Citrus Sinensis ID: 001973

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------99
MVNDLLEGVHLIASVEAISLGVQFGIHPWVLYDIISNAAGNSWIFKNYIPNLLRGDAKLHFLNAFIQNLGIALDMAKTLAFPLPLLAVAHQQLILGLSHAHANDDNPPLVKVWENVLGVNITDAANLEAYKPEELAKQITAKSNSVTRVGFIGLGAMGFGMATHLLRSNFTVIGYDVYRPTLTKFQNVGGLIANSPAEAAKDVGVLVIMVTNEAQAESVLYGDLGAVSALSSGASIILSSTVSPGFVSQLERRLQFEGKDLKLVDAPVSGGVKRASMGELTIMAAGTEESLKSTGSVLSALSEKLYVIKGGCGAGSGVKMANQLLAGVHIASAAEAMAFGARLGLNTRVLFNIITDSGGSSWMFENRVPHMLDNDYTPYSALDIFVKDMGIIARECLSQRVPLHISTIAHQLFLAGSAAGWGRQDDAAVVKVYETLSGVKVEGRLPVLKKEAVLQSLPSEWPLDPIDDIKGLIKKNAKTLIVLDDDPTGTQTVHGIEVLTEWSVASLVEQFRKKPLCFFILTNSRALSSEKASSLITDICRNLRTASNSVENTEYTVVLRGDSTLRGHFPEEADAAVSVLGEMDAWIICPFFLQGGRYTIEDIHYVGDLDQLVPAGDTEFAKDASFGFKSSNLREWVEEKTSGRIPASSVASISIQLLRKGGPDAVCERLCSLQKGSTCIVNAASERDIAVFAAGMIQAELKGKSFLCRTAASFVSARIGIVAKAPILPKDLGNKIESTGGLIVVGSYVPKTTKQVEELISQSGRFIRSVEVSVDKVAMKSLEERQEEIIRAAEMVDVFLQARKDTLLITSRVLITGKTPSESLEINLKVSSAMVEIVRRITTRPRYILAKGGITSSDIATKALEAKRAKVVGQALAGVPLWELGPESRHPGVPYVVFPGNVGDNNAVANVVRSWARPVRISSTKELLLNAEKGEYAVGAFNVYNMEGVEAVVAAAEEERSPAILQVRSTCFKVQYITLVTSSIMNDS
cHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHccccccccHHHHHHHHHHcccccccccccccccHHHHHHHHHcccccccEEEEEEcccccHHHHHHHHHcccEEEEEcccHHHHHHHHHccccccccHHHHHHcccEEEEEcccHHcHHHHHccccHHHcccccccEEEEcccccHHHHHHHHHHHHHcccccccccccccccHHHHccccEEEEEcccHHHHHHHHHHHHHHccccEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHccccccccccccHHHHHHccccccccccHHHHHHHHHHccccEEEEEccccccccccccccccccccHHHHHHHHcccccEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHcccccEEEEEccccccccccHHHHHHHHHHHccccEEEEccccccccEEEcccEEEEccccccccccccccccccccccccccHHHHHHHHcccccccccEEEEEHHHHHcccHHHHHHHHHccccccEEEEEcccHHHHHHHHHHHHHHHHccccEEEEccHHHHHHHHccccccccccccccccccccccEEEEccccccHHHHHHHHHHHccccEEEEEEEcHHHHHHcHHHHHHHHHHHHHHHHHHHHccccEEEEccccccccccHHHHHHHHHHHHHHHHHHHHHccccccEEEEcccccHHHHHHHcccccEEEEcccccccccEEEcccccccccccEEEcccccccccHHHHHHHHHccccccccHHHHHHHcccccEEEEEEEEEccHHHHHHHHHHHHcccccEEEEccccccccccEEEEEEEcccc
cHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHccccHHHHHHccHHHHccccccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHccccccccHHHHHHHHHHccccccccccHccccHHHHHccccccccHHcEEEEEEccHccHHHHHHHHHcccEEEEEcccHHHHHHHHHccccccccHHHHHccccEEEEEEcccHHHHHHEcccccHHHccccccEEEEcccccHHHHHHHHHHHHHccccEEEEEcccccccccccccEEEEEEcccHHHHHHHHHHHHHHHHHEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHccccHHHHHHccHHHHcccccccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHcccccccccccccHHHHHHHccccccccHHHHHHHHHHccccEEEEEcccccccEEEccEEEEEEccHHHHHHHHcccccEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEccccccccccHHHHHHHHHHccccEEEEEHHHcccccEEEccEEEEEEccEEEcccccHHcccccccccccccHHHHHHHccccccHHHHEEEcHHHHHcccHHHHHHHHHHcccccEEEEEcccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccccccccHHHHccccccccEEEEEEccccHHHHHHHHHHHccccEEEEEEEEHHHHHcccHHHHHHHHHHHHHHHHHHHHccccEEEEEccEEEEcccHHHHHHHHHHHHHHHHHHHHcccccccEEEEcccccccHHHHHHHHHcHEEEEEEcccccEEEEcccccccccccEEEEccccccHHHHHHHHHHHccccccccHHHHHHHHHccccEEEEEEEEcHHHHHHHHHHHHHccccEEEEEcHHHHHcccccEEEEEEEccc
MVNDLLEGVHLIASVEAISLGVQFGIHPWVLYDIISnaagnswifknyipnllrgdAKLHFLNAFIQNLGIALDMAKTLAFPLPLLAVAHQQLILGLshahanddnpplVKVWENVLGVnitdaanleaykpeeLAKQItaksnsvtrVGFIGLGAMGFGMATHLLRSNFtvigydvyrptltkfqnvgglianspaeaakdVGVLVIMVTNEAQAESVLYGDLGAVSALSSGASIilsstvspgfvSQLERRLQFEgkdlklvdapvsggvkrasmgELTIMAAGTEESLKSTGSVLSALSEKLYVIkggcgagsgVKMANQLLAGVHIASAAEAMAFGARLGLNTRVLFNIItdsggsswmfenrvphmldndytpysalDIFVKDMGIIAreclsqrvplHISTIAHQLFLagsaagwgrqddAAVVKVYETLsgvkvegrlpvlkKEAVlqslpsewpldpiddiKGLIKKNAKTlivldddptgtqtvhgiEVLTEWSVASLVEQFRKKplcffiltnsralsseKASSLITDICRNLRtasnsventEYTVVLRgdstlrghfpeEADAAVSVLGEMDawiicpfflqggrytiedihyvgdldqlvpagdtefakdasfgfkssnLREWVEektsgripassvASISIQLLRKGGPDAVCERLCSLQKGSTCIVNAASERDIAVFAAGMIQAELKGKSFLCRTAASFVSARIGivakapilpkdlgnkiestgglivvgsyvpktTKQVEELISQSGRFIRSVEVSVDKVAMKSLEERQEEIIRAAEMVDVFLQARKDTLLITSRvlitgktpseslEINLKVSSAMVEIVRRITTrpryilakggitsSDIATKALEAKRAKVVGQAlagvplwelgpesrhpgvpyvvfpgnvgdnnavANVVRswarpvrisSTKELLLNAEKGEYAVGAFNVYNMEGVEAVVAAAEEERSPAILQVRSTCFKVQYITLVTSSIMNDS
MVNDLLEGVHLIASVEAISLGVQFGIHPWVLYDIISNAAGNSWIFKNYIPNLLRGDAKLHFLNAFIQNLGIALDMAKTLAFPLPLLAVAHQQLILGLSHAHANDDNPPLVKVWENVLGVNITDAANLEAYKPEELAkqitaksnsVTRVGFIGLGAMGFGMATHLLRSNFTVIGYDVYRPTLTKFQNVGGLIANSPAEAAKDVGVLVIMVTNEAQAESVLYGDLGAVSALSSGASIILSSTVSPGFVSQLERRLQFegkdlklvdapvsggvkraSMGELTIMAAGTEESLKSTGSVLSALSEKLYVIKGGCGAGSGVKMANQLLAGVHIASAAEAMAFGARLGLNTRVLFNIITDSGGSSWMFENRVPHMLDNDYTPYSALDIFVKDMGIIARECLSQRVPLHISTIAHQLFLAGSAAGWGRQDDAAVVKVYETlsgvkvegrlpvLKKEavlqslpsewpldpiDDIKGLIKKNAKTlivldddptgtQTVHGIEVLTEWSVASLVEQFRKKPLCFFILTnsralssekasSLITDICRNlrtasnsventeyTVVLRGDSTLRGHFPEEADAAVSVLGEMDAWIICPFFLQGGRYTIEDIHYVGDLDQLVPAGDTEFAKDAsfgfkssnlREWVEEktsgripassvaSISIQLLRKGGPDAVCERLCSLQKGSTCIVNAASERDIAVFAAGMIQAELKGKSFLCRTAASFVSarigivakapilpkdlgnkieSTGGLIVVGSYVPKTTKQVEELisqsgrfirsvevsvdkVAMKSLEERQEEIIRAAEMVDVFLQARKDTLLITsrvlitgktpsesleinlkvssAMVEIVRrittrpryilakggitssDIATKALEAKRAKVVGQALAGVPLWELGPESRHPGVPYVVFPGNVGDNNAVANVVRSWARPVRISSTKELLLNAEKGEYAVGAFNVYNMEGVEAVVAAAEEERSPAILQVRSTCFKVQYITLVTSSIMNDS
MVNDLLEGVHLIASVEAISLGVQFGIHPWVLYDIISNAAGNSWIFKNYIPNLLRGDAKLHFLNAFIQNLGIALDMAKTLAFPLPLLAVAHQQLILGLSHAHANDDNPPLVKVWENVLGVNITDAANLEAYKPEELAKQITAKSNSVTRVGFIGLGAMGFGMATHLLRSNFTVIGYDVYRPTLTKFQNVGGLIANSPAEAAKDVGVLVIMVTNEAQAESVLYGDlgavsalssgasiilsstvsPGFVSQLERRLQFEGKDLKLVDAPVSGGVKRASMGELTIMAAGTEESLKSTGSVLSALSEKLYVIKGGCGAGSGVKMANQLLAGVHIASAAEAMAFGARLGLNTRVLFNIITDSGGSSWMFENRVPHMLDNDYTPYSALDIFVKDMGIIARECLSQRVPLHISTIAHQLFLAGSAAGWGRQDDAAVVKVYETLSGVKVEGRLPVLKKEAVLQSLPSEWPLDPIDDIKGLIKKNAKTLIVLDDDPTGTQTVHGIEVLTEWSVASLVEQFRKKPLCFFILTNSRALSSEKASSLITDICRNLRTASNSVENTEYTVVLRGDSTLRGHFPEEADAAVSVLGEMDAWIICPFFLQGGRYTIEDIHYVGDLDQLVPAGDTEFAKDASFGFKSSNLREWVEEKTSGRIPASSVASISIQLLRKGGPDAVCERLCSLQKGSTCIVNAASERDIAVFAAGMIQAELKGKSFLCRTAASFVSARIGIVAKAPILPKDLGNKIESTGGLIVVGSYVPKTTKQVEELISQSGRFIRSVEVSVDKVAMKSLeerqeeiiraaeMVDVFLQARKDTLLITSRVLITGKTPSESLEINLKVSSAMVEIVRRITTRPRYILAKGGITSSDIATKALEAKRAKVVGQALAGVPLWELGPESRHPGVPYVVFPgnvgdnnavanvvRSWARPVRISSTKELLLNAEKGEYAVGAFNVYNMEGveavvaaaeeeRSPAILQVRSTCFKVQYITLVTSSIMNDS
****LLEGVHLIASVEAISLGVQFGIHPWVLYDIISNAAGNSWIFKNYIPNLLRGDAKLHFLNAFIQNLGIALDMAKTLAFPLPLLAVAHQQLILGLSHAHANDDNPPLVKVWENVLGVNITDAANLEAYKPEELAKQITAKSNSVTRVGFIGLGAMGFGMATHLLRSNFTVIGYDVYRPTLTKFQNVGGLIANSPAEAAKDVGVLVIMVTNEAQAESVLYGDLGAVSALSSGASIILSSTVSPGFVSQLERRLQFEGKDLKLVDAPVS**********LTIM************SVLSALSEKLYVIKGGCGAGSGVKMANQLLAGVHIASAAEAMAFGARLGLNTRVLFNIITDSGGSSWMFENRVPHMLDNDYTPYSALDIFVKDMGIIARECLSQRVPLHISTIAHQLFLAGSAAGWGRQDDAAVVKVYETLSGVKVEGRLPVLKKEAVLQSLPSEWPLDPIDDIKGLIKKNAKTLIVLDDDPTGTQTVHGIEVLTEWSVASLVEQFRKKPLCFFILTNSRALSSEKASSLITDICRNLRTASNSVENTEYTVVLRGDSTLRGHFPEEADAAVSVLGEMDAWIICPFFLQGGRYTIEDIHYVGDLDQLVPAGDTEFAKDASFGFKSSNLREWV***********SVASISIQLLRKGGPDAVCERLCSLQKGSTCIVNAASERDIAVFAAGMIQAELKGKSFLCRTAASFVSARIGIVAKAPILPKDLGNKIESTGGLIVVGSYVPKTTKQVEELISQSGRFIRSVEVSVDKVAMKSL**RQEEIIRAAEMVDVFLQARKDTLLITSRVLITGKTPSESLEINLKVSSAMVEIVRRITTRPRYILAKGGITSSDIATKALEAKRAKVVGQALAGVPLWELGPESRHPGVPYVVFPGNVGDNNAVANVVRSWARPVRISSTKELLLNAEKGEYAVGAFNVYNMEGVEAVVAAAEEERSPAILQVRSTCFKVQYITLVTS******
MVNDLLEGVHLIASVEAISLGVQFGIHPWVLYDIISNAAGNSWIFKNYIPNLLRGDAKLHFLNAFIQNLGIALDMAKTLAFPLPLLAVAHQQLILGLSHAHANDDNPPLVKVWENVLGV**************************VTRVGFIGLGAMGFGMATHLLRSNFTVIGYDVYRPTLTKFQNVGGLIANSPAEAAKDVGVLVIMVTNEAQAESVLYGDLGAVSALSSGASIILSSTVSPGFVSQLERRLQFEGKDLKLVDAPVSGGVKRASMGELTIMAAGTEESLKSTGSVLSALSEKLYVIKGGCGAGSGVKMANQLLAGVHIASAAEAMAFGARLGLNTRVLFNIITDSGGSSWMFENRVPHMLDNDYTPYSALDIFVKDMGIIARECLSQRVPLHISTIAHQLFLAGSAAGWGRQDDAAVVKVYETLSGV*******************SEWPLDPIDDIKGLIKKNAKTLIVLDDDPTGTQTVHGIEVLTEWSVASLVEQFRKKPLCFFILTNSRALSSEKASSLITDICRNLRTASNSVENTEYTVVLRGDSTLRGHFPEEADAAVSVLGEMDAWIICPFFLQGGRYTIEDIHYVGDLDQLVPAGDTEFAKDASFGFKSSNLREWVEEKTSGRIPASSVASISIQLLRKGGPDAVCERLCSLQKGSTCIVNAASERDIAVFAAGMIQAELKGKSFLCRTAASFVSARIGI*****************TGGLIVVGSYVPKTTKQVEELISQSGRFIRSVEVSVDKVAMKS***RQEEIIRAAEMVDVFLQARKDTLLITSRVLIT***PSESLEINLKVSSAMVEIVRRITTRPRYILAKGGITSSDIATKALEAKRAKVVGQALAGVPLWELGPESRHPGVPYVVFPGNVGDNNAVANVVRSWAR*************AEKGEYAVGAFNVYNMEGVEAVVAAAEEERSPAILQVRSTCFKVQYITLVTSSIMND*
MVNDLLEGVHLIASVEAISLGVQFGIHPWVLYDIISNAAGNSWIFKNYIPNLLRGDAKLHFLNAFIQNLGIALDMAKTLAFPLPLLAVAHQQLILGLSHAHANDDNPPLVKVWENVLGVNITDAANLEAYKPEELAKQITAKSNSVTRVGFIGLGAMGFGMATHLLRSNFTVIGYDVYRPTLTKFQNVGGLIANSPAEAAKDVGVLVIMVTNEAQAESVLYGDLGAVSALSSGASIILSSTVSPGFVSQLERRLQFEGKDLKLVDAPVSGGVKRASMGELTIMAAGTEESLKSTGSVLSALSEKLYVIKGGCGAGSGVKMANQLLAGVHIASAAEAMAFGARLGLNTRVLFNIITDSGGSSWMFENRVPHMLDNDYTPYSALDIFVKDMGIIARECLSQRVPLHISTIAHQLFLAGSAAGWGRQDDAAVVKVYETLSGVKVEGRLPVLKKEAVLQSLPSEWPLDPIDDIKGLIKKNAKTLIVLDDDPTGTQTVHGIEVLTEWSVASLVEQFRKKPLCFFILTNSRALSSEKASSLITDICRNLRTASNSVENTEYTVVLRGDSTLRGHFPEEADAAVSVLGEMDAWIICPFFLQGGRYTIEDIHYVGDLDQLVPAGDTEFAKDASFGFKSSNLREWV*********ASSVASISIQLLRKGGPDAVCERLCSLQKGSTCIVNAASERDIAVFAAGMIQAELKGKSFLCRTAASFVSARIGIVAKAPILPKDLGNKIESTGGLIVVGSYVPKTTKQVEELISQSGRFIRSVEVSVDKVAMKSLEERQEEIIRAAEMVDVFLQARKDTLLITSRVLITGKTPSESLEINLKVSSAMVEIVRRITTRPRYILAKGGITSSDIATKALEAKRAKVVGQALAGVPLWELGPESRHPGVPYVVFPGNVGDNNAVANVVRSWARPVRISSTKELLLNAEKGEYAVGAFNVYNMEGVEAVVAAAEEERSPAILQVRSTCFKVQYITLVTSSIMNDS
MVNDLLEGVHLIASVEAISLGVQFGIHPWVLYDIISNAAGNSWIFKNYIPNLLRGDAKLHFLNAFIQNLGIALDMAKTLAFPLPLLAVAHQQLILGLSHAHANDDNPPLVKVWENVLGVNITDAANLEAYKPEELAKQITAKSNSVTRVGFIGLGAMGFGMATHLLRSNFTVIGYDVYRPTLTKFQNVGGLIANSPAEAAKDVGVLVIMVTNEAQAESVLYGDLGAVSALSSGASIILSSTVSPGFVSQLERRLQFEGKDLKLVDAPVSGGVKRASMGELTIMAAGTEESLKSTGSVLSALSEKLYVIKGGCGAGSGVKMANQLLAGVHIASAAEAMAFGARLGLNTRVLFNIITDSGGSSWMFENRVPHMLDNDYTPYSALDIFVKDMGIIARECLSQRVPLHISTIAHQLFLAGSAAGWGRQDDAAVVKVYETLSGVKVEGRLPVLKKEAVLQSLPSEWPLDPIDDIKGLIKKNAKTLIVLDDDPTGTQTVHGIEVLTEWSVASLVEQFRKKPLCFFILTNSRALSSEKASSLITDICRNLRTASNSVENTEYTVVLRGDSTLRGHFPEEADAAVSVLGEMDAWIICPFFLQGGRYTIEDIHYVGDLDQLVPAGDTEFAKDASFGFKSSNLREWVEEKTSGRIPASSVASISIQLLRKGGPDAVCERLCSLQKGSTCIVNAASERDIAVFAAGMIQAELKGKSFLCRTAASFVSARIGIVAKAPILPKDLGNKIESTGGLIVVGSYVPKTTKQVEELISQSGRFIRSVEVSVDKVAMKSLEERQEEIIRAAEMVDVFLQARKDTLLITSRVLITGKTPSESLEINLKVSSAMVEIVRRITTRPRYILAKGGITSSDIATKALEAKRAKVVGQALAGVPLWELGPESRHPGVPYVVFPGNVGDNNAVANVVRSWARPVRISSTKELLLNAEKGEYAVGAFNVYNMEGVEAVVAAAEEERSPAILQVRSTCFKVQYITLVTSSIMND*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVNDLLEGVHLIASVEAISLGVQFGIHPWVLYDIISNAAGNSWIFKNYIPNLLRGDAKLHFLNAFIQNLGIALDMAKTLAFPLPLLAVAHQQLILGLSHAHANDDNPPLVKVWENVLGVNITDAANLEAYKPEELAKQITAKSNSVTRVGFIGLGAMGFGMATHLLRSNFTVIGYDVYRPTLTKFQNVGGLIANSPAEAAKDVGVLVIMVTNEAQAESVLYGDLGAVSALSSGASIILSSTVSPGFVSQLERRLQFEGKDLKLVDAPVSGGVKRASMGELTIMAAGTEESLKSTGSVLSALSEKLYVIKGGCGAGSGVKMANQLLAGVHIASAAEAMAFGARLGLNTRVLFNIITDSGGSSWMFENRVPHMLDNDYTPYSALDIFVKDMGIIARECLSQRVPLHISTIAHQLFLAGSAAGWGRQDDAAVVKVYETLSGVKVEGRLPVLKKEAVLQSLPSEWPLDPIDDIKGLIKKNAKTLIVLDDDPTGTQTVHGIEVLTEWSVASLVEQFRKKPLCFFILTNSRALSSEKASSLITDICRNLRTASNSVENTEYTVVLRGDSTLRGHFPEEADAAVSVLGEMDAWIICPFFLQGGRYTIEDIHYVGDLDQLVPAGDTEFAKDASFGFKSSNLREWVEEKTSGRIPASSVASISIQLLRKGGPDAVCERLCSLQKGSTCIVNAASERDIAVFAAGMIQAELKGKSFLCRTAASFVSARIGIVAKAPILPKDLGNKIESTGGLIVVGSYVPKTTKQVEELISQSGRFIRSVEVSVDKVAMKSLEERQEEIIRAAEMVDVFLQARKDTLLITSRVLITGKTPSESLEINLKVSSAMVEIVRRITTRPRYILAKGGITSSDIATKALEAKRAKVVGQALAGVPLWELGPESRHPGVPYVVFPGNVGDNNAVANVVRSWARPVRISSTKELLLNAEKGEYAVGAFNVYNMEGVEAVVAAAEEERSPAILQVRSTCFKVQYITLVTSSIMNDS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query988 2.2.26 [Sep-21-2011]
Q46888302 Uncharacterized oxidoredu N/A no 0.300 0.983 0.397 3e-54
P44979301 Uncharacterized oxidoredu yes no 0.295 0.970 0.386 2e-49
Q0QLF5301 2-(hydroxymethyl)glutarat N/A no 0.296 0.973 0.350 1e-37
P31937336 3-hydroxyisobutyrate dehy yes no 0.287 0.845 0.312 2e-34
Q5R5E7336 3-hydroxyisobutyrate dehy yes no 0.287 0.845 0.312 2e-34
Q99L13335 3-hydroxyisobutyrate dehy yes no 0.287 0.847 0.309 2e-33
P29266335 3-hydroxyisobutyrate dehy yes no 0.286 0.844 0.311 3e-33
Q2HJD7336 3-hydroxyisobutyrate dehy yes no 0.287 0.845 0.312 5e-33
Q9V8M5324 Probable 3-hydroxyisobuty yes no 0.276 0.842 0.280 3e-26
O34948288 Uncharacterized oxidoredu yes no 0.254 0.871 0.300 5e-26
>sp|Q46888|YGBJ_ECOLI Uncharacterized oxidoreductase YgbJ OS=Escherichia coli (strain K12) GN=ygbJ PE=3 SV=1 Back     alignment and function desciption
 Score =  214 bits (545), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 120/302 (39%), Positives = 196/302 (64%), Gaps = 5/302 (1%)

Query: 142 KSNSVTRVGFIGLGAMGFGMATHLLRSNFTVIGYDVYRPTLTKFQNVGGL-IANSPAEAA 200
           K+ S   VG +GLG+MG G A   +R+  +  G D+        +  G   ++++ A  A
Sbjct: 2   KTGSEFHVGIVGLGSMGMGAALSYVRAGLSTWGADLNSNACATLKEAGACGVSDNAATFA 61

Query: 201 KDVGVLVIMVTNEAQAESVLYGDLGAVSALSSGASIILSSTVSPGFVSQLERRLQFEGKD 260
           + +  L+++V N AQ + VL+G+ G    L  G ++++SST++     ++   L   G D
Sbjct: 62  EKLDALLVLVVNAAQVKQVLFGETGVAQHLKPGTAVMVSSTIASADAQEIATALA--GFD 119

Query: 261 LKLVDAPVSGGVKRASMGELTIMAAGTEESLKSTGSVLSALSEKLYVIKGGCGAGSGVKM 320
           L+++DAPVSGG  +A+ GE+T+MA+G++ + +    VL A++ K+Y I    G GS VK+
Sbjct: 120 LEMLDAPVSGGAVKAANGEMTVMASGSDIAFERLAPVLEAVAGKVYRIGAEPGLGSTVKI 179

Query: 321 ANQLLAGVHIASAAEAMAFGARLGLNTRVLFNIITDSGGSSWMFENRVPHMLDNDYTPYS 380
            +QLLAGVHIA+ AEAMA  AR G+   V+++++T++ G+SWMFENR+ H++D DYTP+S
Sbjct: 180 IHQLLAGVHIAAGAEAMALAARAGIPLDVMYDVVTNAAGNSWMFENRMRHVVDGDYTPHS 239

Query: 381 ALDIFVKDMGIIARECLSQRVPLHISTIAHQLFLAGSAAGWGRQDDAAVVKVYE--TLSG 438
           A+DIFVKD+G++A    +   PL +++ A  +F + S AG+G++DD+AV+K++   TL G
Sbjct: 240 AVDIFVKDLGLVADTAKALHFPLPLASTALNMFTSASNAGYGKEDDSAVIKIFSGITLPG 299

Query: 439 VK 440
            K
Sbjct: 300 AK 301

Escherichia coli (strain K12) (taxid: 83333)
EC: 1EC: .EC: 1EC: .EC: -EC: .EC: -
>sp|P44979|Y1010_HAEIN Uncharacterized oxidoreductase HI_1010 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1010 PE=3 SV=1 Back     alignment and function description
>sp|Q0QLF5|HMGD_EUBBA 2-(hydroxymethyl)glutarate dehydrogenase OS=Eubacterium barkeri GN=Hgd PE=1 SV=1 Back     alignment and function description
>sp|P31937|3HIDH_HUMAN 3-hydroxyisobutyrate dehydrogenase, mitochondrial OS=Homo sapiens GN=HIBADH PE=1 SV=2 Back     alignment and function description
>sp|Q5R5E7|3HIDH_PONAB 3-hydroxyisobutyrate dehydrogenase, mitochondrial OS=Pongo abelii GN=HIBADH PE=2 SV=1 Back     alignment and function description
>sp|Q99L13|3HIDH_MOUSE 3-hydroxyisobutyrate dehydrogenase, mitochondrial OS=Mus musculus GN=Hibadh PE=2 SV=1 Back     alignment and function description
>sp|P29266|3HIDH_RAT 3-hydroxyisobutyrate dehydrogenase, mitochondrial OS=Rattus norvegicus GN=Hibadh PE=1 SV=3 Back     alignment and function description
>sp|Q2HJD7|3HIDH_BOVIN 3-hydroxyisobutyrate dehydrogenase, mitochondrial OS=Bos taurus GN=HIBADH PE=2 SV=1 Back     alignment and function description
>sp|Q9V8M5|3HIDH_DROME Probable 3-hydroxyisobutyrate dehydrogenase, mitochondrial OS=Drosophila melanogaster GN=CG15093 PE=2 SV=2 Back     alignment and function description
>sp|O34948|YKWC_BACSU Uncharacterized oxidoreductase YkwC OS=Bacillus subtilis (strain 168) GN=ykwC PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query988
359491523 1377 PREDICTED: uncharacterized protein LOC10 0.990 0.710 0.785 0.0
297734349 1509 unnamed protein product [Vitis vinifera] 0.990 0.648 0.785 0.0
297850224 1376 ketose-bisphosphate aldolase class-II fa 0.994 0.714 0.759 0.0
186478598 1374 ketose-bisphosphate aldolase class-II-li 0.994 0.715 0.757 0.0
22329645 1373 ketose-bisphosphate aldolase class-II-li 0.994 0.715 0.757 0.0
334182667 1393 ketose-bisphosphate aldolase class-II-li 0.994 0.705 0.742 0.0
449439145 1372 PREDICTED: uncharacterized protein LOC10 0.994 0.716 0.722 0.0
8671773 1486 T10O22.24 [Arabidopsis thaliana] 0.994 0.661 0.695 0.0
356522861 1376 PREDICTED: uncharacterized protein LOC10 0.994 0.714 0.723 0.0
6714293 1197 F15H18.21 [Arabidopsis thaliana] 0.936 0.772 0.703 0.0
>gi|359491523|ref|XP_002278967.2| PREDICTED: uncharacterized protein LOC100262718 [Vitis vinifera] Back     alignment and taxonomy information
 Score = 1550 bits (4013), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 771/981 (78%), Positives = 865/981 (88%), Gaps = 2/981 (0%)

Query: 1    MVNDLLEGVHLIASVEAISLGVQFGIHPWVLYDIISNAAGNSWIFKNYIPNLLRGD-AKL 59
            MVN LLEG+HL+AS EAI+LGVQ GIHPW++YDII+NAAGNSW+FKN++P LLRG+  K 
Sbjct: 179  MVNGLLEGIHLVASAEAIALGVQAGIHPWIIYDIIANAAGNSWVFKNHVPQLLRGNLTKQ 238

Query: 60   HFLNAFIQNLGIALDMAKTLAFPLPLLAVAHQQLILGLSHAHANDDNPPLVKVWENVLGV 119
            HFLN  +QN+G  LDMAK+L FPLPLLAVAHQQLI G S+ H ++D   LVKVWE V GV
Sbjct: 239  HFLNTAVQNVGSILDMAKSLPFPLPLLAVAHQQLISGSSYGHGHND-ATLVKVWEKVFGV 297

Query: 120  NITDAANLEAYKPEELAKQITAKSNSVTRVGFIGLGAMGFGMATHLLRSNFTVIGYDVYR 179
            N+T AAN E Y P EL  QITAK  +V RVGFIGLGAMGFGMAT LL+SNF V+G+DVY+
Sbjct: 298  NLTAAANAEIYSPLELGSQITAKPKTVKRVGFIGLGAMGFGMATSLLKSNFCVLGFDVYK 357

Query: 180  PTLTKFQNVGGLIANSPAEAAKDVGVLVIMVTNEAQAESVLYGDLGAVSALSSGASIILS 239
            PTL++F N GGL+  SPAE +KDV VLVIMVTNEAQAESVL+GDLGAV  L  GASIILS
Sbjct: 358  PTLSRFANAGGLVGESPAEVSKDVDVLVIMVTNEAQAESVLFGDLGAVKVLPPGASIILS 417

Query: 240  STVSPGFVSQLERRLQFEGKDLKLVDAPVSGGVKRASMGELTIMAAGTEESLKSTGSVLS 299
            STVSPGFV QLERRL+ E K+LKLVDAPVSGGVKRASMG LTI+A+GT+E+L S GSVLS
Sbjct: 418  STVSPGFVIQLERRLKNENKNLKLVDAPVSGGVKRASMGTLTIIASGTDEALTSAGSVLS 477

Query: 300  ALSEKLYVIKGGCGAGSGVKMANQLLAGVHIASAAEAMAFGARLGLNTRVLFNIITDSGG 359
            ALSEKLY+I+GGCG+GS VKM NQLLAGVHIA++AEAMA GARLGLNTR LF+ IT+SGG
Sbjct: 478  ALSEKLYIIRGGCGSGSAVKMVNQLLAGVHIAASAEAMAIGARLGLNTRKLFDFITNSGG 537

Query: 360  SSWMFENRVPHMLDNDYTPYSALDIFVKDMGIIARECLSQRVPLHISTIAHQLFLAGSAA 419
            +SWMFENR PHML+NDYTP SALDIFVKD+GI++ EC S +VPL +ST+AHQLFL+GSAA
Sbjct: 538  TSWMFENRTPHMLNNDYTPCSALDIFVKDLGIVSHECSSYKVPLLLSTVAHQLFLSGSAA 597

Query: 420  GWGRQDDAAVVKVYETLSGVKVEGRLPVLKKEAVLQSLPSEWPLDPIDDIKGLIKKNAKT 479
            GWGR DDAAVVKVYETL+GVKVEG+LPV+KKE VL SLP EWP DPIDDI+ L + N KT
Sbjct: 598  GWGRYDDAAVVKVYETLTGVKVEGKLPVVKKEEVLHSLPPEWPSDPIDDIRTLDQSNLKT 657

Query: 480  LIVLDDDPTGTQTVHGIEVLTEWSVASLVEQFRKKPLCFFILTNSRALSSEKASSLITDI 539
            LIVLDDDPTGTQTVH IEVLTEW+V  LVEQFRK+P CFFILTNSRAL+ EKA++LI DI
Sbjct: 658  LIVLDDDPTGTQTVHDIEVLTEWNVEPLVEQFRKRPKCFFILTNSRALTPEKATALIKDI 717

Query: 540  CRNLRTASNSVENTEYTVVLRGDSTLRGHFPEEADAAVSVLGEMDAWIICPFFLQGGRYT 599
            C N+R A+NSV N +YTVVLRGDSTLRGHFPEEA+AAVSVLGEMDAWIICPFFLQGGRYT
Sbjct: 718  CTNIRNAANSVGNIDYTVVLRGDSTLRGHFPEEANAAVSVLGEMDAWIICPFFLQGGRYT 777

Query: 600  IEDIHYVGDLDQLVPAGDTEFAKDASFGFKSSNLREWVEEKTSGRIPASSVASISIQLLR 659
            I+DIHYV D D+LVPAGDTEFAKDASFG+KSSNLREWVEEKT GRIPASSV SISIQLLR
Sbjct: 778  IDDIHYVADSDRLVPAGDTEFAKDASFGYKSSNLREWVEEKTIGRIPASSVTSISIQLLR 837

Query: 660  KGGPDAVCERLCSLQKGSTCIVNAASERDIAVFAAGMIQAELKGKSFLCRTAASFVSARI 719
            KGGPDAVC  LCSLQKGSTCIVNAASERD+AVFAAGMIQAE KGK FLCRTAASFVSARI
Sbjct: 838  KGGPDAVCMHLCSLQKGSTCIVNAASERDMAVFAAGMIQAERKGKHFLCRTAASFVSARI 897

Query: 720  GIVAKAPILPKDLGNKIESTGGLIVVGSYVPKTTKQVEELISQSGRFIRSVEVSVDKVAM 779
            GI+ KAPILPKDLG   E  GGLIVVGSYVPKTTKQVEEL  Q G+ +RS+E+SVDK+AM
Sbjct: 898  GIIPKAPILPKDLGINKERNGGLIVVGSYVPKTTKQVEELKLQCGQILRSIEISVDKLAM 957

Query: 780  KSLEERQEEIIRAAEMVDVFLQARKDTLLITSRVLITGKTPSESLEINLKVSSAMVEIVR 839
            KS EER+EEI RAAEM DVFL+A KDTL++TSR LITGK+PSESLEIN KVSSA+VEIVR
Sbjct: 958  KSSEEREEEISRAAEMADVFLRASKDTLIMTSRELITGKSPSESLEINFKVSSALVEIVR 1017

Query: 840  RITTRPRYILAKGGITSSDIATKALEAKRAKVVGQALAGVPLWELGPESRHPGVPYVVFP 899
            RITTRPRYILAKGGITSSD+ATKALEA+RAKVVGQALAGVPLW+LGPESRHPGVPY+VFP
Sbjct: 1018 RITTRPRYILAKGGITSSDLATKALEARRAKVVGQALAGVPLWQLGPESRHPGVPYIVFP 1077

Query: 900  GNVGDNNAVANVVRSWARPVRISSTKELLLNAEKGEYAVGAFNVYNMEGVEAVVAAAEEE 959
            GNVGD+ A+A+VV+SW RP R+SSTK LLL+AE+G YAVGAFNVYN+EGVEAVVAAAEEE
Sbjct: 1078 GNVGDSKALADVVKSWVRPFRLSSTKGLLLDAERGGYAVGAFNVYNLEGVEAVVAAAEEE 1137

Query: 960  RSPAILQVRSTCFKVQYITLV 980
            +SPAILQ+  +  K   I LV
Sbjct: 1138 QSPAILQIHPSALKQGGIPLV 1158

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|297734349|emb|CBI15596.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|297850224|ref|XP_002892993.1| ketose-bisphosphate aldolase class-II family protein [Arabidopsis lyrata subsp. lyrata] gi|297338835|gb|EFH69252.1| ketose-bisphosphate aldolase class-II family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|186478598|ref|NP_001117303.1| ketose-bisphosphate aldolase class-II-like protein [Arabidopsis thaliana] gi|332191574|gb|AEE29695.1| ketose-bisphosphate aldolase class-II-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|22329645|ref|NP_173263.2| ketose-bisphosphate aldolase class-II-like protein [Arabidopsis thaliana] gi|18176246|gb|AAL60010.1| unknown protein [Arabidopsis thaliana] gi|22136930|gb|AAM91809.1| unknown protein [Arabidopsis thaliana] gi|332191573|gb|AEE29694.1| ketose-bisphosphate aldolase class-II-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|334182667|ref|NP_001185028.1| ketose-bisphosphate aldolase class-II-like protein [Arabidopsis thaliana] gi|332191575|gb|AEE29696.1| ketose-bisphosphate aldolase class-II-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449439145|ref|XP_004137348.1| PREDICTED: uncharacterized protein LOC101221907 [Cucumis sativus] Back     alignment and taxonomy information
>gi|8671773|gb|AAF78379.1|AC069551_12 T10O22.24 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356522861|ref|XP_003530061.1| PREDICTED: uncharacterized protein LOC100779987 [Glycine max] Back     alignment and taxonomy information
>gi|6714293|gb|AAF25989.1|AC013354_8 F15H18.21 [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query988
ASPGD|ASPL0000062319488 AN0873 [Emericella nidulans (t 0.475 0.963 0.457 9.5e-105
UNIPROTKB|G4NEV0493 MGG_00039 "Uncharacterized pro 0.473 0.949 0.452 2.7e-100
UNIPROTKB|Q48PA9301 PSPPH_0457 "3-hydroxyisobutyra 0.285 0.936 0.447 3.1e-60
UNIPROTKB|Q46888302 ygbJ "predicted dehydrogenase, 0.300 0.983 0.377 3.7e-53
ASPGD|ASPL0000044129434 AN2335 [Emericella nidulans (t 0.288 0.656 0.394 2.8e-52
UNIPROTKB|G4NKB0444 MGG_03097 "Oxidoreductase" [Ma 0.288 0.641 0.410 2.1e-51
UNIPROTKB|Q2KEY5558 MGCH7_ch7g901 "Putative unchar 0.288 0.510 0.410 2.1e-51
TIGR_CMR|SPO_2560299 SPO_2560 "2-hydroxy-3-oxopropi 0.293 0.969 0.363 2.4e-45
UNIPROTKB|Q0QLF5301 Hgd "2-(hydroxymethyl)glutarat 0.296 0.973 0.323 3.3e-35
UNIPROTKB|P31937336 HIBADH "3-hydroxyisobutyrate d 0.285 0.839 0.294 6.4e-31
ASPGD|ASPL0000062319 AN0873 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
 Score = 1037 (370.1 bits), Expect = 9.5e-105, P = 9.5e-105
 Identities = 222/485 (45%), Positives = 299/485 (61%)

Query:   446 PVLKKEAVLQSLPSEWPLDPIDDIKGLIKKNAKT---LIVLDDDPTGTQTVHGIEVLTEW 502
             P L     L +LP E+  D +  I   +   + T   L+VLDDDPTGTQT H I VLT W
Sbjct:     5 PPLPLTQTLSTLPPEYSTDTLSQIATYLFSTSTTPRRLVVLDDDPTGTQTCHDISVLTVW 64

Query:   503 SVASLVEQFRKKPLCFFILTNSRALSSEKASSLITDICRNLRTAS--NSVENTEYTVVLR 560
              V +LV +F      FFILTNSRAL  ++A  LI +IC+N+ TA+    +      +VLR
Sbjct:    65 DVRTLVAEFSTNSAGFFILTNSRALPPDEAELLIREICQNVLTAALEMGLSRESLDIVLR 124

Query:   561 GDSTLRGHFPEEADAAVSV---LGEMDA----WIICPFFLQGGRYTIEDIHYVGDLDQLV 613
             GDSTLRGHFP E D A SV   + + +A    W++ PFF QGGRYTI D+HYV + + LV
Sbjct:   125 GDSTLRGHFPLEVDVAQSVFYSVSDENATAPTWVLAPFFFQGGRYTINDVHYVLEGEDLV 184

Query:   614 PAGDTEFAKDASFGFKSSNLREWVEEKTSGRIPASSVASISIQLLRKGGPDAVCERLCSL 673
             PAG T+FA+DA+FG+KSSNLR+++ EK  GR  A  + S+++  +R GGP+ V +RL S 
Sbjct:   185 PAGQTQFARDATFGYKSSNLRDYILEKAPGRFTAEQIHSVTLNDIRTGGPEGVRDRLLSF 244

Query:   674 QKGSTCIVNAASERDIAVFAAGMIQAELKGKSFLCRTAASFVSARIGIVAKAPILPKDLG 733
               G   I NAA+E D+ VF  G++ AE KG  ++ RT A+FVS R+GI  K PI   +L 
Sbjct:   245 PAGGIVIANAAAESDMHVFVMGLLLAEAKGLRYIYRTGAAFVSTRLGIPHKPPITKAELQ 304

Query:   734 -NKIESTGGLIVVGSYVPKTTKQVEELISQSGRFIRSVEVSVDKVAMKSLXXXXXXXXXX 792
                 + TGGL++VGSYVPKTT Q++ LI + G  +  +E+ V+ + ++S           
Sbjct:   305 LPNPQQTGGLVLVGSYVPKTTAQLKVLIERRGDLLSVIEMRVEDL-IESKEKAAEVIQSV 363

Query:   793 XXMVDVFLQARKDTLLITSRVLITGKTPSESLEINLKVSSAMVEIVRRITTRPRYILAKG 852
                 + +L A KDTL++TSR L+ G     SL+I  +V+ A+V ++  I  RPRY++AKG
Sbjct:   364 ITQTESYLNAGKDTLVMTSRALVKGDDEISSLKIGSRVAEALVGVLEGIEVRPRYVIAKG 423

Query:   853 GITSSDIATKALEAKRAKVVGQALAGVPLWELGPE-SRHPGVPYVVFPXXXXXXXXXXXX 911
             GITSSD ATK L  KRA +VGQA AGVPLW    E SRH GVP+VVFP            
Sbjct:   424 GITSSDAATKGLRMKRALIVGQAAAGVPLWRCYEETSRHRGVPFVVFPGNVGSESTLYEL 483

Query:   912 XRSWA 916
               +W+
Sbjct:   484 VEAWS 488
GO:0005575 "cellular_component" evidence=ND
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0016491 "oxidoreductase activity" evidence=IEA
UNIPROTKB|G4NEV0 MGG_00039 "Uncharacterized protein" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
UNIPROTKB|Q48PA9 PSPPH_0457 "3-hydroxyisobutyrate dehydrogenase family protein" [Pseudomonas syringae pv. phaseolicola 1448A (taxid:264730)] Back     alignment and assigned GO terms
UNIPROTKB|Q46888 ygbJ "predicted dehydrogenase, with NAD(P)-binding Rossmann-fold domain" [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
ASPGD|ASPL0000044129 AN2335 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
UNIPROTKB|G4NKB0 MGG_03097 "Oxidoreductase" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
UNIPROTKB|Q2KEY5 MGCH7_ch7g901 "Putative uncharacterized protein" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_2560 SPO_2560 "2-hydroxy-3-oxopropionate reductase" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
UNIPROTKB|Q0QLF5 Hgd "2-(hydroxymethyl)glutarate dehydrogenase" [Eubacterium barkeri (taxid:1528)] Back     alignment and assigned GO terms
UNIPROTKB|P31937 HIBADH "3-hydroxyisobutyrate dehydrogenase, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.1.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query988
PLN02858 1378 PLN02858, PLN02858, fructose-bisphosphate aldolase 0.0
PLN02858 1378 PLN02858, PLN02858, fructose-bisphosphate aldolase 1e-83
COG2084286 COG2084, MmsB, 3-hydroxyisobutyrate dehydrogenase 2e-80
TIGR01692288 TIGR01692, HIBADH, 3-hydroxyisobutyrate dehydrogen 2e-47
TIGR01505291 TIGR01505, tartro_sem_red, 2-hydroxy-3-oxopropiona 1e-40
PRK11559296 PRK11559, garR, tartronate semialdehyde reductase; 6e-39
pfam03446163 pfam03446, NAD_binding_2, NAD binding domain of 6- 5e-38
PRK15461296 PRK15461, PRK15461, NADH-dependent gamma-hydroxybu 9e-34
COG3395413 COG3395, COG3395, Uncharacterized protein conserve 1e-31
PRK15059292 PRK15059, PRK15059, tartronate semialdehyde reduct 2e-25
COG2084286 COG2084, MmsB, 3-hydroxyisobutyrate dehydrogenase 3e-16
pfam01116 283 pfam01116, F_bP_aldolase, Fructose-bisphosphate al 1e-15
cd00947 276 cd00947, TBP_aldolase_IIB, Tagatose-1,6-bisphospha 6e-15
pfam07005224 pfam07005, DUF1537, Protein of unknown function, D 3e-13
PRK12857 284 PRK12857, PRK12857, fructose-1,6-bisphosphate aldo 4e-13
PRK12737 284 PRK12737, gatY, tagatose-bisphosphate aldolase; Re 6e-11
COG1023300 COG1023, Gnd, Predicted 6-phosphogluconate dehydro 6e-11
PRK09195 284 PRK09195, gatY, tagatose-bisphosphate aldolase; Re 9e-11
TIGR01859 282 TIGR01859, fruc_bis_ald_, fructose-1,6-bisphosphat 1e-10
COG0191 286 COG0191, Fba, Fructose/tagatose bisphosphate aldol 3e-10
PRK09599301 PRK09599, PRK09599, 6-phosphogluconate dehydrogena 2e-09
PRK12490299 PRK12490, PRK12490, 6-phosphogluconate dehydrogena 2e-09
PRK06806 281 PRK06806, PRK06806, fructose-bisphosphate aldolase 5e-09
TIGR00167 288 TIGR00167, cbbA, ketose-bisphosphate aldolase 7e-09
TIGR01858 282 TIGR01858, tag_bisphos_ald, class II aldolase, tag 1e-08
PRK07709 285 PRK07709, PRK07709, fructose-bisphosphate aldolase 5e-08
PRK07084 321 PRK07084, PRK07084, fructose-bisphosphate aldolase 1e-07
TIGR00872298 TIGR00872, gnd_rel, 6-phosphogluconate dehydrogena 5e-07
PRK08185 283 PRK08185, PRK08185, hypothetical protein; Provisio 1e-06
PRK08610 286 PRK08610, PRK08610, fructose-bisphosphate aldolase 2e-06
PRK09196 347 PRK09196, PRK09196, fructose-1,6-bisphosphate aldo 2e-06
PRK06801 286 PRK06801, PRK06801, hypothetical protein; Provisio 5e-06
TIGR01692288 TIGR01692, HIBADH, 3-hydroxyisobutyrate dehydrogen 7e-06
PRK12738 286 PRK12738, kbaY, tagatose-bisphosphate aldolase; Re 3e-05
PRK05835 307 PRK05835, PRK05835, fructose-bisphosphate aldolase 3e-05
PRK13399 347 PRK13399, PRK13399, fructose-1,6-bisphosphate aldo 3e-05
TIGR01521 347 TIGR01521, FruBisAldo_II_B, fructose-bisphosphate 0.001
PRK07315 293 PRK07315, PRK07315, fructose-bisphosphate aldolase 0.002
PRK11559296 PRK11559, garR, tartronate semialdehyde reductase; 0.004
cd00453 340 cd00453, FTBP_aldolase_II, Fructose/tagarose-bisph 0.004
>gnl|CDD|215463 PLN02858, PLN02858, fructose-bisphosphate aldolase Back     alignment and domain information 
 Score = 1714 bits (4440), Expect = 0.0
 Identities = 778/986 (78%), Positives = 871/986 (88%), Gaps = 3/986 (0%)

Query: 1    MVNDLLEGVHLIASVEAISLGVQFGIHPWVLYDIISNAAGNSWIFKNYIPNLLRGDA-KL 59
            MVN+LLEG+HL+AS EA++LGV+ GIHPW++YDIISNAAG+SWIFKN++P LL+ D  + 
Sbjct: 178  MVNELLEGIHLVASAEAMALGVRAGIHPWIIYDIISNAAGSSWIFKNHVPLLLKDDYIEG 237

Query: 60   HFLNAFIQNLGIALDMAKTLAFPLPLLAVAHQQLILGLSHAHANDDNPPLVKVWENVLGV 119
             FLN  +QNLGI LDMAK+L FPLPLLAVAHQQLI G S    +D    L KVWE V GV
Sbjct: 238  RFLNVLVQNLGIVLDMAKSLPFPLPLLAVAHQQLISGSSSMQGDDTATSLAKVWEKVFGV 297

Query: 120  NITDAANLEAYKPEELAKQITAKSNSVTRVGFIGLGAMGFGMATHLLRSNFTVIGYDVYR 179
            NI +AAN E YKPE+LAKQIT ++  V R+GFIGLGAMGFGMA+HLL+SNF+V GYDVY+
Sbjct: 298  NILEAANRELYKPEDLAKQITMQAKPVKRIGFIGLGAMGFGMASHLLKSNFSVCGYDVYK 357

Query: 180  PTLTKFQNVGGLIANSPAEAAKDVGVLVIMVTNEAQAESVLYGDLGAVSALSSGASIILS 239
            PTL +F+N GGL  NSPAE AKDV VLVIMV NE QAE+VL+GDLGAVSAL +GASI+LS
Sbjct: 358  PTLVRFENAGGLAGNSPAEVAKDVDVLVIMVANEVQAENVLFGDLGAVSALPAGASIVLS 417

Query: 240  STVSPGFVSQLERRLQFEGKDLKLVDAPVSGGVKRASMGELTIMAAGTEESLKSTGSVLS 299
            STVSPGFV QLERRL+ EG+D+KLVDAPVSGGVKRA+MG LTIMA+GT+E+LKS GSVLS
Sbjct: 418  STVSPGFVIQLERRLENEGRDIKLVDAPVSGGVKRAAMGTLTIMASGTDEALKSAGSVLS 477

Query: 300  ALSEKLYVIKGGCGAGSGVKMANQLLAGVHIASAAEAMAFGARLGLNTRVLFNIITDSGG 359
            ALSEKLYVIKGGCGAGSGVKM NQLLAGVHIASAAEAMAFGARLGLNTR LF+II+++GG
Sbjct: 478  ALSEKLYVIKGGCGAGSGVKMVNQLLAGVHIASAAEAMAFGARLGLNTRKLFDIISNAGG 537

Query: 360  SSWMFENRVPHMLDNDYTPYSALDIFVKDMGIIARECLSQRVPLHISTIAHQLFLAGSAA 419
            +SWMFENRVPHMLDNDYTPYSALDIFVKD+GI++RE  S+++PLH+ST+AHQLFLAGSA+
Sbjct: 538  TSWMFENRVPHMLDNDYTPYSALDIFVKDLGIVSREGSSRKIPLHLSTVAHQLFLAGSAS 597

Query: 420  GWGRQDDAAVVKVYETLSGVKVEGRLPVLKKEAVLQSLPSEWPLDPIDDI-KGLIKKNAK 478
            GWGR DDAAVVKVYETL+GVKVEGRLPVLKKE VL SLP+EWP DPIDDI   L   N+K
Sbjct: 598  GWGRIDDAAVVKVYETLTGVKVEGRLPVLKKEDVLTSLPAEWPEDPIDDICHRLNMGNSK 657

Query: 479  TLIVLDDDPTGTQTVHGIEVLTEWSVASLVEQFRKKPLCFFILTNSRALSSEKASSLITD 538
            TL+VLDDDPTGTQTVH +EVLTEWSV S+ EQFRKKP CFFILTNSR+LS EKAS LI D
Sbjct: 658  TLVVLDDDPTGTQTVHDVEVLTEWSVESISEQFRKKPACFFILTNSRSLSPEKASELIKD 717

Query: 539  ICRNLRTASNSVENTEYTVVLRGDSTLRGHFPEEADAAVSVLGEMDAWIICPFFLQGGRY 598
            ICRNL  A+ SV N +YT+VLRGDSTLRGHFPEEADAAVSVLGEMDAWIICPFFLQGGRY
Sbjct: 718  ICRNLCAAAKSVGNVDYTIVLRGDSTLRGHFPEEADAAVSVLGEMDAWIICPFFLQGGRY 777

Query: 599  TIEDIHYVGDLDQLVPAGDTEFAKDASFGFKSSNLREWVEEKTSGRIPASSVASISIQLL 658
            TI DIHYV D D+LVPAG+TEFAKDASFG+KSSNLREWVEEKT GRI A+SV SISIQLL
Sbjct: 778  TINDIHYVADSDRLVPAGETEFAKDASFGYKSSNLREWVEEKTKGRISANSVQSISIQLL 837

Query: 659  RKGGPDAVCERLCSLQKGSTCIVNAASERDIAVFAAGMIQAELKGKSFLCRTAASFVSAR 718
            RKGGPDAVCE LCSL+KGSTCIVNAASERD+AVFAAGMIQAELKGK FLCRTAASFVSAR
Sbjct: 838  RKGGPDAVCEHLCSLKKGSTCIVNAASERDMAVFAAGMIQAELKGKRFLCRTAASFVSAR 897

Query: 719  IGIVAKAPILPKDLGNKIESTGGLIVVGSYVPKTTKQVEELISQSGRFIRSVEVSVDKVA 778
            IGI+ K P+LPKDL +  ES+GGLIVVGSYVPKTTKQVEEL SQ G+ +RS+EVSV+KVA
Sbjct: 898  IGIIPKPPVLPKDLESNKESSGGLIVVGSYVPKTTKQVEELKSQCGQSLRSIEVSVEKVA 957

Query: 779  MKSLEERQEEIIRAAEMVDVFLQARKDTLLITSRVLITGKTPSESLEINLKVSSAMVEIV 838
            MKS E R EEI RA EM D FL+A KDTL++TSR LITGKTPSESL+IN KVSSA+VEIV
Sbjct: 958  MKSSEVRDEEISRAVEMADAFLRAGKDTLIMTSRELITGKTPSESLDINSKVSSALVEIV 1017

Query: 839  RRITTRPRYILAKGGITSSDIATKALEAKRAKVVGQALAGVPLWELGPESRHPGVPYVVF 898
            RRI+TRPRYILAKGGITSSD+ATKALEA+RAKVVGQALAGVPLW+LGPESRHPGVPY+VF
Sbjct: 1018 RRISTRPRYILAKGGITSSDLATKALEARRAKVVGQALAGVPLWKLGPESRHPGVPYIVF 1077

Query: 899  PGNVGDNNAVANVVRSWARPVRISSTKELLLNAEKGEYAVGAFNVYNMEGVEAVVAAAEE 958
            PGNVGD+ A+A VV+SWARP R SSTKELLLNAEKG YAVGAFNVYN+EG+EAVVAAAE 
Sbjct: 1078 PGNVGDSTALAEVVKSWARPAR-SSTKELLLNAEKGGYAVGAFNVYNLEGIEAVVAAAEA 1136

Query: 959  ERSPAILQVRSTCFKVQYITLVTSSI 984
            E+SPAILQV     K   I LV+  I
Sbjct: 1137 EKSPAILQVHPGALKQGGIPLVSCCI 1162

Length = 1378
>gnl|CDD|215463 PLN02858, PLN02858, fructose-bisphosphate aldolase Back     alignment and domain information
>gnl|CDD|224995 COG2084, MmsB, 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|130753 TIGR01692, HIBADH, 3-hydroxyisobutyrate dehydrogenase Back     alignment and domain information
>gnl|CDD|130569 TIGR01505, tartro_sem_red, 2-hydroxy-3-oxopropionate reductase Back     alignment and domain information
>gnl|CDD|183197 PRK11559, garR, tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>gnl|CDD|217563 pfam03446, NAD_binding_2, NAD binding domain of 6-phosphogluconate dehydrogenase Back     alignment and domain information
>gnl|CDD|185358 PRK15461, PRK15461, NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|225930 COG3395, COG3395, Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>gnl|CDD|185019 PRK15059, PRK15059, tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>gnl|CDD|224995 COG2084, MmsB, 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|216305 pfam01116, F_bP_aldolase, Fructose-bisphosphate aldolase class-II Back     alignment and domain information
>gnl|CDD|238477 cd00947, TBP_aldolase_IIB, Tagatose-1,6-bisphosphate (TBP) aldolase and related Type B Class II aldolases Back     alignment and domain information
>gnl|CDD|219265 pfam07005, DUF1537, Protein of unknown function, DUF1537 Back     alignment and domain information
>gnl|CDD|237235 PRK12857, PRK12857, fructose-1,6-bisphosphate aldolase; Reviewed Back     alignment and domain information
>gnl|CDD|183710 PRK12737, gatY, tagatose-bisphosphate aldolase; Reviewed Back     alignment and domain information
>gnl|CDD|223954 COG1023, Gnd, Predicted 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|181690 PRK09195, gatY, tagatose-bisphosphate aldolase; Reviewed Back     alignment and domain information
>gnl|CDD|130918 TIGR01859, fruc_bis_ald_, fructose-1,6-bisphosphate aldolase, class II, various bacterial and amitochondriate protist Back     alignment and domain information
>gnl|CDD|223269 COG0191, Fba, Fructose/tagatose bisphosphate aldolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|236582 PRK09599, PRK09599, 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>gnl|CDD|237116 PRK12490, PRK12490, 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>gnl|CDD|180705 PRK06806, PRK06806, fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>gnl|CDD|232852 TIGR00167, cbbA, ketose-bisphosphate aldolase Back     alignment and domain information
>gnl|CDD|130917 TIGR01858, tag_bisphos_ald, class II aldolase, tagatose bisphosphate family Back     alignment and domain information
>gnl|CDD|169068 PRK07709, PRK07709, fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>gnl|CDD|180829 PRK07084, PRK07084, fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>gnl|CDD|233163 TIGR00872, gnd_rel, 6-phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>gnl|CDD|181275 PRK08185, PRK08185, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|181501 PRK08610, PRK08610, fructose-bisphosphate aldolase; Reviewed Back     alignment and domain information
>gnl|CDD|181691 PRK09196, PRK09196, fructose-1,6-bisphosphate aldolase; Reviewed Back     alignment and domain information
>gnl|CDD|180701 PRK06801, PRK06801, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|130753 TIGR01692, HIBADH, 3-hydroxyisobutyrate dehydrogenase Back     alignment and domain information
>gnl|CDD|183711 PRK12738, kbaY, tagatose-bisphosphate aldolase; Reviewed Back     alignment and domain information
>gnl|CDD|180280 PRK05835, PRK05835, fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>gnl|CDD|184029 PRK13399, PRK13399, fructose-1,6-bisphosphate aldolase; Provisional Back     alignment and domain information
>gnl|CDD|130584 TIGR01521, FruBisAldo_II_B, fructose-bisphosphate aldolase, class II, Calvin cycle subtype Back     alignment and domain information
>gnl|CDD|180926 PRK07315, PRK07315, fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>gnl|CDD|183197 PRK11559, garR, tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>gnl|CDD|238255 cd00453, FTBP_aldolase_II, Fructose/tagarose-bisphosphate aldolase class II Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 988
PLN02858 1378 fructose-bisphosphate aldolase 100.0
COG3395413 Uncharacterized protein conserved in bacteria [Fun 100.0
COG2084286 MmsB 3-hydroxyisobutyrate dehydrogenase and relate 100.0
KOG0409327 consensus Predicted dehydrogenase [General functio 100.0
PRK15059292 tartronate semialdehyde reductase; Provisional 100.0
PRK15461296 NADH-dependent gamma-hydroxybutyrate dehydrogenase 100.0
PLN02858 1378 fructose-bisphosphate aldolase 100.0
TIGR01692288 HIBADH 3-hydroxyisobutyrate dehydrogenase. This en 100.0
PRK11559296 garR tartronate semialdehyde reductase; Provisiona 100.0
TIGR01505291 tartro_sem_red 2-hydroxy-3-oxopropionate reductase 100.0
PLN02350493 phosphogluconate dehydrogenase (decarboxylating) 100.0
PRK12490299 6-phosphogluconate dehydrogenase-like protein; Rev 100.0
PRK09599301 6-phosphogluconate dehydrogenase-like protein; Rev 100.0
TIGR03026411 NDP-sugDHase nucleotide sugar dehydrogenase. All o 100.0
TIGR00872298 gnd_rel 6-phosphogluconate dehydrogenase (decarbox 99.98
PTZ00142470 6-phosphogluconate dehydrogenase; Provisional 99.98
TIGR00873467 gnd 6-phosphogluconate dehydrogenase, decarboxylat 99.97
PRK15182425 Vi polysaccharide biosynthesis protein TviB; Provi 99.97
PRK09287459 6-phosphogluconate dehydrogenase; Validated 99.97
COG1004414 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en 99.97
PRK15057388 UDP-glucose 6-dehydrogenase; Provisional 99.96
PRK11064415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro 99.96
PF07005223 DUF1537: Protein of unknown function, DUF1537; Int 99.96
PF03446163 NAD_binding_2: NAD binding domain of 6-phosphogluc 99.96
COG1023300 Gnd Predicted 6-phosphogluconate dehydrogenase [Ca 99.95
PRK14618328 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 99.94
PLN02353473 probable UDP-glucose 6-dehydrogenase 99.93
PRK00094325 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr 99.93
COG0677436 WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenas 99.91
PRK14619308 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 99.91
PRK06129308 3-hydroxyacyl-CoA dehydrogenase; Validated 99.89
COG0362473 Gnd 6-phosphogluconate dehydrogenase [Carbohydrate 99.88
COG0240329 GpsA Glycerol-3-phosphate dehydrogenase [Energy pr 99.85
PF14833122 NAD_binding_11: NAD-binding of NADP-dependent 3-hy 99.85
PRK08229341 2-dehydropantoate 2-reductase; Provisional 99.84
COG2084286 MmsB 3-hydroxyisobutyrate dehydrogenase and relate 99.83
KOG0409327 consensus Predicted dehydrogenase [General functio 99.82
PRK12557342 H(2)-dependent methylenetetrahydromethanopterin de 99.81
KOG2653487 consensus 6-phosphogluconate dehydrogenase [Carboh 99.8
PRK07531495 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe 99.8
PRK07679279 pyrroline-5-carboxylate reductase; Reviewed 99.77
PRK08268507 3-hydroxy-acyl-CoA dehydrogenase; Validated 99.77
PRK15059292 tartronate semialdehyde reductase; Provisional 99.76
PLN02688266 pyrroline-5-carboxylate reductase 99.76
PRK09260288 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.75
PF14833122 NAD_binding_11: NAD-binding of NADP-dependent 3-hy 99.75
PTZ00345365 glycerol-3-phosphate dehydrogenase; Provisional 99.74
PRK12439341 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 99.74
TIGR02279503 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa 99.72
TIGR03376342 glycerol3P_DH glycerol-3-phosphate dehydrogenase ( 99.72
PRK15461296 NADH-dependent gamma-hydroxybutyrate dehydrogenase 99.7
PRK06130311 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.7
PRK07819286 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.69
PLN02545295 3-hydroxybutyryl-CoA dehydrogenase 99.68
PRK08507275 prephenate dehydrogenase; Validated 99.68
PRK11199374 tyrA bifunctional chorismate mutase/prephenate deh 99.68
PRK14620326 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 99.68
PRK07530292 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.67
TIGR01692288 HIBADH 3-hydroxyisobutyrate dehydrogenase. This en 99.65
TIGR01505291 tartro_sem_red 2-hydroxy-3-oxopropionate reductase 99.63
PRK08655437 prephenate dehydrogenase; Provisional 99.62
PRK07417279 arogenate dehydrogenase; Reviewed 99.61
TIGR01724341 hmd_rel H2-forming N(5),N(10)-methenyltetrahydrome 99.61
PRK11559296 garR tartronate semialdehyde reductase; Provisiona 99.59
PRK08293287 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.59
PRK07066321 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.59
PRK06035291 3-hydroxyacyl-CoA dehydrogenase; Validated 99.56
PRK12921305 2-dehydropantoate 2-reductase; Provisional 99.56
KOG2666481 consensus UDP-glucose/GDP-mannose dehydrogenase [C 99.56
PRK06522304 2-dehydropantoate 2-reductase; Reviewed 99.54
PRK11880267 pyrroline-5-carboxylate reductase; Reviewed 99.54
PRK06476258 pyrroline-5-carboxylate reductase; Reviewed 99.53
PRK12491272 pyrroline-5-carboxylate reductase; Reviewed 99.53
PF03721185 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen 99.52
PRK06249313 2-dehydropantoate 2-reductase; Provisional 99.52
COG0191 286 Fba Fructose/tagatose bisphosphate aldolase [Carbo 99.51
PRK05808282 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.51
PRK07680273 late competence protein ComER; Validated 99.49
PRK08269314 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.47
PRK12737 284 gatY tagatose-bisphosphate aldolase; Reviewed 99.47
PRK12738 286 kbaY tagatose-bisphosphate aldolase; Reviewed 99.47
PRK09195 284 gatY tagatose-bisphosphate aldolase; Reviewed 99.46
PRK07502307 cyclohexadienyl dehydrogenase; Validated 99.46
PRK12857 284 fructose-1,6-bisphosphate aldolase; Reviewed 99.46
PRK07709 285 fructose-bisphosphate aldolase; Provisional 99.44
TIGR00167 288 cbbA ketose-bisphosphate aldolases. fructose-bisph 99.44
PRK06545359 prephenate dehydrogenase; Validated 99.44
PRK06806 281 fructose-bisphosphate aldolase; Provisional 99.44
PRK06801 286 hypothetical protein; Provisional 99.43
PRK13399 347 fructose-1,6-bisphosphate aldolase; Provisional 99.43
PRK09196 347 fructose-1,6-bisphosphate aldolase; Reviewed 99.43
PRK08610 286 fructose-bisphosphate aldolase; Reviewed 99.42
PRK05835 307 fructose-bisphosphate aldolase; Provisional 99.41
PRK07315 293 fructose-bisphosphate aldolase; Provisional 99.41
PRK07998 283 gatY putative fructose-1,6-bisphosphate aldolase; 99.41
PRK07084 321 fructose-bisphosphate aldolase; Provisional 99.4
COG0345266 ProC Pyrroline-5-carboxylate reductase [Amino acid 99.39
TIGR01858 282 tag_bisphos_ald class II aldolase, tagatose bispho 99.38
PLN02256304 arogenate dehydrogenase 99.38
TIGR01521 347 FruBisAldo_II_B fructose-bisphosphate aldolase, cl 99.37
PF01116 287 F_bP_aldolase: Fructose-bisphosphate aldolase clas 99.37
PLN02712667 arogenate dehydrogenase 99.36
PRK05708305 2-dehydropantoate 2-reductase; Provisional 99.36
COG1893307 ApbA Ketopantoate reductase [Coenzyme metabolism] 99.36
COG1250307 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabo 99.34
PTZ00431260 pyrroline carboxylate reductase; Provisional 99.33
PRK07634245 pyrroline-5-carboxylate reductase; Reviewed 99.32
COG0287279 TyrA Prephenate dehydrogenase [Amino acid transpor 99.31
TIGR01859 282 fruc_bis_ald_ fructose-1,6-bisphosphate aldolase, 99.28
TIGR01915219 npdG NADPH-dependent F420 reductase. This model re 99.27
PRK08185 283 hypothetical protein; Provisional 99.27
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 99.27
PRK05479330 ketol-acid reductoisomerase; Provisional 99.25
PRK06928277 pyrroline-5-carboxylate reductase; Reviewed 99.23
PLN02712667 arogenate dehydrogenase 99.22
PRK12490299 6-phosphogluconate dehydrogenase-like protein; Rev 99.21
COG2085211 Predicted dinucleotide-binding enzymes [General fu 99.2
cd00947 276 TBP_aldolase_IIB Tagatose-1,6-bisphosphate (TBP) a 99.19
TIGR02440699 FadJ fatty oxidation complex, alpha subunit FadJ. 99.19
PRK14806735 bifunctional cyclohexadienyl dehydrogenase/ 3-phos 99.19
PRK11154708 fadJ multifunctional fatty acid oxidation complex 99.18
PRK11730715 fadB multifunctional fatty acid oxidation complex 99.18
TIGR01520 357 FruBisAldo_II_A fructose-bisphosphate aldolase, cl 99.17
PF0380796 F420_oxidored: NADP oxidoreductase coenzyme F420-d 99.17
TIGR02437714 FadB fatty oxidation complex, alpha subunit FadB. 99.16
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 99.16
PRK09197 350 fructose-bisphosphate aldolase; Provisional 99.14
TIGR02441737 fa_ox_alpha_mit fatty acid oxidation complex, alph 99.12
PRK08818370 prephenate dehydrogenase; Provisional 99.11
cd00453 340 FTBP_aldolase_II Fructose/tagarose-bisphosphate al 99.1
TIGR03026411 NDP-sugDHase nucleotide sugar dehydrogenase. All o 99.09
cd00946 345 FBP_aldolase_IIA Class II Type A, Fructose-1,6-bis 99.09
PF10727127 Rossmann-like: Rossmann-like domain; InterPro: IPR 99.05
PRK07574385 formate dehydrogenase; Provisional 98.98
TIGR00745293 apbA_panE 2-dehydropantoate 2-reductase. This mode 98.97
TIGR00465314 ilvC ketol-acid reductoisomerase. This is the seco 98.97
KOG2304298 consensus 3-hydroxyacyl-CoA dehydrogenase [Lipid t 98.95
PRK12480330 D-lactate dehydrogenase; Provisional 98.94
PLN03139386 formate dehydrogenase; Provisional 98.94
PRK06436303 glycerate dehydrogenase; Provisional 98.9
PRK08605332 D-lactate dehydrogenase; Validated 98.87
COG4007340 Predicted dehydrogenase related to H2-forming N5,N 98.86
PRK13243333 glyoxylate reductase; Reviewed 98.86
PLN02350493 phosphogluconate dehydrogenase (decarboxylating) 98.86
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 98.84
PF02153258 PDH: Prephenate dehydrogenase; InterPro: IPR003099 98.84
PRK13403335 ketol-acid reductoisomerase; Provisional 98.84
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 98.82
PRK15469312 ghrA bifunctional glyoxylate/hydroxypyruvate reduc 98.81
KOG2380480 consensus Prephenate dehydrogenase (NADP+) [Amino 98.8
PRK09599301 6-phosphogluconate dehydrogenase-like protein; Rev 98.78
COG0111324 SerA Phosphoglycerate dehydrogenase and related de 98.73
KOG2711372 consensus Glycerol-3-phosphate dehydrogenase/dihyd 98.71
COG1052324 LdhA Lactate dehydrogenase and related dehydrogena 98.7
TIGR01327525 PGDH D-3-phosphoglycerate dehydrogenase. This mode 98.68
PRK13581526 D-3-phosphoglycerate dehydrogenase; Provisional 98.66
TIGR00112245 proC pyrroline-5-carboxylate reductase. This enzym 98.64
PRK13302271 putative L-aspartate dehydrogenase; Provisional 98.61
PLN02928347 oxidoreductase family protein 98.55
PRK00257381 erythronate-4-phosphate dehydrogenase; Validated 98.54
PF07991165 IlvN: Acetohydroxy acid isomeroreductase, catalyti 98.53
PRK11790409 D-3-phosphoglycerate dehydrogenase; Provisional 98.53
PRK08410311 2-hydroxyacid dehydrogenase; Provisional 98.52
PRK15409323 bifunctional glyoxylate/hydroxypyruvate reductase 98.49
PRK06487317 glycerate dehydrogenase; Provisional 98.45
PF0098496 UDPG_MGDP_dh: UDP-glucose/GDP-mannose dehydrogenas 98.44
KOG0069336 consensus Glyoxylate/hydroxypyruvate reductase (D- 98.42
PRK06932314 glycerate dehydrogenase; Provisional 98.42
PRK06444197 prephenate dehydrogenase; Provisional 98.41
PRK14194301 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.4
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 98.39
PRK15438378 erythronate-4-phosphate dehydrogenase PdxB; Provis 98.38
PRK14618328 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 98.38
PRK06141314 ornithine cyclodeaminase; Validated 98.35
PRK13304265 L-aspartate dehydrogenase; Reviewed 98.35
PRK15182425 Vi polysaccharide biosynthesis protein TviB; Provi 98.33
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 98.32
PLN02306386 hydroxypyruvate reductase 98.25
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain 98.23
PRK14188296 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.19
PF02558151 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: 98.17
TIGR00872298 gnd_rel 6-phosphogluconate dehydrogenase (decarbox 98.17
KOG2305313 consensus 3-hydroxyacyl-CoA dehydrogenase [Lipid t 98.16
PRK08306296 dipicolinate synthase subunit A; Reviewed 98.13
KOG3124267 consensus Pyrroline-5-carboxylate reductase [Amino 98.1
PRK06129308 3-hydroxyacyl-CoA dehydrogenase; Validated 98.1
PRK00094325 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr 98.05
PRK14619308 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 98.04
TIGR00507270 aroE shikimate 5-dehydrogenase. This model finds p 98.03
PF01408120 GFO_IDH_MocA: Oxidoreductase family, NAD-binding R 97.94
PRK14179284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.92
PLN00203519 glutamyl-tRNA reductase 97.89
TIGR02371325 ala_DH_arch alanine dehydrogenase, Archaeoglobus f 97.8
PF00670162 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase 97.8
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 97.8
PTZ00075476 Adenosylhomocysteinase; Provisional 97.77
PRK11064415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro 97.77
PRK05225487 ketol-acid reductoisomerase; Validated 97.74
PRK15057388 UDP-glucose 6-dehydrogenase; Provisional 97.74
PLN02494477 adenosylhomocysteinase 97.73
TIGR01763305 MalateDH_bact malate dehydrogenase, NAD-dependent. 97.72
COG1712255 Predicted dinucleotide-utilizing enzyme [General f 97.72
smart00859122 Semialdhyde_dh Semialdehyde dehydrogenase, NAD bin 97.71
TIGR00936406 ahcY adenosylhomocysteinase. This enzyme hydrolyze 97.7
PRK05476425 S-adenosyl-L-homocysteine hydrolase; Provisional 97.66
PF01113124 DapB_N: Dihydrodipicolinate reductase, N-terminus; 97.64
TIGR01921324 DAP-DH diaminopimelate dehydrogenase. This model r 97.64
COG0059338 IlvC Ketol-acid reductoisomerase [Amino acid trans 97.64
PRK06223307 malate dehydrogenase; Reviewed 97.61
COG1748389 LYS9 Saccharopine dehydrogenase and related protei 97.6
PRK00045423 hemA glutamyl-tRNA reductase; Reviewed 97.6
PLN02353473 probable UDP-glucose 6-dehydrogenase 97.59
PRK13301267 putative L-aspartate dehydrogenase; Provisional 97.58
PRK13940414 glutamyl-tRNA reductase; Provisional 97.57
COG0373414 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] 97.55
PRK07340304 ornithine cyclodeaminase; Validated 97.54
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 97.53
COG5495289 Uncharacterized conserved protein [Function unknow 97.52
PRK09287459 6-phosphogluconate dehydrogenase; Validated 97.49
PRK04148134 hypothetical protein; Provisional 97.46
PRK13303265 L-aspartate dehydrogenase; Provisional 97.45
PRK08229341 2-dehydropantoate 2-reductase; Provisional 97.44
TIGR01035417 hemA glutamyl-tRNA reductase. This enzyme, togethe 97.43
PRK09310477 aroDE bifunctional 3-dehydroquinate dehydratase/sh 97.38
cd05292308 LDH_2 A subgroup of L-lactate dehydrogenases. L-la 97.38
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 97.37
PRK00066315 ldh L-lactate dehydrogenase; Reviewed 97.36
cd05297423 GH4_alpha_glucosidase_galactosidase Glycoside Hydr 97.36
PRK00048257 dihydrodipicolinate reductase; Provisional 97.35
PRK06823315 ornithine cyclodeaminase; Validated 97.3
PF01118121 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD bi 97.29
PRK06407301 ornithine cyclodeaminase; Provisional 97.29
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 97.29
KOG0068406 consensus D-3-phosphoglycerate dehydrogenase, D-is 97.27
TIGR02992326 ectoine_eutC ectoine utilization protein EutC. Mem 97.27
PF00056141 Ldh_1_N: lactate/malate dehydrogenase, NAD binding 97.27
cd05291306 HicDH_like L-2-hydroxyisocapronate dehydrogenases 97.26
PRK06046326 alanine dehydrogenase; Validated 97.25
PTZ00082321 L-lactate dehydrogenase; Provisional 97.23
PRK08618325 ornithine cyclodeaminase; Validated 97.22
COG0569225 TrkA K+ transport systems, NAD-binding component [ 97.17
COG1004414 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en 97.17
PRK00258278 aroE shikimate 5-dehydrogenase; Reviewed 97.16
PRK08300302 acetaldehyde dehydrogenase; Validated 97.16
COG0673342 MviM Predicted dehydrogenases and related proteins 97.14
PTZ00117319 malate dehydrogenase; Provisional 97.11
COG2423330 Predicted ornithine cyclodeaminase, mu-crystallin 97.09
TIGR00036266 dapB dihydrodipicolinate reductase. 97.08
cd01339300 LDH-like_MDH L-lactate dehydrogenase-like malate d 97.06
PF02423313 OCD_Mu_crystall: Ornithine cyclodeaminase/mu-cryst 97.05
cd0519186 NAD_bind_amino_acid_DH NAD(P) binding domain of am 97.04
PRK00961342 H(2)-dependent methylenetetrahydromethanopterin de 97.0
TIGR01723340 hmd_TIGR 5,10-methenyltetrahydromethanopterin hydr 97.0
PRK07589346 ornithine cyclodeaminase; Validated 96.98
PRK08291330 ectoine utilization protein EutC; Validated 96.97
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 96.97
PRK11579346 putative oxidoreductase; Provisional 96.97
PRK06199379 ornithine cyclodeaminase; Validated 96.9
PRK12549284 shikimate 5-dehydrogenase; Reviewed 96.9
PRK00436343 argC N-acetyl-gamma-glutamyl-phosphate reductase; 96.86
PLN028191042 lysine-ketoglutarate reductase/saccharopine dehydr 96.84
TIGR01761343 thiaz-red thiazolinyl imide reductase. This reduct 96.82
cd05294309 LDH-like_MDH_nadp A lactate dehydrogenases-like st 96.81
cd05293312 LDH_1 A subgroup of L-lactate dehydrogenases. L-la 96.81
TIGR01850346 argC N-acetyl-gamma-glutamyl-phosphate reductase, 96.79
TIGR03215285 ac_ald_DH_ac acetaldehyde dehydrogenase (acetylati 96.77
TIGR00873467 gnd 6-phosphogluconate dehydrogenase, decarboxylat 96.76
PRK09496453 trkA potassium transporter peripheral membrane com 96.73
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 96.69
PRK14175286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.65
PRK04207341 glyceraldehyde-3-phosphate dehydrogenase; Provisio 96.65
cd00300300 LDH_like L-lactate dehydrogenase-like enzymes. Mem 96.63
cd00650263 LDH_MDH_like NAD-dependent, lactate dehydrogenase- 96.62
TIGR00561511 pntA NAD(P) transhydrogenase, alpha subunit. In so 96.61
PF01262168 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal 96.57
COG2344211 AT-rich DNA-binding protein [General function pred 96.57
PRK03659601 glutathione-regulated potassium-efflux system prot 96.54
PRK10669558 putative cation:proton antiport protein; Provision 96.53
TIGR02354200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 96.47
PRK05472213 redox-sensing transcriptional repressor Rex; Provi 96.45
PF03435386 Saccharop_dh: Saccharopine dehydrogenase ; InterPr 96.41
PTZ00142470 6-phosphogluconate dehydrogenase; Provisional 96.36
PRK05442326 malate dehydrogenase; Provisional 96.36
PRK14189285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.35
PRK06718202 precorrin-2 dehydrogenase; Reviewed 96.35
PRK00676338 hemA glutamyl-tRNA reductase; Validated 96.31
PRK06349426 homoserine dehydrogenase; Provisional 96.29
PF13460183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 96.28
PF10100429 DUF2338: Uncharacterized protein conserved in bact 96.27
KOG2741351 consensus Dimeric dihydrodiol dehydrogenase [Carbo 96.27
PRK09424509 pntA NAD(P) transhydrogenase subunit alpha; Provis 96.26
PRK10206344 putative oxidoreductase; Provisional 96.23
PRK15076431 alpha-galactosidase; Provisional 96.18
COG2910211 Putative NADH-flavin reductase [General function p 96.14
PLN02968381 Probable N-acetyl-gamma-glutamyl-phosphate reducta 96.13
TIGR01759323 MalateDH-SF1 malate dehydrogenase. This model repr 96.12
PLN02602350 lactate dehydrogenase 96.1
cd01483143 E1_enzyme_family Superfamily of activating enzymes 96.1
PRK05671336 aspartate-semialdehyde dehydrogenase; Reviewed 96.09
PF02882160 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cycl 95.97
PF00393291 6PGD: 6-phosphogluconate dehydrogenase, C-terminal 95.96
TIGR01809282 Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO 95.92
cd05311226 NAD_bind_2_malic_enz NAD(P) binding domain of mali 95.87
PRK00683418 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.86
PRK02318381 mannitol-1-phosphate 5-dehydrogenase; Provisional 95.84
PRK03562621 glutathione-regulated potassium-efflux system prot 95.84
PRK10792285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.81
cd01338322 MDH_choloroplast_like Chloroplast-like malate dehy 95.8
PRK05086312 malate dehydrogenase; Provisional 95.77
PF13380116 CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5 95.77
COG0002349 ArgC Acetylglutamate semialdehyde dehydrogenase [A 95.75
CHL00194317 ycf39 Ycf39; Provisional 95.69
PRK14982340 acyl-ACP reductase; Provisional 95.67
PRK14192283 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.59
PRK14106450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.58
PLN00112444 malate dehydrogenase (NADP); Provisional 95.58
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 95.58
PRK06719157 precorrin-2 dehydrogenase; Validated 95.55
TIGR02356202 adenyl_thiF thiazole biosynthesis adenylyltransfer 95.47
cd05211217 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of 95.46
PRK11863313 N-acetyl-gamma-glutamyl-phosphate reductase; Provi 95.45
PRK14191285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.44
PRK14176287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.44
PRK01710458 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.42
PRK09496453 trkA potassium transporter peripheral membrane com 95.4
cd01487174 E1_ThiF_like E1_ThiF_like. Member of superfamily o 95.32
PF03720106 UDPG_MGDP_dh_C: UDP-glucose/GDP-mannose dehydrogen 95.3
PRK00421461 murC UDP-N-acetylmuramate--L-alanine ligase; Provi 95.26
cd01337310 MDH_glyoxysomal_mitochondrial Glyoxysomal and mito 95.23
cd05290307 LDH_3 A subgroup of L-lactate dehydrogenases. L-la 95.19
TIGR01757387 Malate-DH_plant malate dehydrogenase, NADP-depende 95.19
PRK06270341 homoserine dehydrogenase; Provisional 95.17
PRK08664349 aspartate-semialdehyde dehydrogenase; Reviewed 95.16
COG0686371 Ald Alanine dehydrogenase [Amino acid transport an 95.15
PRK02472447 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.13
cd01336325 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosoli 95.13
PLN00106323 malate dehydrogenase 95.1
cd00704323 MDH Malate dehydrogenase. Malate dehydrogenase (MD 95.09
cd01076227 NAD_bind_1_Glu_DH NAD(P) binding domain of glutama 95.06
PRK14183281 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.05
COG0039313 Mdh Malate/lactate dehydrogenases [Energy producti 94.99
PRK14874334 aspartate-semialdehyde dehydrogenase; Provisional 94.99
PTZ00325321 malate dehydrogenase; Provisional 94.97
COG0169283 AroE Shikimate 5-dehydrogenase [Amino acid transpo 94.94
PRK03369488 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 94.91
PRK12475338 thiamine/molybdopterin biosynthesis MoeB-like prot 94.88
PRK01390460 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 94.88
PF05368233 NmrA: NmrA-like family; InterPro: IPR008030 NmrA i 94.88
PRK07688339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 94.76
PRK08040336 putative semialdehyde dehydrogenase; Provisional 94.75
COG0771448 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligas 94.75
PRK06728347 aspartate-semialdehyde dehydrogenase; Provisional 94.72
COG4408431 Uncharacterized protein conserved in bacteria [Fun 94.71
PLN02383344 aspartate semialdehyde dehydrogenase 94.71
PF03447117 NAD_binding_3: Homoserine dehydrogenase, NAD bindi 94.68
PRK14178279 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.63
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General 94.63
cd05212140 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding dom 94.62
PF07479149 NAD_Gly3P_dh_C: NAD-dependent glycerol-3-phosphate 94.56
PRK00141473 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 94.53
TIGR01772312 MDH_euk_gproteo malate dehydrogenase, NAD-dependen 94.51
TIGR01296339 asd_B aspartate-semialdehyde dehydrogenase (peptid 94.43
cd01079197 NAD_bind_m-THF_DH NAD binding domain of methylene- 94.42
PRK08644212 thiamine biosynthesis protein ThiF; Provisional 94.32
TIGR00978341 asd_EA aspartate-semialdehyde dehydrogenase (non-p 94.14
COG0499420 SAM1 S-adenosylhomocysteine hydrolase [Coenzyme me 94.12
PRK07326237 short chain dehydrogenase; Provisional 94.12
PRK14170284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.09
PRK14573809 bifunctional D-alanyl-alanine synthetase A/UDP-N-a 93.98
PRK12548289 shikimate 5-dehydrogenase; Provisional 93.97
PRK08306296 dipicolinate synthase subunit A; Reviewed 93.97
TIGR01851310 argC_other N-acetyl-gamma-glutamyl-phosphate reduc 93.94
PF00899135 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a 93.93
PRK02006498 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 93.92
COG0289266 DapB Dihydrodipicolinate reductase [Amino acid tra 93.89
PRK01438480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 93.88
TIGR01758324 MDH_euk_cyt malate dehydrogenase, NAD-dependent. T 93.88
TIGR01771299 L-LDH-NAD L-lactate dehydrogenase. This model repr 93.74
TIGR01082448 murC UDP-N-acetylmuramate--alanine ligase. UDP-N-a 93.71
PRK14173287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.69
PRK07774250 short chain dehydrogenase; Provisional 93.67
PRK05653246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 93.63
PRK07454241 short chain dehydrogenase; Provisional 93.61
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 93.61
PRK14169282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.58
PRK14186297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.5
PRK14166282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.48
PRK08223287 hypothetical protein; Validated 93.44
PRK08328231 hypothetical protein; Provisional 93.43
PRK03803448 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 93.41
PRK14180282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.37
PF0262996 CoA_binding: CoA binding domain; InterPro: IPR0037 93.33
PRK14177284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.32
KOG4153 358 consensus Fructose 1,6-bisphosphate aldolase [Carb 93.31
COG1063350 Tdh Threonine dehydrogenase and related Zn-depende 93.29
TIGR02355240 moeB molybdopterin synthase sulfurylase MoeB. This 93.2
PRK07067257 sorbitol dehydrogenase; Provisional 93.18
PLN02516299 methylenetetrahydrofolate dehydrogenase (NADP+) 93.17
PRK14172278 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.17
TIGR02279503 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa 93.16
PRK06392326 homoserine dehydrogenase; Provisional 93.13
COG0460333 ThrA Homoserine dehydrogenase [Amino acid transpor 93.09
PRK07523255 gluconate 5-dehydrogenase; Provisional 93.09
PRK07109334 short chain dehydrogenase; Provisional 93.08
PRK06200263 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrog 93.05
PF02056183 Glyco_hydro_4: Family 4 glycosyl hydrolase; InterP 93.04
PRK08374336 homoserine dehydrogenase; Provisional 93.03
TIGR01546333 GAPDH-II_archae glyceraldehyde-3-phosphate dehydro 93.01
PRK14027283 quinate/shikimate dehydrogenase; Provisional 93.01
PRK14187294 bifunctional 5,10-methylene-tetrahydrofolate dehyd 92.96
cd00757228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 92.93
TIGR02717447 AcCoA-syn-alpha acetyl coenzyme A synthetase (ADP 92.92
PRK14171288 bifunctional 5,10-methylene-tetrahydrofolate dehyd 92.9
PRK06180277 short chain dehydrogenase; Provisional 92.9
PRK14190284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 92.88
KOG1502327 consensus Flavonol reductase/cinnamoyl-CoA reducta 92.86
PRK11861673 bifunctional prephenate dehydrogenase/3-phosphoshi 92.74
PRK05678291 succinyl-CoA synthetase subunit alpha; Validated 92.74
PRK06182273 short chain dehydrogenase; Validated 92.71
KOG3007333 consensus Mu-crystallin [Amino acid transport and 92.7
PRK12769654 putative oxidoreductase Fe-S binding subunit; Revi 92.68
PRK14182282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 92.68
PRK13394262 3-hydroxybutyrate dehydrogenase; Provisional 92.61
COG0026375 PurK Phosphoribosylaminoimidazole carboxylase (NCA 92.61
COG0190283 FolD 5,10-methylene-tetrahydrofolate dehydrogenase 92.58
PLN00141251 Tic62-NAD(P)-related group II protein; Provisional 92.55
PRK04308445 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 92.53
PRK14193284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 92.53
PRK08773392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 92.44
PLN02897345 tetrahydrofolate dehydrogenase/cyclohydrolase, put 92.43
PRK05993277 short chain dehydrogenase; Provisional 92.43
PRK14181287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 92.4
COG1648210 CysG Siroheme synthase (precorrin-2 oxidase/ferroc 92.4
PRK05690245 molybdopterin biosynthesis protein MoeB; Provision 92.4
PRK12429258 3-hydroxybutyrate dehydrogenase; Provisional 92.33
PRK05866293 short chain dehydrogenase; Provisional 92.32
PRK06139330 short chain dehydrogenase; Provisional 92.32
PRK07236386 hypothetical protein; Provisional 92.32
PRK08265261 short chain dehydrogenase; Provisional 92.32
PRK12939250 short chain dehydrogenase; Provisional 92.32
PRK12809639 putative oxidoreductase Fe-S binding subunit; Revi 92.3
cd01485198 E1-1_like Ubiquitin activating enzyme (E1), repeat 92.23
PRK12828239 short chain dehydrogenase; Provisional 92.2
cd08230355 glucose_DH Glucose dehydrogenase. Glucose dehydrog 92.15
COG4091438 Predicted homoserine dehydrogenase [Amino acid tra 92.15
TIGR01087433 murD UDP-N-acetylmuramoylalanine--D-glutamate liga 92.14
PRK07478254 short chain dehydrogenase; Provisional 92.02
TIGR01318467 gltD_gamma_fam glutamate synthase small subunit fa 92.01
cd01492197 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit 91.97
PRK02705459 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 91.95
cd05197425 GH4_glycoside_hydrolases Glycoside Hydrases Family 91.91
PRK03806438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 91.91
PRK12826251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 91.89
TIGR03649285 ergot_EASG ergot alkaloid biosynthesis protein, AF 91.88
PRK10538248 malonic semialdehyde reductase; Provisional 91.87
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 91.85
PLN03209576 translocon at the inner envelope of chloroplast su 91.83
PRK06598369 aspartate-semialdehyde dehydrogenase; Reviewed 91.83
PRK05867253 short chain dehydrogenase; Provisional 91.79
PRK12749288 quinate/shikimate dehydrogenase; Reviewed 91.78
PRK08163396 salicylate hydroxylase; Provisional 91.75
KOG0022375 consensus Alcohol dehydrogenase, class III [Second 91.74
TIGR03366280 HpnZ_proposed putative phosphonate catabolism asso 91.68
PRK12936245 3-ketoacyl-(acyl-carrier-protein) reductase NodG; 91.63
PLN02616364 tetrahydrofolate dehydrogenase/cyclohydrolase, put 91.6
PRK09880343 L-idonate 5-dehydrogenase; Provisional 91.58
PRK12550272 shikimate 5-dehydrogenase; Reviewed 91.54
TIGR03466328 HpnA hopanoid-associated sugar epimerase. The sequ 91.53
PRK07825273 short chain dehydrogenase; Provisional 91.41
PRK12814652 putative NADPH-dependent glutamate synthase small 91.36
PRK11908347 NAD-dependent epimerase/dehydratase family protein 91.28
PRK07890258 short chain dehydrogenase; Provisional 91.26
PRK12409410 D-amino acid dehydrogenase small subunit; Provisio 91.21
PRK12829264 short chain dehydrogenase; Provisional 91.1
PRK09414445 glutamate dehydrogenase; Provisional 91.08
PRK06153393 hypothetical protein; Provisional 91.08
PRK14185293 bifunctional 5,10-methylene-tetrahydrofolate dehyd 91.02
PRK07494388 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 90.96
TIGR01019286 sucCoAalpha succinyl-CoA synthetase, alpha subunit 90.93
PRK03815401 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 90.91
COG0493457 GltD NADPH-dependent glutamate synthase beta chain 90.87
PRK04663438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 90.83
PLN02477410 glutamate dehydrogenase 90.74
PF1345068 NAD_binding_8: NAD(P)-binding Rossmann-like domain 90.72
PLN02695370 GDP-D-mannose-3',5'-epimerase 90.72
PRK05693274 short chain dehydrogenase; Provisional 90.71
PRK06124256 gluconate 5-dehydrogenase; Provisional 90.66
PRK06194287 hypothetical protein; Provisional 90.65
PRK06185407 hypothetical protein; Provisional 90.63
PRK14168297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 90.58
TIGR03736244 PRTRC_ThiF PRTRC system ThiF family protein. A nov 90.54
PRK06847375 hypothetical protein; Provisional 90.46
PRK14851679 hypothetical protein; Provisional 90.42
KOG03992142 consensus Glutamate synthase [Amino acid transport 90.42
PLN02427386 UDP-apiose/xylose synthase 90.39
PRK14167297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 90.37
PRK07576264 short chain dehydrogenase; Provisional 90.36
PRK14174295 bifunctional 5,10-methylene-tetrahydrofolate dehyd 90.35
PLN02214342 cinnamoyl-CoA reductase 90.33
PRK01368454 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 90.28
>PLN02858 fructose-bisphosphate aldolase Back     alignment and domain information 
Probab=100.00  E-value=2.8e-167  Score=1589.00  Aligned_cols=983  Identities=79%  Similarity=1.200  Sum_probs=916.2

Q ss_pred             ChhHHHHHHHHHHHHHHHHHHHHcCCCHHHHHHHHhhccCCchhhhccccccccCCCCc-chHHHHHHhHHHHHHHHHhc
Q 001973            1 MVNDLLEGVHLIASVEAISLGVQFGIHPWVLYDIISNAAGNSWIFKNYIPNLLRGDAKL-HFLNAFIQNLGIALDMAKTL   79 (988)
Q Consensus         1 L~nN~l~~~~~~~~aEal~la~~~Gld~~~~~~~l~~~~~~s~~~~~~~~~~~~~~~~~-f~l~l~~KDl~la~~~a~~~   79 (988)
                      |+||+++++++++++||+.||+++|||++.++++|+.|+++||+++++.++|++++|.| |++++++||+++++++|++.
T Consensus       178 L~nN~l~~~~~~a~aEAl~la~~~Gld~~~l~~vl~~s~g~s~~~~~~~~~~~~~d~~~~F~l~l~~KDl~la~~~A~~~  257 (1378)
T PLN02858        178 MVNELLEGIHLVASAEAMALGVRAGIHPWIIYDIISNAAGSSWIFKNHVPLLLKDDYIEGRFLNVLVQNLGIVLDMAKSL  257 (1378)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHcCCCHHHHHHHHhcCCccCHHHHhhhhHhhcCCCCCCchhHHHHHHHHHHHHHHHHc
Confidence            68999999999999999999999999999999999999999999999999999999999 99999999999999999999


Q ss_pred             CCCCcHHHHHHHHHHHHhhCcCCCCCchhHHHHHHhhhcccccccccccccCchhhHHHhhhcCCCCCeEEEEccchHHH
Q 001973           80 AFPLPLLAVAHQQLILGLSHAHANDDNPPLVKVWENVLGVNITDAANLEAYKPEELAKQITAKSNSVTRVGFIGLGAMGF  159 (988)
Q Consensus        80 g~~~p~~~~~~~~~~~a~~~G~g~~D~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~m~~~~~~kIgiIG~G~mG~  159 (988)
                      |+++|+++++++.|+.+.+.|+|++|++++++++++..|....++.+.+-|.+++..+++.|..+..++|||||+|+||.
T Consensus       258 g~~lpl~~~a~~~~~~a~~~G~g~~D~sav~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~IGfIGlG~MG~  337 (1378)
T PLN02858        258 PFPLPLLAVAHQQLISGSSSMQGDDTATSLAKVWEKVFGVNILEAANRELYKPEDLAKQITMQAKPVKRIGFIGLGAMGF  337 (1378)
T ss_pred             CCCChHHHHHHHHHHHHHhcCCCccChHHHHHHHHHHcCCCccccccccccChHHHHHHhhccccCCCeEEEECchHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999988788999999999999


Q ss_pred             HHHHHHHhCCCeEEEEeCChhHHHHHHhcCCcccCCHHHHhccCcEEEEEcCChHHHHHHHccccchhhhCCCCCEEEec
Q 001973          160 GMATHLLRSNFTVIGYDVYRPTLTKFQNVGGLIANSPAEAAKDVGVLVIMVTNEAQAESVLYGDLGAVSALSSGASIILS  239 (988)
Q Consensus       160 ~lA~~L~~~G~~V~v~dr~~~~~~~l~~~G~~~~~s~~e~~~~aDvV~l~vp~~~~~~~vl~~~~~i~~~l~~g~ivId~  239 (988)
                      +||.+|+++||+|++|||++++.+.+.+.|+..++++.+++++||+||+|||++.++++++++..++.+.+.+|++|||+
T Consensus       338 ~mA~~L~~~G~~V~v~dr~~~~~~~l~~~Ga~~~~s~~e~~~~aDvVi~~V~~~~~v~~Vl~g~~g~~~~l~~g~ivVd~  417 (1378)
T PLN02858        338 GMASHLLKSNFSVCGYDVYKPTLVRFENAGGLAGNSPAEVAKDVDVLVIMVANEVQAENVLFGDLGAVSALPAGASIVLS  417 (1378)
T ss_pred             HHHHHHHHCCCEEEEEeCCHHHHHHHHHcCCeecCCHHHHHhcCCEEEEecCChHHHHHHHhchhhHHhcCCCCCEEEEC
Confidence            99999999999999999999999999999988899999999999999999999999999998877888889999999999


Q ss_pred             CCCCHHHHHHHHHHHHhcCCCceEecCcccCCcccccCCCeEEEEeCCHHHHHHHHHHHHhcCCeEEEEeCCcchHHHHH
Q 001973          240 STVSPGFVSQLERRLQFEGKDLKLVDAPVSGGVKRASMGELTIMAAGTEESLKSTGSVLSALSEKLYVIKGGCGAGSGVK  319 (988)
Q Consensus       240 st~~p~~~~~l~~~l~~~~~g~~~ldapv~g~~~~a~~g~l~~~~gg~~~~~~~~~~ll~~~g~~v~~~~g~~g~a~~~K  319 (988)
                      ||++|.+++++++.+.+.++|++|+|+||+|++..+..|++++|+||+++.+++++++|+.++.++++++|++|+|+.+|
T Consensus       418 STvsP~~~~~la~~l~~~g~g~~~lDAPVsGg~~~A~~G~L~imvgG~~~~~~~~~plL~~lg~~i~~~~g~~G~a~~~K  497 (1378)
T PLN02858        418 STVSPGFVIQLERRLENEGRDIKLVDAPVSGGVKRAAMGTLTIMASGTDEALKSAGSVLSALSEKLYVIKGGCGAGSGVK  497 (1378)
T ss_pred             CCCCHHHHHHHHHHHHhhCCCcEEEEccCCCChhhhhcCCceEEEECCHHHHHHHHHHHHHHhCcEEEeCCCCCHHHHHH
Confidence            99999999999999987567899999999999999999999999999999999999999999999887678899999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHcCCCHHHHHHHHHhcCCCccccccccccccCCCCCCCchhhHHHHHHHHHHHHHHhC
Q 001973          320 MANQLLAGVHIASAAEAMAFGARLGLNTRVLFNIITDSGGSSWMFENRVPHMLDNDYTPYSALDIFVKDMGIIARECLSQ  399 (988)
Q Consensus       320 l~~N~~~~~~~~~~~Ea~~la~~~Gid~~~~~~~l~~~~~~s~~~~~~~~~~~~~~~~~~~~l~~~~kDl~~~~~~a~~~  399 (988)
                      +++|++.+.++.+++|++.++++.|+|+++++++++.+++.||++.++.++++.++|.++|+++.+.||++++.+++++.
T Consensus       498 L~nN~l~~~~~aa~aEal~la~k~Gld~~~l~evl~~s~g~s~~~~~~~~~~l~~d~~~~f~l~l~~KDl~l~~~~a~~~  577 (1378)
T PLN02858        498 MVNQLLAGVHIASAAEAMAFGARLGLNTRKLFDIISNAGGTSWMFENRVPHMLDNDYTPYSALDIFVKDLGIVSREGSSR  577 (1378)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHcCCCHHHHHHHHHhhcccChhhhhccchhhcCCCCCCchhHHHHHHHHHHHHHHHHc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCchHHHHHHHHHHHHHHcCCCCCChHHHHHHHHHhhCccccCCCCcchhhhhhccCCCCCCCCchhhhhHhhhcc-Cc
Q 001973          400 RVPLHISTIAHQLFLAGSAAGWGRQDDAAVVKVYETLSGVKVEGRLPVLKKEAVLQSLPSEWPLDPIDDIKGLIKKN-AK  478 (988)
Q Consensus       400 gi~~pi~~a~~~~~~~a~~~g~g~~d~~a~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~  478 (988)
                      |+++|+..++.++|+.+.+.|+|++|++++++++++..|++++++.|++..++.|+.++++|+.++.+++......+ .+
T Consensus       578 g~~~pl~~~~~~~~~~a~~~G~g~~D~sav~~~~~~~~g~~~~~~~p~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~  657 (1378)
T PLN02858        578 KIPLHLSTVAHQLFLAGSASGWGRIDDAAVVKVYETLTGVKVEGRLPVLKKEDVLTSLPAEWPEDPIDDICHRLNMGNSK  657 (1378)
T ss_pred             CCCChHHHHHHHHHHHHHhcCCCccChHHHHHHHHHhcCCCCCCCCCCcCcchhhccCCCcCccchhhhHHHhhccCCCc
Confidence            99999999999999999999999999999999999999999999999999999999999999999998776663333 35


Q ss_pred             EEEEecCCCCcccccccceeEeecChhhHHHhhccCCcEEEEecCCCCCCHHHHHHHHHHHHHHHHHhccccCCCeEEEE
Q 001973          479 TLIVLDDDPTGTQTVHGIEVLTEWSVASLVEQFRKKPLCFFILTNSRALSSEKASSLITDICRNLRTASNSVENTEYTVV  558 (988)
Q Consensus       479 ~~~iiaDD~TGa~~~~g~~~~~~~~~~~~~~~~~~~~dvvvi~T~SR~l~~~~A~~~v~~~~~~l~~~~~~~~~~~~~i~  558 (988)
                      +|+|+|||+||+|.++|+.+++.||++++...+.+..++++|+||||+++|++||++|++++++++.+..+....+|+||
T Consensus       658 ~~vvldddptg~qtv~~~~~l~~wd~~~l~~~~~~~~~v~~i~TnSRal~~~eA~~~v~ei~~~l~~a~~~~~~~~~~i~  737 (1378)
T PLN02858        658 TLVVLDDDPTGTQTVHDVEVLTEWSVESISEQFRKKPACFFILTNSRSLSPEKASELIKDICRNLCAAAKSVGNVDYTIV  737 (1378)
T ss_pred             eEEEECCCCCCCeeecccHhhhcCCHHHHHHHhccCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHhcCCcceEEE
Confidence            89999999999999999999999999999999999999999999999999999999999999999887544223456799


Q ss_pred             eccCCCCCCCchhHHHHHHhhhCCCCEEEEeccccCCCeEEECcEEEEecCCceeecCCCccccCCCCCCCCCcHHHHHH
Q 001973          559 LRGDSTLRGHFPEEADAAVSVLGEMDAWIICPFFLQGGRYTIEDIHYVGDLDQLVPAGDTEFAKDASFGFKSSNLREWVE  638 (988)
Q Consensus       559 kkiDSTLRGnig~Ei~a~~~~~~~~~~~~v~PAfP~~GR~t~~G~~~v~g~~~~~pl~et~~a~Dp~~Pv~~s~l~~~l~  638 (988)
                      ||+|||||||||+|++++++++|+++.++||||||++||||+||+|||||++.++|++||+||+||+||+++|+|++||+
T Consensus       738 kR~DSTLRGn~~~E~da~~~~~g~~d~~i~~PAFp~~GR~Tv~Gvhyv~~~~~~vPv~eTefA~Dp~~p~~~S~l~~~l~  817 (1378)
T PLN02858        738 LRGDSTLRGHFPEEADAAVSVLGEMDAWIICPFFLQGGRYTINDIHYVADSDRLVPAGETEFAKDASFGYKSSNLREWVE  817 (1378)
T ss_pred             eccccccCCCCchhHHHHHHhhCcCcEEEEeccccCCCcEEECCEEEEccCCCcccccCCccccCCCCCCccccHHHHHH
Confidence            99999999999999999999999878999999999999999999999999889999999999999999999999999999


Q ss_pred             hHcCCCCCCCceeEEehHHHhccChhHHHHHHhcccCCCeEEEecCChhHHHHHHHHHHHHHHcCCcEEEEcchHHHHHH
Q 001973          639 EKTSGRIPASSVASISIQLLRKGGPDAVCERLCSLQKGSTCIVNAASERDIAVFAAGMIQAELKGKSFLCRTAASFVSAR  718 (988)
Q Consensus       639 ~q~~~~~~~~~v~~i~l~~v~~~~~~~~~~~l~~~~~~~i~V~Da~t~~dL~~ia~a~~~~~~~~~~~l~vg~agl~~~L  718 (988)
                      +||++++++++|.+|++++||.++.+.+.++|..+.+++++||||+|++||+.||.++.+++..+++++|+|+|+|+.++
T Consensus       818 eqt~g~~~~~~V~~i~l~~lr~g~~~~~~~~L~~~~~~~~vVvDA~t~~DL~~ia~a~~~~~~~gk~~l~~~aA~~~~~~  897 (1378)
T PLN02858        818 EKTKGRISANSVQSISIQLLRKGGPDAVCEHLCSLKKGSTCIVNAASERDMAVFAAGMIQAELKGKRFLCRTAASFVSAR  897 (1378)
T ss_pred             HHcCCCCcccceeEEeHHHHhccCHHHHHHHHHhccCCCEEEEeCCCHHHHHHHHHHHHHHHhcCCeEEEECcHHHHHHH
Confidence            99999999999999999999997678899999877778899999999999999999997755568999999999999998


Q ss_pred             hcccccCCCCccccccccCCCceEEEEeccccccHHHHHHHHhhcCCcEEEEEEehhHHHhhchHhHHHHHHHHHHHHHH
Q 001973          719 IGIVAKAPILPKDLGNKIESTGGLIVVGSYVPKTTKQVEELISQSGRFIRSVEVSVDKVAMKSLEERQEEIIRAAEMVDV  798 (988)
Q Consensus       719 ~~~~~~~~~~~~~~~~~~~~~~~L~v~GS~s~~T~~Qi~~l~~~~~~~~~~i~~~~~~ll~~~~~~~~~~~~~~~~~~~~  798 (988)
                      ......+|..|.........+|+|+||||++++|++|+++|+++.+..+..|++|++++++..++.++++++++++++.+
T Consensus       898 ~~~~~~~~~~~~~~~~~~~~~~~LvvvGS~~~~T~~Ql~~L~~~~~~~~~~i~v~v~~l~~~~~~~~~~~~~~~~~~~~~  977 (1378)
T PLN02858        898 IGIIPKPPVLPKDLESNKESSGGLIVVGSYVPKTTKQVEELKSQCGQSLRSIEVSVEKVAMKSSEVRDEEISRAVEMADA  977 (1378)
T ss_pred             hcCCCCCCCChHHhcccCCCCCEEEEEeCCcHhHHHHHHHHHhCcCCCeeEEEEeHHHHhhccchhHHHHHHHHHHHHHH
Confidence            65433344444444444456789999999999999999999987651146899999999853223456788999999999


Q ss_pred             HHhcCCcEEEEecCcccccCCccchHHHHHHHHHHHHHHHHHhhcCcceeeeccccchHHHHHhhccccceEEecccccC
Q 001973          799 FLQARKDTLLITSRVLITGKTPSESLEINLKVSSAMVEIVRRITTRPRYILAKGGITSSDIATKALEAKRAKVVGQALAG  878 (988)
Q Consensus       799 ~l~~~~~~vi~t~~~~~~~~~~~~~~~~~~~i~~~l~~i~~~~~~~~~~li~tGGdTs~~v~~~~Lg~~~~~~~~ei~pG  878 (988)
                      .+++|++++|+|++......+...+.+++.+|++.|+++++++..++++||+||||||.+++++.||++++++++||+||
T Consensus       978 ~l~~g~~~vv~Tsr~~~~~~~~~~~~~~~~~Is~~L~~iv~~l~~~~~~li~kGGdTs~~vl~~~L~~~~~~l~gei~pG 1057 (1378)
T PLN02858        978 FLRAGKDTLIMTSRELITGKTPSESLDINSKVSSALVEIVRRISTRPRYILAKGGITSSDLATKALEARRAKVVGQALAG 1057 (1378)
T ss_pred             HHHcCCCEEEEeChhhccCCCHHHHHHHHHHHHHHHHHHHHhccccCCEEEeCCchhHHHHHHhhcCcceeeeecccccC
Confidence            99999999999998766566667789999999999999999998889999999999999997799999999999999999


Q ss_pred             CcEEEcCCCCCCCCCcEEecCCCCCChhHHHHHHHHhccCcccccHHHHHHHHHHCCceeeeeccCchhHHHHHHHHHHH
Q 001973          879 VPLWELGPESRHPGVPYVVFPGNVGDNNAVANVVRSWARPVRISSTKELLLNAEKGEYAVGAFNVYNMEGVEAVVAAAEE  958 (988)
Q Consensus       879 vp~~~~~~~g~~~gl~ivtK~G~fG~~~~l~~~~~~l~~~~~lv~~~~ll~~A~~~~yav~afn~~~~e~~~a~~~aAe~  958 (988)
                      ||++++.+++.++|+|||||+|+||++++|.+++++|.++-+ |||++||++|++++||||||||+|+|+++|+++|||+
T Consensus      1058 vp~~~~~~~~~~~glpvVtk~G~~G~~~tL~~~~~~l~~~~~-v~~~~~l~~A~~~~yav~afn~~n~e~~~avi~aAe~ 1136 (1378)
T PLN02858       1058 VPLWKLGPESRHPGVPYIVFPGNVGDSTALAEVVKSWARPAR-SSTKELLLNAEKGGYAVGAFNVYNLEGIEAVVAAAEA 1136 (1378)
T ss_pred             CceEEecCCCCCCCCcEEEeCCcCCChHHHHHHHHHhcCcCC-ccHHHHHHHHHHCCcEEEEEEeCCHHHHHHHHHHHHH
Confidence            999999645678999999999999999999999999999987 9999999999999999999999999999999999999


Q ss_pred             cCCCEEEEeccchhcccCHHHHHhhh
Q 001973          959 ERSPAILQVRSTCFKVQYITLVTSSI  984 (988)
Q Consensus       959 ~~~Pvil~~~~~~~~~~~~~~~~~~~  984 (988)
                      +++|||||+++++++|.|.+++.+++
T Consensus      1137 ~~sPvIl~~~~~~~~~~~~~~~~~~~ 1162 (1378)
T PLN02858       1137 EKSPAILQVHPGALKQGGIPLVSCCI 1162 (1378)
T ss_pred             hCCCEEEECCccHHhhcCHHHHHHHH
Confidence            99999999999999999988555544

>COG3395 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG2084 MmsB 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism] Back     alignment and domain information
>KOG0409 consensus Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>PRK15059 tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>PRK15461 NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PLN02858 fructose-bisphosphate aldolase Back     alignment and domain information
>TIGR01692 HIBADH 3-hydroxyisobutyrate dehydrogenase Back     alignment and domain information
>PRK11559 garR tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase Back     alignment and domain information
>PLN02350 phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK12490 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase Back     alignment and domain information
>TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PTZ00142 6-phosphogluconate dehydrogenase; Provisional Back     alignment and domain information
>TIGR00873 gnd 6-phosphogluconate dehydrogenase, decarboxylating Back     alignment and domain information
>PRK15182 Vi polysaccharide biosynthesis protein TviB; Provisional Back     alignment and domain information
>PRK09287 6-phosphogluconate dehydrogenase; Validated Back     alignment and domain information
>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK15057 UDP-glucose 6-dehydrogenase; Provisional Back     alignment and domain information
>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional Back     alignment and domain information
>PF07005 DUF1537: Protein of unknown function, DUF1537; InterPro: IPR010737 This entry represents a conserved region found in a range of Proteobacteria as well as the Gram-positive Oceanobacillus iheyensis Back     alignment and domain information
>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>COG1023 Gnd Predicted 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PLN02353 probable UDP-glucose 6-dehydrogenase Back     alignment and domain information
>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>COG0677 WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>COG0362 Gnd 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG0240 GpsA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PF14833 NAD_binding_11: NAD-binding of NADP-dependent 3-hydroxyisobutyrate dehydrogenase; PDB: 3OBB_A 3Q3C_A 2UYY_D 3G0O_A 1WP4_A 2CVZ_B 1YB4_A 3PDU_G 2I9P_D 2GF2_D Back     alignment and domain information
>PRK08229 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>COG2084 MmsB 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism] Back     alignment and domain information
>KOG0409 consensus Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>PRK12557 H(2)-dependent methylenetetrahydromethanopterin dehydrogenase-related protein; Provisional Back     alignment and domain information
>KOG2653 consensus 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated Back     alignment and domain information
>PRK07679 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK08268 3-hydroxy-acyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK15059 tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>PLN02688 pyrroline-5-carboxylate reductase Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PF14833 NAD_binding_11: NAD-binding of NADP-dependent 3-hydroxyisobutyrate dehydrogenase; PDB: 3OBB_A 3Q3C_A 2UYY_D 3G0O_A 1WP4_A 2CVZ_B 1YB4_A 3PDU_G 2I9P_D 2GF2_D Back     alignment and domain information
>PTZ00345 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK12439 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC Back     alignment and domain information
>TIGR03376 glycerol3P_DH glycerol-3-phosphate dehydrogenase (NAD(+)) Back     alignment and domain information
>PRK15461 NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PLN02545 3-hydroxybutyryl-CoA dehydrogenase Back     alignment and domain information
>PRK08507 prephenate dehydrogenase; Validated Back     alignment and domain information
>PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK14620 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR01692 HIBADH 3-hydroxyisobutyrate dehydrogenase Back     alignment and domain information
>TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase Back     alignment and domain information
>PRK08655 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK07417 arogenate dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01724 hmd_rel H2-forming N(5),N(10)-methenyltetrahydromethanopterin dehydrogenase-related protein Back     alignment and domain information
>PRK11559 garR tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK12921 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>KOG2666 consensus UDP-glucose/GDP-mannose dehydrogenase [Carbohydrate transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PRK06522 2-dehydropantoate 2-reductase; Reviewed Back     alignment and domain information
>PRK11880 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK06476 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK12491 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>PRK06249 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>COG0191 Fba Fructose/tagatose bisphosphate aldolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK07680 late competence protein ComER; Validated Back     alignment and domain information
>PRK08269 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK12737 gatY tagatose-bisphosphate aldolase; Reviewed Back     alignment and domain information
>PRK12738 kbaY tagatose-bisphosphate aldolase; Reviewed Back     alignment and domain information
>PRK09195 gatY tagatose-bisphosphate aldolase; Reviewed Back     alignment and domain information
>PRK07502 cyclohexadienyl dehydrogenase; Validated Back     alignment and domain information
>PRK12857 fructose-1,6-bisphosphate aldolase; Reviewed Back     alignment and domain information
>PRK07709 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>TIGR00167 cbbA ketose-bisphosphate aldolases Back     alignment and domain information
>PRK06545 prephenate dehydrogenase; Validated Back     alignment and domain information
>PRK06806 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>PRK06801 hypothetical protein; Provisional Back     alignment and domain information
>PRK13399 fructose-1,6-bisphosphate aldolase; Provisional Back     alignment and domain information
>PRK09196 fructose-1,6-bisphosphate aldolase; Reviewed Back     alignment and domain information
>PRK08610 fructose-bisphosphate aldolase; Reviewed Back     alignment and domain information
>PRK05835 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>PRK07315 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>PRK07998 gatY putative fructose-1,6-bisphosphate aldolase; Reviewed Back     alignment and domain information
>PRK07084 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>COG0345 ProC Pyrroline-5-carboxylate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01858 tag_bisphos_ald class II aldolase, tagatose bisphosphate family Back     alignment and domain information
>PLN02256 arogenate dehydrogenase Back     alignment and domain information
>TIGR01521 FruBisAldo_II_B fructose-bisphosphate aldolase, class II, Calvin cycle subtype Back     alignment and domain information
>PF01116 F_bP_aldolase: Fructose-bisphosphate aldolase class-II; InterPro: IPR000771 Fructose-bisphosphate aldolase [, ] is a glycolytic enzyme that catalyses the reversible aldol cleavage or condensation of fructose-1,6-bisphosphate into dihydroxyacetone-phosphate and glyceraldehyde 3-phosphate Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>PRK05708 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>COG1893 ApbA Ketopantoate reductase [Coenzyme metabolism] Back     alignment and domain information
>COG1250 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabolism] Back     alignment and domain information
>PTZ00431 pyrroline carboxylate reductase; Provisional Back     alignment and domain information
>PRK07634 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>COG0287 TyrA Prephenate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01859 fruc_bis_ald_ fructose-1,6-bisphosphate aldolase, class II, various bacterial and amitochondriate protist Back     alignment and domain information
>TIGR01915 npdG NADPH-dependent F420 reductase Back     alignment and domain information
>PRK08185 hypothetical protein; Provisional Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>PRK05479 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>PRK06928 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>PRK12490 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>COG2085 Predicted dinucleotide-binding enzymes [General function prediction only] Back     alignment and domain information
>cd00947 TBP_aldolase_IIB Tagatose-1,6-bisphosphate (TBP) aldolase and related Type B Class II aldolases Back     alignment and domain information
>TIGR02440 FadJ fatty oxidation complex, alpha subunit FadJ Back     alignment and domain information
>PRK14806 bifunctional cyclohexadienyl dehydrogenase/ 3-phosphoshikimate 1-carboxyvinyltransferase; Provisional Back     alignment and domain information
>PRK11154 fadJ multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>TIGR01520 FruBisAldo_II_A fructose-bisphosphate aldolase, class II, yeast/E Back     alignment and domain information
>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain Back     alignment and domain information
>TIGR02437 FadB fatty oxidation complex, alpha subunit FadB Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>PRK09197 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>TIGR02441 fa_ox_alpha_mit fatty acid oxidation complex, alpha subunit, mitochondrial Back     alignment and domain information
>PRK08818 prephenate dehydrogenase; Provisional Back     alignment and domain information
>cd00453 FTBP_aldolase_II Fructose/tagarose-bisphosphate aldolase class II Back     alignment and domain information
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase Back     alignment and domain information
>cd00946 FBP_aldolase_IIA Class II Type A, Fructose-1,6-bisphosphate (FBP) aldolases Back     alignment and domain information
>PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins Back     alignment and domain information
>PRK07574 formate dehydrogenase; Provisional Back     alignment and domain information
>TIGR00745 apbA_panE 2-dehydropantoate 2-reductase Back     alignment and domain information
>TIGR00465 ilvC ketol-acid reductoisomerase Back     alignment and domain information
>KOG2304 consensus 3-hydroxyacyl-CoA dehydrogenase [Lipid transport and metabolism] Back     alignment and domain information
>PRK12480 D-lactate dehydrogenase; Provisional Back     alignment and domain information
>PLN03139 formate dehydrogenase; Provisional Back     alignment and domain information
>PRK06436 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK08605 D-lactate dehydrogenase; Validated Back     alignment and domain information
>COG4007 Predicted dehydrogenase related to H2-forming N5,N10-methylenetetrahydromethanopterin dehydrogenase [General function prediction only] Back     alignment and domain information
>PRK13243 glyoxylate reductase; Reviewed Back     alignment and domain information
>PLN02350 phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>PF02153 PDH: Prephenate dehydrogenase; InterPro: IPR003099 Members of this family are prephenate dehydrogenases 1 Back     alignment and domain information
>PRK13403 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional Back     alignment and domain information
>KOG2380 consensus Prephenate dehydrogenase (NADP+) [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2711 consensus Glycerol-3-phosphate dehydrogenase/dihydroxyacetone 3-phosphate reductase [Energy production and conversion] Back     alignment and domain information
>COG1052 LdhA Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>TIGR01327 PGDH D-3-phosphoglycerate dehydrogenase Back     alignment and domain information
>PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>TIGR00112 proC pyrroline-5-carboxylate reductase Back     alignment and domain information
>PRK13302 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PLN02928 oxidoreductase family protein Back     alignment and domain information
>PRK00257 erythronate-4-phosphate dehydrogenase; Validated Back     alignment and domain information
>PF07991 IlvN: Acetohydroxy acid isomeroreductase, catalytic domain; InterPro: IPR013116 Acetohydroxy acid isomeroreductase catalyses the conversion of acetohydroxy acids into dihydroxy valerates Back     alignment and domain information
>PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK08410 2-hydroxyacid dehydrogenase; Provisional Back     alignment and domain information
>PRK15409 bifunctional glyoxylate/hydroxypyruvate reductase B; Provisional Back     alignment and domain information
>PRK06487 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PF00984 UDPG_MGDP_dh: UDP-glucose/GDP-mannose dehydrogenase family, central domain; InterPro: IPR014026 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>KOG0069 consensus Glyoxylate/hydroxypyruvate reductase (D-isomer-specific 2-hydroxy acid dehydrogenase superfamily) [Energy production and conversion] Back     alignment and domain information
>PRK06932 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK06444 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK14194 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>PRK15438 erythronate-4-phosphate dehydrogenase PdxB; Provisional Back     alignment and domain information
>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK06141 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK13304 L-aspartate dehydrogenase; Reviewed Back     alignment and domain information
>PRK15182 Vi polysaccharide biosynthesis protein TviB; Provisional Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PLN02306 hydroxypyruvate reductase Back     alignment and domain information
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information
>PRK14188 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 Back     alignment and domain information
>TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>KOG2305 consensus 3-hydroxyacyl-CoA dehydrogenase [Lipid transport and metabolism] Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>KOG3124 consensus Pyrroline-5-carboxylate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR00507 aroE shikimate 5-dehydrogenase Back     alignment and domain information
>PF01408 GFO_IDH_MocA: Oxidoreductase family, NAD-binding Rossmann fold; InterPro: IPR000683 This group of enzymes utilise NADP or NAD, and is known as the GFO/IDH/MOCA family in UniProtKB/Swiss-Prot Back     alignment and domain information
>PRK14179 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PLN00203 glutamyl-tRNA reductase Back     alignment and domain information
>TIGR02371 ala_DH_arch alanine dehydrogenase, Archaeoglobus fulgidus type Back     alignment and domain information
>PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>PTZ00075 Adenosylhomocysteinase; Provisional Back     alignment and domain information
>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional Back     alignment and domain information
>PRK05225 ketol-acid reductoisomerase; Validated Back     alignment and domain information
>PRK15057 UDP-glucose 6-dehydrogenase; Provisional Back     alignment and domain information
>PLN02494 adenosylhomocysteinase Back     alignment and domain information
>TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent Back     alignment and domain information
>COG1712 Predicted dinucleotide-utilizing enzyme [General function prediction only] Back     alignment and domain information
>smart00859 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain Back     alignment and domain information
>TIGR00936 ahcY adenosylhomocysteinase Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] Back     alignment and domain information
>TIGR01921 DAP-DH diaminopimelate dehydrogenase Back     alignment and domain information
>COG0059 IlvC Ketol-acid reductoisomerase [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PRK06223 malate dehydrogenase; Reviewed Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PRK00045 hemA glutamyl-tRNA reductase; Reviewed Back     alignment and domain information
>PLN02353 probable UDP-glucose 6-dehydrogenase Back     alignment and domain information
>PRK13301 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK13940 glutamyl-tRNA reductase; Provisional Back     alignment and domain information
>COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] Back     alignment and domain information
>PRK07340 ornithine cyclodeaminase; Validated Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>COG5495 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK09287 6-phosphogluconate dehydrogenase; Validated Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>PRK13303 L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK08229 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>TIGR01035 hemA glutamyl-tRNA reductase Back     alignment and domain information
>PRK09310 aroDE bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase protein; Reviewed Back     alignment and domain information
>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PRK00066 ldh L-lactate dehydrogenase; Reviewed Back     alignment and domain information
>cd05297 GH4_alpha_glucosidase_galactosidase Glycoside Hydrolases Family 4; Alpha-glucosidases and alpha-galactosidases Back     alignment and domain information
>PRK00048 dihydrodipicolinate reductase; Provisional Back     alignment and domain information
>PRK06823 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PF01118 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD binding domain; InterPro: IPR000534 The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate Back     alignment and domain information
>PRK06407 ornithine cyclodeaminase; Provisional Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>KOG0068 consensus D-3-phosphoglycerate dehydrogenase, D-isomer-specific 2-hydroxy acid dehydrogenase superfamily [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02992 ectoine_eutC ectoine utilization protein EutC Back     alignment and domain information
>PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] Back     alignment and domain information
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>PRK06046 alanine dehydrogenase; Validated Back     alignment and domain information
>PTZ00082 L-lactate dehydrogenase; Provisional Back     alignment and domain information
>PRK08618 ornithine cyclodeaminase; Validated Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK08300 acetaldehyde dehydrogenase; Validated Back     alignment and domain information
>COG0673 MviM Predicted dehydrogenases and related proteins [General function prediction only] Back     alignment and domain information
>PTZ00117 malate dehydrogenase; Provisional Back     alignment and domain information
>COG2423 Predicted ornithine cyclodeaminase, mu-crystallin homolog [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00036 dapB dihydrodipicolinate reductase Back     alignment and domain information
>cd01339 LDH-like_MDH L-lactate dehydrogenase-like malate dehydrogenase proteins Back     alignment and domain information
>PF02423 OCD_Mu_crystall: Ornithine cyclodeaminase/mu-crystallin family; InterPro: IPR003462 This entry represents the bacterial ornithine cyclodeaminase enzyme family, which catalyse the deamination of ornithine to proline [] Back     alignment and domain information
>cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins Back     alignment and domain information
>PRK00961 H(2)-dependent methylenetetrahydromethanopterin dehydrogenase; Provisional Back     alignment and domain information
>TIGR01723 hmd_TIGR 5,10-methenyltetrahydromethanopterin hydrogenase Back     alignment and domain information
>PRK07589 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK08291 ectoine utilization protein EutC; Validated Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>PRK11579 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK06199 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK00436 argC N-acetyl-gamma-glutamyl-phosphate reductase; Validated Back     alignment and domain information
>PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase Back     alignment and domain information
>TIGR01761 thiaz-red thiazolinyl imide reductase Back     alignment and domain information
>cd05294 LDH-like_MDH_nadp A lactate dehydrogenases-like structure with malate dehydrogenase enzymatic activity Back     alignment and domain information
>cd05293 LDH_1 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>TIGR01850 argC N-acetyl-gamma-glutamyl-phosphate reductase, common form Back     alignment and domain information
>TIGR03215 ac_ald_DH_ac acetaldehyde dehydrogenase (acetylating) Back     alignment and domain information
>TIGR00873 gnd 6-phosphogluconate dehydrogenase, decarboxylating Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK04207 glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>cd00300 LDH_like L-lactate dehydrogenase-like enzymes Back     alignment and domain information
>cd00650 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family Back     alignment and domain information
>TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit Back     alignment and domain information
>PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 Back     alignment and domain information
>COG2344 AT-rich DNA-binding protein [General function prediction only] Back     alignment and domain information
>PRK03659 glutathione-regulated potassium-efflux system protein KefB; Provisional Back     alignment and domain information
>PRK10669 putative cation:proton antiport protein; Provisional Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>PRK05472 redox-sensing transcriptional repressor Rex; Provisional Back     alignment and domain information
>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase Back     alignment and domain information
>PTZ00142 6-phosphogluconate dehydrogenase; Provisional Back     alignment and domain information
>PRK05442 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK14189 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>PRK00676 hemA glutamyl-tRNA reductase; Validated Back     alignment and domain information
>PRK06349 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>PF10100 DUF2338: Uncharacterized protein conserved in bacteria (DUF2338); InterPro: IPR016935 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG2741 consensus Dimeric dihydrodiol dehydrogenase [Carbohydrate transport and metabolism; Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>PRK10206 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK15076 alpha-galactosidase; Provisional Back     alignment and domain information
>COG2910 Putative NADH-flavin reductase [General function prediction only] Back     alignment and domain information
>PLN02968 Probable N-acetyl-gamma-glutamyl-phosphate reductase Back     alignment and domain information
>TIGR01759 MalateDH-SF1 malate dehydrogenase Back     alignment and domain information
>PLN02602 lactate dehydrogenase Back     alignment and domain information
>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>PRK05671 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>PF02882 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain; InterPro: IPR020631 Enzymes that participate in the transfer of one-carbon units require the coenzyme tetrahydrofolate (THF) Back     alignment and domain information
>PF00393 6PGD: 6-phosphogluconate dehydrogenase, C-terminal domain; InterPro: IPR006114 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type Back     alignment and domain information
>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 Back     alignment and domain information
>PRK00683 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK02318 mannitol-1-phosphate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional Back     alignment and domain information
>PRK10792 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd01338 MDH_choloroplast_like Chloroplast-like malate dehydrogenases Back     alignment and domain information
>PRK05086 malate dehydrogenase; Provisional Back     alignment and domain information
>PF13380 CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5A_A 2D59_A 2E6U_X 1IUL_A 1IUK_A 1Y81_A 2DUW_A Back     alignment and domain information
>COG0002 ArgC Acetylglutamate semialdehyde dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>PRK14982 acyl-ACP reductase; Provisional Back     alignment and domain information
>PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PLN00112 malate dehydrogenase (NADP); Provisional Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>cd05211 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PRK11863 N-acetyl-gamma-glutamyl-phosphate reductase; Provisional Back     alignment and domain information
>PRK14191 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14176 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>cd01487 E1_ThiF_like E1_ThiF_like Back     alignment and domain information
>PF03720 UDPG_MGDP_dh_C: UDP-glucose/GDP-mannose dehydrogenase family, UDP binding domain; InterPro: IPR014027 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>PRK00421 murC UDP-N-acetylmuramate--L-alanine ligase; Provisional Back     alignment and domain information
>cd01337 MDH_glyoxysomal_mitochondrial Glyoxysomal and mitochondrial malate dehydrogenases Back     alignment and domain information
>cd05290 LDH_3 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>TIGR01757 Malate-DH_plant malate dehydrogenase, NADP-dependent Back     alignment and domain information
>PRK06270 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PRK08664 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>COG0686 Ald Alanine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>cd01336 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosolic Malate dehydrogenases Back     alignment and domain information
>PLN00106 malate dehydrogenase Back     alignment and domain information
>cd00704 MDH Malate dehydrogenase Back     alignment and domain information
>cd01076 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 1 Back     alignment and domain information
>PRK14183 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG0039 Mdh Malate/lactate dehydrogenases [Energy production and conversion] Back     alignment and domain information
>PRK14874 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PTZ00325 malate dehydrogenase; Provisional Back     alignment and domain information
>COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>PRK01390 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>PRK08040 putative semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>COG0771 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK06728 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>COG4408 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PLN02383 aspartate semialdehyde dehydrogenase Back     alignment and domain information
>PF03447 NAD_binding_3: Homoserine dehydrogenase, NAD binding domain; InterPro: IPR005106 Bacteria, plants and fungi metabolise aspartic acid to produce four amino acids - lysine, threonine, methionine and isoleucine - in a series of reactions known as the aspartate pathway Back     alignment and domain information
>PRK14178 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>cd05212 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PF07479 NAD_Gly3P_dh_C: NAD-dependent glycerol-3-phosphate dehydrogenase C-terminus; InterPro: IPR006109 NAD-dependent glycerol-3-phosphate dehydrogenase (1 Back     alignment and domain information
>PRK00141 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR01772 MDH_euk_gproteo malate dehydrogenase, NAD-dependent Back     alignment and domain information
>TIGR01296 asd_B aspartate-semialdehyde dehydrogenase (peptidoglycan organisms) Back     alignment and domain information
>cd01079 NAD_bind_m-THF_DH NAD binding domain of methylene-tetrahydrofolate dehydrogenase Back     alignment and domain information
>PRK08644 thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>TIGR00978 asd_EA aspartate-semialdehyde dehydrogenase (non-peptidoglycan organisms) Back     alignment and domain information
>COG0499 SAM1 S-adenosylhomocysteine hydrolase [Coenzyme metabolism] Back     alignment and domain information
>PRK07326 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK14170 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14573 bifunctional D-alanyl-alanine synthetase A/UDP-N-acetylmuramate--L-alanine ligase; Provisional Back     alignment and domain information
>PRK12548 shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>TIGR01851 argC_other N-acetyl-gamma-glutamyl-phosphate reductase, uncommon form Back     alignment and domain information
>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>PRK02006 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG0289 DapB Dihydrodipicolinate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR01758 MDH_euk_cyt malate dehydrogenase, NAD-dependent Back     alignment and domain information
>TIGR01771 L-LDH-NAD L-lactate dehydrogenase Back     alignment and domain information
>TIGR01082 murC UDP-N-acetylmuramate--alanine ligase Back     alignment and domain information
>PRK14173 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK07774 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK07454 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>PRK14169 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14186 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14166 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK08223 hypothetical protein; Validated Back     alignment and domain information
>PRK08328 hypothetical protein; Provisional Back     alignment and domain information
>PRK03803 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK14180 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF02629 CoA_binding: CoA binding domain; InterPro: IPR003781 This domain has a Rossmann fold and is found in a number of proteins including succinyl CoA synthetases, malate and ATP-citrate ligases Back     alignment and domain information
>PRK14177 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>KOG4153 consensus Fructose 1,6-bisphosphate aldolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB Back     alignment and domain information
>PRK07067 sorbitol dehydrogenase; Provisional Back     alignment and domain information
>PLN02516 methylenetetrahydrofolate dehydrogenase (NADP+) Back     alignment and domain information
>PRK14172 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC Back     alignment and domain information
>PRK06392 homoserine dehydrogenase; Provisional Back     alignment and domain information
>COG0460 ThrA Homoserine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK07109 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional Back     alignment and domain information
>PF02056 Glyco_hydro_4: Family 4 glycosyl hydrolase; InterPro: IPR001088 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PRK08374 homoserine dehydrogenase; Provisional Back     alignment and domain information
>TIGR01546 GAPDH-II_archae glyceraldehyde-3-phosphate dehydrogenase, type II Back     alignment and domain information
>PRK14027 quinate/shikimate dehydrogenase; Provisional Back     alignment and domain information
>PRK14187 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA Back     alignment and domain information
>TIGR02717 AcCoA-syn-alpha acetyl coenzyme A synthetase (ADP forming), alpha domain Back     alignment and domain information
>PRK14171 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK06180 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK14190 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>KOG1502 consensus Flavonol reductase/cinnamoyl-CoA reductase [Defense mechanisms] Back     alignment and domain information
>PRK11861 bifunctional prephenate dehydrogenase/3-phosphoshikimate 1-carboxyvinyltransferase; Provisional Back     alignment and domain information
>PRK05678 succinyl-CoA synthetase subunit alpha; Validated Back     alignment and domain information
>PRK06182 short chain dehydrogenase; Validated Back     alignment and domain information
>KOG3007 consensus Mu-crystallin [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK14182 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>COG0026 PurK Phosphoribosylaminoimidazole carboxylase (NCAIR synthetase) [Nucleotide transport and metabolism] Back     alignment and domain information
>COG0190 FolD 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl tetrahydrofolate cyclohydrolase [Coenzyme metabolism] Back     alignment and domain information
>PLN00141 Tic62-NAD(P)-related group II protein; Provisional Back     alignment and domain information
>PRK04308 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK14193 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>PLN02897 tetrahydrofolate dehydrogenase/cyclohydrolase, putative Back     alignment and domain information
>PRK05993 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK14181 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG1648 CysG Siroheme synthase (precorrin-2 oxidase/ferrochelatase domain) [Coenzyme metabolism] Back     alignment and domain information
>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional Back     alignment and domain information
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK05866 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06139 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>PRK08265 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12939 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>cd01485 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-like Back     alignment and domain information
>PRK12828 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd08230 glucose_DH Glucose dehydrogenase Back     alignment and domain information
>COG4091 Predicted homoserine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01087 murD UDP-N-acetylmuramoylalanine--D-glutamate ligase Back     alignment and domain information
>PRK07478 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 Back     alignment and domain information
>PRK02705 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>cd05197 GH4_glycoside_hydrolases Glycoside Hydrases Family 4 Back     alignment and domain information
>PRK03806 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family Back     alignment and domain information
>PRK10538 malonic semialdehyde reductase; Provisional Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>PRK06598 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>PRK05867 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12749 quinate/shikimate dehydrogenase; Reviewed Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>KOG0022 consensus Alcohol dehydrogenase, class III [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase Back     alignment and domain information
>PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed Back     alignment and domain information
>PLN02616 tetrahydrofolate dehydrogenase/cyclohydrolase, putative Back     alignment and domain information
>PRK09880 L-idonate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK12550 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>TIGR03466 HpnA hopanoid-associated sugar epimerase Back     alignment and domain information
>PRK07825 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional Back     alignment and domain information
>PRK07890 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>PRK12829 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09414 glutamate dehydrogenase; Provisional Back     alignment and domain information
>PRK06153 hypothetical protein; Provisional Back     alignment and domain information
>PRK14185 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>TIGR01019 sucCoAalpha succinyl-CoA synthetase, alpha subunit Back     alignment and domain information
>PRK03815 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG0493 GltD NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PRK04663 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PLN02477 glutamate dehydrogenase Back     alignment and domain information
>PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G Back     alignment and domain information
>PLN02695 GDP-D-mannose-3',5'-epimerase Back     alignment and domain information
>PRK05693 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06124 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK06194 hypothetical protein; Provisional Back     alignment and domain information
>PRK06185 hypothetical protein; Provisional Back     alignment and domain information
>PRK14168 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR03736 PRTRC_ThiF PRTRC system ThiF family protein Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>PRK14851 hypothetical protein; Provisional Back     alignment and domain information
>KOG0399 consensus Glutamate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02427 UDP-apiose/xylose synthase Back     alignment and domain information
>PRK14167 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK07576 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK14174 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PLN02214 cinnamoyl-CoA reductase Back     alignment and domain information
>PRK01368 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query988
3g0o_A303 Crystal Structure Of 3-Hydroxyisobutyrate Dehydroge 1e-39
3cky_A301 Structural And Kinetic Properties Of A Beta-Hydroxy 1e-33
2gf2_A296 Crystal Structure Of Human Hydroxyisobutyrate Dehyd 2e-30
2i9p_A319 Crystal Structure Of Human Hydroxyisobutyrate Dehyd 2e-30
3pdu_A287 Crystal Structure Of Gamma-Hydroxybutyrate Dehydrog 4e-18
3pef_A287 Crystal Structure Of Gamma-Hydroxybutyrate Dehydrog 8e-18
1vpd_A299 X-Ray Crystal Structure Of Tartronate Semialdehyde 3e-17
3doj_A310 Structure Of Glyoxylate Reductase 1 From Arabidopsi 6e-16
1wp4_A289 Structure Of Tt368 Protein From Thermus Thermophilu 2e-15
1yb4_A295 Crystal Structure Of The Tartronic Semialdehyde Red 2e-14
2cvz_A289 Structure Of Hydroxyisobutyrate Dehydrogenase From 2e-13
2uyy_A316 Structure Of The Cytokine-Like Nuclear Factor N-Pac 8e-11
4dll_A320 Crystal Structure Of A 2-Hydroxy-3-Oxopropionate Re 2e-07
3q3c_A299 Crystal Structure Of A Serine Dehydrogenase From Ps 3e-07
3obb_A300 Crystal Structure Of A Possible 3-Hydroxyisobutyrat 3e-07
3qha_A296 Crystal Structure Of A Putative Oxidoreductase From 5e-06
>pdb|3G0O|A Chain A, Crystal Structure Of 3-Hydroxyisobutyrate Dehydrogenase (Ygbj) From Salmonella Typhimurium Length = 303 Back     alignment and structure 
Iteration: 1

 Score =  162 bits (409), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 106/273 (38%), Positives = 154/273 (56%), Gaps = 3/273 (1%)
Query: 162 ATHLLRSNFTVIGYDVYRPTLTKFQNVGGLIANSPA-EAAKDVGVLVIMVTNEAQAESVL 220
           A   LR+  +  G D+           G   A + A E A  V  LVI+V N AQ   VL
Sbjct: 23  ARSCLRAGLSTWGADLNPQACANLLAEGACGAAASAREFAGVVDALVILVVNAAQVRQVL 82
Query: 221 YGDXXXXXXXXXXXXXXXXXXXXPGFVSQLERRLQFEGKDLKLVDAPVSGGVKRASMGEL 280
           +G+                         ++   L     +L  +DAPVSGG  +A+ GE 
Sbjct: 83  FGEDGVAHLXKPGSAVXVSSTISSADAQEIAAALT--ALNLNXLDAPVSGGAVKAAQGEX 140
Query: 281 TIMAAGTEESLKSTGSVLSALSEKLYVIKGGCGAGSGVKMANQLLAGVHIASAAEAMAFG 340
           T+ A+G+E +      VL A++  +Y I    GAGS VK+ +QLLAGVHIA+AAEA A  
Sbjct: 141 TVXASGSEAAFTRLKPVLDAVASNVYRISDTPGAGSTVKIIHQLLAGVHIAAAAEAXALA 200
Query: 341 ARLGLNTRVLFNIITDSGGSSWMFENRVPHMLDNDYTPYSALDIFVKDMGIIARECLSQR 400
           AR G+   V ++++T + G+SW FENR  H++D DYTP SA+DIFVKD+G++A    + R
Sbjct: 201 ARAGIPLDVXYDVVTHAAGNSWXFENRXQHVVDGDYTPRSAVDIFVKDLGLVADTAKALR 260
Query: 401 VPLHISTIAHQLFLAGSAAGWGRQDDAAVVKVY 433
            PL +++ A   F + S AG+G++DD+AV+K++
Sbjct: 261 FPLPLASTALNXFTSASNAGYGKEDDSAVIKIF 293
>pdb|3CKY|A Chain A, Structural And Kinetic Properties Of A Beta-Hydroxyacid Dehydrogenase Involved In Nicotinate Fermentation Length = 301 Back     alignment and structure
>pdb|2GF2|A Chain A, Crystal Structure Of Human Hydroxyisobutyrate Dehydrogenase Length = 296 Back     alignment and structure
>pdb|2I9P|A Chain A, Crystal Structure Of Human Hydroxyisobutyrate Dehydrogenase Complexed With Nad+ Length = 319 Back     alignment and structure
>pdb|3PDU|A Chain A, Crystal Structure Of Gamma-Hydroxybutyrate Dehydrogenase From Geobacter Sulfurreducens In Complex With Nadp+ Length = 287 Back     alignment and structure
>pdb|3PEF|A Chain A, Crystal Structure Of Gamma-Hydroxybutyrate Dehydrogenase From Geobacter Metallireducens In Complex With Nadp+ Length = 287 Back     alignment and structure
>pdb|1VPD|A Chain A, X-Ray Crystal Structure Of Tartronate Semialdehyde Reductase [salmonella Typhimurium Lt2] Length = 299 Back     alignment and structure
>pdb|3DOJ|A Chain A, Structure Of Glyoxylate Reductase 1 From Arabidopsis (Atglyr1) Length = 310 Back     alignment and structure
>pdb|1WP4|A Chain A, Structure Of Tt368 Protein From Thermus Thermophilus Hb8 Length = 289 Back     alignment and structure
>pdb|1YB4|A Chain A, Crystal Structure Of The Tartronic Semialdehyde Reductase From Salmonella Typhimurium Lt2 Length = 295 Back     alignment and structure
>pdb|2CVZ|A Chain A, Structure Of Hydroxyisobutyrate Dehydrogenase From Thermus Thermophilus Hb8 Length = 289 Back     alignment and structure
>pdb|2UYY|A Chain A, Structure Of The Cytokine-Like Nuclear Factor N-Pac Length = 316 Back     alignment and structure
>pdb|4DLL|A Chain A, Crystal Structure Of A 2-Hydroxy-3-Oxopropionate Reductase From Polaromonas Sp. Js666 Length = 320 Back     alignment and structure
>pdb|3Q3C|A Chain A, Crystal Structure Of A Serine Dehydrogenase From Pseudomonas Aeruginosa Pao1 In Complex With Nad Length = 299 Back     alignment and structure
>pdb|3OBB|A Chain A, Crystal Structure Of A Possible 3-Hydroxyisobutyrate Dehydrogenase From Pseudomonas Aeruginosa Pao1 Length = 300 Back     alignment and structure
>pdb|3QHA|A Chain A, Crystal Structure Of A Putative Oxidoreductase From Mycobacterium Avium 104 Length = 296 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query988
3g0o_A303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 1e-106
3g0o_A303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 4e-21
3cky_A301 2-hydroxymethyl glutarate dehydrogenase; rossmann 2e-90
3cky_A301 2-hydroxymethyl glutarate dehydrogenase; rossmann 4e-19
2gf2_A296 Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct 6e-80
2gf2_A296 Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct 5e-14
3pdu_A287 3-hydroxyisobutyrate dehydrogenase family protein; 4e-77
3pdu_A287 3-hydroxyisobutyrate dehydrogenase family protein; 7e-15
1vpd_A299 Tartronate semialdehyde reductase; structural geno 1e-76
1vpd_A299 Tartronate semialdehyde reductase; structural geno 5e-15
2uyy_A316 N-PAC protein; long-chain dehydrogenase, cytokine; 2e-76
2uyy_A316 N-PAC protein; long-chain dehydrogenase, cytokine; 4e-15
3pef_A287 6-phosphogluconate dehydrogenase, NAD-binding; gam 2e-76
3pef_A287 6-phosphogluconate dehydrogenase, NAD-binding; gam 6e-16
3doj_A310 AT3G25530, dehydrogenase-like protein; gamma-hydro 3e-75
3doj_A310 AT3G25530, dehydrogenase-like protein; gamma-hydro 8e-14
1yb4_A295 Tartronic semialdehyde reductase; structural genom 3e-73
1yb4_A295 Tartronic semialdehyde reductase; structural genom 1e-12
2h78_A302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 4e-73
2h78_A302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 2e-13
3qha_A296 Putative oxidoreductase; seattle structural genomi 5e-72
3qha_A296 Putative oxidoreductase; seattle structural genomi 7e-14
4dll_A320 2-hydroxy-3-oxopropionate reductase; structural ge 3e-71
4dll_A320 2-hydroxy-3-oxopropionate reductase; structural ge 2e-11
2cvz_A289 Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; 9e-66
2cvz_A289 Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; 3e-13
3l6d_A306 Putative oxidoreductase; structural genomics, prot 1e-62
3l6d_A306 Putative oxidoreductase; structural genomics, prot 2e-08
1yzy_A413 Hypothetical protein HI1011; putative tRNA synthas 6e-59
3dqq_A421 Putative tRNA synthase; structural genomics, unkno 8e-59
3qsg_A312 NAD-binding phosphogluconate dehydrogenase-like P; 2e-42
3qsg_A312 NAD-binding phosphogluconate dehydrogenase-like P; 6e-04
4ezb_A317 Uncharacterized conserved protein; structural geno 8e-38
1i36_A264 Conserved hypothetical protein MTH1747; NADP bindi 2e-32
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-19
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-07
3pm6_A 306 Putative fructose-bisphosphate aldolase; structura 2e-16
1rvg_A 305 Fructose-1,6-bisphosphate aldolase; class II aldol 3e-16
1gvf_A 286 Tagatose-bisphosphate aldolase AGAY; lyase, zinc.; 3e-16
3q94_A 288 Fructose-bisphosphate aldolase, class II; structur 3e-16
3n9r_A 307 Fructose-bisphosphate aldolase; FBP aldolase, clas 4e-16
2isw_A 323 Putative fructose-1,6-bisphosphate aldolase; class 7e-16
1dos_A 358 Aldolase class II; lyase, classii fructose 1,6-bis 5e-12
3elf_A 349 Fructose-bisphosphate aldolase; zinc enzyme, dihyd 2e-11
3qm3_A 357 Fructose-bisphosphate aldolase; structural genomic 7e-11
3c24_A286 Putative oxidoreductase; YP_511008.1, structural g 1e-08
4e21_A358 6-phosphogluconate dehydrogenase (decarboxylating; 3e-08
3d1l_A266 Putative NADP oxidoreductase BF3122; structural ge 2e-07
2vns_A215 Metalloreductase steap3; metal-binding, transmembr 1e-06
2i76_A276 Hypothetical protein; NADP, dehydrogenase, TM1727, 6e-06
1pgj_A478 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; o 1e-05
2iz1_A474 6-phosphogluconate dehydrogenase, decarboxylating; 9e-05
2yjz_A201 Metalloreductase steap4; oxidoreductase, metabolic 2e-04
2zyd_A480 6-phosphogluconate dehydrogenase, decarboxylating; 3e-04
2ahr_A259 Putative pyrroline carboxylate reductase; pyrrolin 6e-04
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Length = 303 Back     alignment and structure
 Score =  331 bits (851), Expect = e-106
 Identities = 121/297 (40%), Positives = 184/297 (61%), Gaps = 3/297 (1%)

Query: 143 SNSVTRVGFIGLGAMGFGMATHLLRSNFTVIGYDVYRPTLTKFQNVGGL-IANSPAEAAK 201
           + +   VG +GLG+MG G A   LR+  +  G D+           G    A S  E A 
Sbjct: 4   TGTDFHVGIVGLGSMGMGAARSCLRAGLSTWGADLNPQACANLLAEGACGAAASAREFAG 63

Query: 202 DVGVLVIMVTNEAQAESVLYGDLGAVSALSSGASIILSSTVSPGFVSQLERRLQFEGKDL 261
            V  LVI+V N AQ   VL+G+ G    +  G+++++SST+S     ++   L     +L
Sbjct: 64  VVDALVILVVNAAQVRQVLFGEDGVAHLMKPGSAVMVSSTISSADAQEIAAAL--TALNL 121

Query: 262 KLVDAPVSGGVKRASMGELTIMAAGTEESLKSTGSVLSALSEKLYVIKGGCGAGSGVKMA 321
            ++DAPVSGG  +A+ GE+T+MA+G+E +      VL A++  +Y I    GAGS VK+ 
Sbjct: 122 NMLDAPVSGGAVKAAQGEMTVMASGSEAAFTRLKPVLDAVASNVYRISDTPGAGSTVKII 181

Query: 322 NQLLAGVHIASAAEAMAFGARLGLNTRVLFNIITDSGGSSWMFENRVPHMLDNDYTPYSA 381
           +QLLAGVHIA+AAEAMA  AR G+   V+++++T + G+SWMFENR+ H++D DYTP SA
Sbjct: 182 HQLLAGVHIAAAAEAMALAARAGIPLDVMYDVVTHAAGNSWMFENRMQHVVDGDYTPRSA 241

Query: 382 LDIFVKDMGIIARECLSQRVPLHISTIAHQLFLAGSAAGWGRQDDAAVVKVYETLSG 438
           +DIFVKD+G++A    + R PL +++ A  +F + S AG+G++DD+AV+K++     
Sbjct: 242 VDIFVKDLGLVADTAKALRFPLPLASTALNMFTSASNAGYGKEDDSAVIKIFSGEGH 298
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Length = 303 Back     alignment and structure
>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Length = 301 Back     alignment and structure
>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Length = 301 Back     alignment and structure
>2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* Length = 296 Back     alignment and structure
>2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* Length = 296 Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Length = 287 Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Length = 287 Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Length = 299 Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Length = 299 Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Length = 316 Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Length = 316 Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Length = 287 Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Length = 287 Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Length = 310 Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Length = 310 Back     alignment and structure
>1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} Length = 295 Back     alignment and structure
>1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} Length = 295 Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Length = 296 Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Length = 296 Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Length = 320 Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Length = 320 Back     alignment and structure
>2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* Length = 289 Back     alignment and structure
>2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* Length = 289 Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Length = 306 Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Length = 306 Back     alignment and structure
>1yzy_A Hypothetical protein HI1011; putative tRNA synthase, structural genomics, PSI, protein structure initiative; 2.10A {Haemophilus influenzae} SCOP: c.146.1.1 Length = 413 Back     alignment and structure
>3dqq_A Putative tRNA synthase; structural genomics, unknown function, center for structural genomics of infecti diseases; 2.70A {Salmonella typhimurium} Length = 421 Back     alignment and structure
>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Length = 312 Back     alignment and structure
>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Length = 312 Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Length = 317 Back     alignment and structure
>1i36_A Conserved hypothetical protein MTH1747; NADP binding domain, protein NADP complex, structural genomics, PSI; HET: NAP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: a.100.1.8 c.2.1.6 Length = 264 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3pm6_A Putative fructose-bisphosphate aldolase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.20A {Coccidioides immitis} Length = 306 Back     alignment and structure
>1rvg_A Fructose-1,6-bisphosphate aldolase; class II aldolase, metal-depdendent aldolase, lyase; 2.00A {Thermus aquaticus} SCOP: c.1.10.2 PDB: 1rv8_A 2fjk_A* Length = 305 Back     alignment and structure
>1gvf_A Tagatose-bisphosphate aldolase AGAY; lyase, zinc.; HET: PGH; 1.45A {Escherichia coli} SCOP: c.1.10.2 Length = 286 Back     alignment and structure
>3q94_A Fructose-bisphosphate aldolase, class II; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta barrel; HET: 13P; 2.30A {Bacillus anthracis} Length = 288 Back     alignment and structure
>3n9r_A Fructose-bisphosphate aldolase; FBP aldolase, class II, inhibitor, lyase; HET: TD3; 1.80A {Helicobacter pylori} PDB: 3c52_A* 3c56_A* 3c4u_A* 3n9s_A* Length = 307 Back     alignment and structure
>2isw_A Putative fructose-1,6-bisphosphate aldolase; class II fructose-1,6-bisphosphate aldolase, glycolytic pathway, giardia lamblia, drug target; HET: PGH; 1.75A {Giardia intestinalis} PDB: 2isv_A* 3ohi_A* 3gay_A* 3gak_A* 3gb6_A* Length = 323 Back     alignment and structure
>1dos_A Aldolase class II; lyase, classii fructose 1,6-bisphosphate aldolase, glycolysis; 1.67A {Escherichia coli} SCOP: c.1.10.2 PDB: 1b57_A* 1gyn_A 1zen_A Length = 358 Back     alignment and structure
>3elf_A Fructose-bisphosphate aldolase; zinc enzyme, dihydroxyacetone, glyceraldehyd phosphate, aldol condensation, glycolysis, lyase; HET: 2FP; 1.31A {Mycobacterium tuberculosis} PDB: 3ekz_A* 3ekl_A* 4a22_A* 4a21_A* Length = 349 Back     alignment and structure
>3qm3_A Fructose-bisphosphate aldolase; structural genomics, center for structural genomics of infec diseases, csgid, TIM beta/alpha-barrel, lyase; 1.85A {Campylobacter jejuni} Length = 357 Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Length = 286 Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Length = 358 Back     alignment and structure
>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} Length = 266 Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Length = 215 Back     alignment and structure
>2i76_A Hypothetical protein; NADP, dehydrogenase, TM1727, structural genomics, PSI-2, protein structure initiative; HET: NDP; 3.00A {Thermotoga maritima} SCOP: a.100.1.10 c.2.1.6 Length = 276 Back     alignment and structure
>1pgj_A 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; oxidoreductase, CHOH(D)-NADP+(B); 2.82A {Trypanosoma brucei} SCOP: a.100.1.1 c.2.1.6 Length = 478 Back     alignment and structure
>2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* Length = 474 Back     alignment and structure
>2yjz_A Metalloreductase steap4; oxidoreductase, metabolic syndrome; HET: NAP; 2.20A {Rattus norvegicus} Length = 201 Back     alignment and structure
>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* Length = 480 Back     alignment and structure
>2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A Length = 259 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query988
3dqq_A421 Putative tRNA synthase; structural genomics, unkno 100.0
1yzy_A413 Hypothetical protein HI1011; putative tRNA synthas 100.0
3obb_A300 Probable 3-hydroxyisobutyrate dehydrogenase; struc 100.0
4gbj_A297 6-phosphogluconate dehydrogenase NAD-binding; stru 100.0
3doj_A310 AT3G25530, dehydrogenase-like protein; gamma-hydro 100.0
4dll_A320 2-hydroxy-3-oxopropionate reductase; structural ge 100.0
3g0o_A303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 100.0
3pdu_A287 3-hydroxyisobutyrate dehydrogenase family protein; 100.0
3pef_A287 6-phosphogluconate dehydrogenase, NAD-binding; gam 100.0
2h78_A302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 100.0
3qha_A296 Putative oxidoreductase; seattle structural genomi 100.0
3l6d_A306 Putative oxidoreductase; structural genomics, prot 100.0
1vpd_A299 Tartronate semialdehyde reductase; structural geno 100.0
3cky_A301 2-hydroxymethyl glutarate dehydrogenase; rossmann 100.0
1yb4_A295 Tartronic semialdehyde reductase; structural genom 100.0
4ezb_A317 Uncharacterized conserved protein; structural geno 100.0
2gf2_A296 Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct 100.0
4a7p_A446 UDP-glucose dehydrogenase; oxidoreductase, carbohy 100.0
2uyy_A316 N-PAC protein; long-chain dehydrogenase, cytokine; 100.0
3qsg_A312 NAD-binding phosphogluconate dehydrogenase-like P; 100.0
2cvz_A289 Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; 100.0
3gg2_A450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 100.0
4e21_A358 6-phosphogluconate dehydrogenase (decarboxylating; 100.0
3g79_A478 NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; 100.0
4gwg_A484 6-phosphogluconate dehydrogenase, decarboxylating; 100.0
2y0c_A478 BCEC, UDP-glucose dehydrogenase; oxidoreductase, c 99.97
2p4q_A497 6-phosphogluconate dehydrogenase, decarboxylating; 99.97
3pid_A432 UDP-glucose 6-dehydrogenase; rossmann fold, oxidor 99.97
3ojo_A431 CAP5O; rossmann fold, complex with cofactor NAD an 99.97
2q3e_A467 UDP-glucose 6-dehydrogenase; hexamer, structural g 99.97
2o3j_A481 UDP-glucose 6-dehydrogenase; structural genomics, 99.97
2zyd_A480 6-phosphogluconate dehydrogenase, decarboxylating; 99.97
1mv8_A436 GMD, GDP-mannose 6-dehydrogenase; rossman fold, do 99.96
3vtf_A444 UDP-glucose 6-dehydrogenase; two discrete alpha/be 99.96
1dlj_A402 UDP-glucose dehydrogenase; rossmann fold, ternary 99.96
2pgd_A482 6-phosphogluconate dehydrogenase; oxidoreductase ( 99.96
1i36_A264 Conserved hypothetical protein MTH1747; NADP bindi 99.96
2iz1_A474 6-phosphogluconate dehydrogenase, decarboxylating; 99.95
1pgj_A478 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; o 99.95
3k96_A356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 99.92
2ew2_A316 2-dehydropantoate 2-reductase, putative; alpha-str 99.87
1z82_A335 Glycerol-3-phosphate dehydrogenase; TM0378, struct 99.86
1evy_A366 Glycerol-3-phosphate dehydrogenase; rossmann fold, 99.86
1zej_A293 HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural 99.84
1txg_A335 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid 99.84
1yqg_A263 Pyrroline-5-carboxylate reductase; structural geno 99.83
2izz_A322 Pyrroline-5-carboxylate reductase 1; amino-acid bi 99.83
3dtt_A245 NADP oxidoreductase; structural genomics, joint ce 99.83
2ahr_A259 Putative pyrroline carboxylate reductase; pyrrolin 99.83
2qyt_A317 2-dehydropantoate 2-reductase; APC81190, porphyrom 99.82
2dpo_A319 L-gulonate 3-dehydrogenase; structural genomics, N 99.82
1ks9_A291 KPA reductase;, 2-dehydropantoate 2-reductase; PAN 99.82
1yj8_A375 Glycerol-3-phosphate dehydrogenase; SGPP, structur 99.81
1x0v_A354 GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase 99.81
4gbj_A297 6-phosphogluconate dehydrogenase NAD-binding; stru 99.78
3c24_A286 Putative oxidoreductase; YP_511008.1, structural g 99.76
2rcy_A262 Pyrroline carboxylate reductase; malaria, structur 99.75
3d1l_A266 Putative NADP oxidoreductase BF3122; structural ge 99.75
3obb_A300 Probable 3-hydroxyisobutyrate dehydrogenase; struc 99.75
1bg6_A359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 99.75
3mog_A483 Probable 3-hydroxybutyryl-COA dehydrogenase; struc 99.74
1f0y_A302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 99.73
3ggo_A314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 99.71
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 99.7
3gt0_A247 Pyrroline-5-carboxylate reductase; structural geno 99.7
3tri_A280 Pyrroline-5-carboxylate reductase; amino acid bios 99.69
2g5c_A281 Prephenate dehydrogenase; TYRA, oxidoreductase; HE 99.69
3hwr_A318 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A 99.68
3k6j_A460 Protein F01G10.3, confirmed by transcript evidenc; 99.68
3ghy_A335 Ketopantoate reductase protein; oxidoreductase, NA 99.68
2f1k_A279 Prephenate dehydrogenase; tyrosine synthesis, X-RA 99.64
3i83_A320 2-dehydropantoate 2-reductase; structural genomics 99.64
2wtb_A725 MFP2, fatty acid multifunctional protein (ATMFP2); 99.63
3hn2_A312 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str 99.63
1wdk_A715 Fatty oxidation complex alpha subunit; alpha2BETA2 99.63
3b1f_A290 Putative prephenate dehydrogenase; enzyme, 4-hydro 99.62
4fgw_A391 Glycerol-3-phosphate dehydrogenase [NAD(+)] 1; oxi 99.62
1jay_A212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 99.61
4dll_A320 2-hydroxy-3-oxopropionate reductase; structural ge 99.61
3ktd_A341 Prephenate dehydrogenase; structural genomics, joi 99.61
4huj_A220 Uncharacterized protein; PSI-biology, nysgrc, stru 99.59
3doj_A310 AT3G25530, dehydrogenase-like protein; gamma-hydro 99.57
1zcj_A463 Peroxisomal bifunctional enzyme; peroxisomal multi 99.57
2h78_A302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 99.55
2raf_A209 Putative dinucleotide-binding oxidoreductase; NP_7 99.55
2pv7_A298 T-protein [includes: chorismate mutase (EC 5.4.99 99.55
3pef_A287 6-phosphogluconate dehydrogenase, NAD-binding; gam 99.54
3pdu_A287 3-hydroxyisobutyrate dehydrogenase family protein; 99.54
3g0o_A303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 99.54
2yjz_A201 Metalloreductase steap4; oxidoreductase, metabolic 99.29
2i76_A276 Hypothetical protein; NADP, dehydrogenase, TM1727, 99.53
2vns_A215 Metalloreductase steap3; metal-binding, transmembr 99.52
3g17_A294 Similar to 2-dehydropantoate 2-reductase; structur 99.49
1gvf_A 286 Tagatose-bisphosphate aldolase AGAY; lyase, zinc.; 99.48
3l6d_A306 Putative oxidoreductase; structural genomics, prot 99.47
3q94_A 288 Fructose-bisphosphate aldolase, class II; structur 99.46
2isw_A 323 Putative fructose-1,6-bisphosphate aldolase; class 99.45
3n9r_A 307 Fructose-bisphosphate aldolase; FBP aldolase, clas 99.44
3ego_A307 Probable 2-dehydropantoate 2-reductase; structural 99.43
3dfu_A232 Uncharacterized protein from 6-phosphogluconate de 99.42
1rvg_A 305 Fructose-1,6-bisphosphate aldolase; class II aldol 99.42
3ado_A319 Lambda-crystallin; L-gulonate 3-dehydrogenase, str 99.38
1np3_A338 Ketol-acid reductoisomerase; A DEEP figure-OF-eigh 99.35
1vpd_A299 Tartronate semialdehyde reductase; structural geno 99.33
3cky_A301 2-hydroxymethyl glutarate dehydrogenase; rossmann 99.33
3c7a_A404 Octopine dehydrogenase; L) stereospecific opine de 99.32
2cvz_A289 Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; 99.27
1yb4_A295 Tartronic semialdehyde reductase; structural genom 99.27
3qha_A296 Putative oxidoreductase; seattle structural genomi 99.27
3elf_A 349 Fructose-bisphosphate aldolase; zinc enzyme, dihyd 99.25
2gf2_A296 Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct 99.25
3pm6_A 306 Putative fructose-bisphosphate aldolase; structura 99.23
2i99_A312 MU-crystallin homolog; thyroid hormine binding pro 99.18
2uyy_A316 N-PAC protein; long-chain dehydrogenase, cytokine; 99.16
3gvx_A290 Glycerate dehydrogenase related protein; NYSGXRC, 99.15
1dos_A 358 Aldolase class II; lyase, classii fructose 1,6-bis 99.11
4dgs_A340 Dehydrogenase; structural genomics, PSI-biology, N 99.11
4a7p_A446 UDP-glucose dehydrogenase; oxidoreductase, carbohy 99.09
3qm3_A 357 Fructose-bisphosphate aldolase; structural genomic 99.08
3gg2_A450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 99.08
2dc1_A236 L-aspartate dehydrogenase; NAD, oxidoreductase; HE 99.08
3gg9_A352 D-3-phosphoglycerate dehydrogenase oxidoreductase; 99.07
2gcg_A330 Glyoxylate reductase/hydroxypyruvate reductase; NA 99.07
3jtm_A351 Formate dehydrogenase, mitochondrial; mitochondrio 99.06
4ezb_A317 Uncharacterized conserved protein; structural geno 99.06
3hg7_A324 D-isomer specific 2-hydroxyacid dehydrogenase FAM 99.05
2pi1_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 99.05
4g2n_A345 D-isomer specific 2-hydroxyacid dehydrogenase, Na; 99.05
3ba1_A333 HPPR, hydroxyphenylpyruvate reductase; two domain 99.04
1mx3_A347 CTBP1, C-terminal binding protein 1; nuclear prote 99.04
4e5n_A330 Thermostable phosphite dehydrogenase; D-2-hydroxya 99.03
3evt_A324 Phosphoglycerate dehydrogenase; structural genomic 99.03
1wwk_A307 Phosphoglycerate dehydrogenase; riken structural g 99.02
2ekl_A313 D-3-phosphoglycerate dehydrogenase; structural gen 99.01
2w2k_A348 D-mandelate dehydrogenase; 2-hydroxyacid dehydroge 99.01
1gdh_A320 D-glycerate dehydrogenase; oxidoreductase(CHOH (D) 99.0
2dbq_A334 Glyoxylate reductase; D-3-phosphoglycerate dehydro 99.0
2g76_A335 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor 99.0
3fr7_A525 Putative ketol-acid reductoisomerase (OS05G057370 98.98
1qp8_A303 Formate dehydrogenase; oxidoreductase; HET: NDP; 2 98.97
3pp8_A315 Glyoxylate/hydroxypyruvate reductase A; structural 98.97
2yq5_A343 D-isomer specific 2-hydroxyacid dehydrogenase; oxi 98.97
4hy3_A365 Phosphoglycerate oxidoreductase; PSI-biology, stru 98.96
2nac_A393 NAD-dependent formate dehydrogenase; oxidoreductas 98.95
2j6i_A364 Formate dehydrogenase; oxidoreductase, D-specific- 98.95
1j4a_A333 D-LDH, D-lactate dehydrogenase; NAD-dependent dehy 98.94
2d0i_A333 Dehydrogenase; structural genomics, NPPSFA, nation 98.92
3zwc_A742 Peroxisomal bifunctional enzyme; beta oxidation pa 98.91
1ygy_A529 PGDH, D-3-phosphoglycerate dehydrogenase; oxidored 98.91
1sc6_A404 PGDH, D-3-phosphoglycerate dehydrogenase; alloster 98.88
3qsg_A312 NAD-binding phosphogluconate dehydrogenase-like P; 98.88
2cuk_A311 Glycerate dehydrogenase/glyoxylate reductase; stru 98.86
3k5p_A416 D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, 98.86
3g79_A478 NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; 98.85
3oet_A381 Erythronate-4-phosphate dehydrogenase; structural 98.84
1xdw_A331 NAD+-dependent (R)-2-hydroxyglutarate dehydrogenas 98.82
1dxy_A333 D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxyc 98.81
2o4c_A380 Erythronate-4-phosphate dehydrogenase; erythronate 98.77
2y0c_A478 BCEC, UDP-glucose dehydrogenase; oxidoreductase, c 98.73
2o3j_A481 UDP-glucose 6-dehydrogenase; structural genomics, 98.71
3txv_A 450 Probable tagatose 6-phosphate kinase; structural g 98.69
1y81_A138 Conserved hypothetical protein; hyperthermophIle, 98.69
2q3e_A467 UDP-glucose 6-dehydrogenase; hexamer, structural g 98.68
1mv8_A436 GMD, GDP-mannose 6-dehydrogenase; rossman fold, do 98.63
2fiq_A 420 Putative tagatose 6-phosphate kinase 1; structural 98.57
2hk9_A275 Shikimate dehydrogenase; shikimate pathway, drug d 98.56
1lss_A140 TRK system potassium uptake protein TRKA homolog; 98.55
2d5c_A263 AROE, shikimate 5-dehydrogenase; substrate, dimer, 98.53
2rir_A300 Dipicolinate synthase, A chain; structural genomic 98.52
1hyh_A309 L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2 98.49
1x7d_A350 Ornithine cyclodeaminase; binds NAD+, binds L-orni 98.49
2duw_A145 Putative COA-binding protein; ligand binding prote 98.48
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 98.47
3kb6_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 98.46
1dlj_A402 UDP-glucose dehydrogenase; rossmann fold, ternary 98.44
2ewd_A317 Lactate dehydrogenase,; protein-substrate_cofactor 98.43
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 98.42
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 98.41
3c85_A183 Putative glutathione-regulated potassium-efflux S 98.4
3uuw_A308 Putative oxidoreductase with NAD(P)-binding rossm 98.4
3q2i_A354 Dehydrogenase; rossmann fold, UDP-sugar binding, N 98.37
3euw_A344 MYO-inositol dehydrogenase; protein structure init 98.35
1tlt_A319 Putative oxidoreductase (virulence factor MVIM HO; 98.34
1pzg_A331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 98.33
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 98.33
1i36_A264 Conserved hypothetical protein MTH1747; NADP bindi 98.32
3e9m_A330 Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, 98.31
3e18_A359 Oxidoreductase; dehydrogenase, NAD-binding, struct 98.29
3db2_A354 Putative NADPH-dependent oxidoreductase; two domai 98.29
2hjr_A328 Malate dehydrogenase; malaria, structural genomics 98.29
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 98.27
1omo_A322 Alanine dehydrogenase; two-domain, beta-sandwich-d 98.26
1a5z_A319 L-lactate dehydrogenase; oxidoreductase, glycolysi 98.25
3rc1_A350 Sugar 3-ketoreductase; sugar biosynthesis, TDP bin 98.24
4hkt_A331 Inositol 2-dehydrogenase; structural genomics, nys 98.24
1guz_A310 Malate dehydrogenase; oxidoreductase, tricarboxyli 98.23
1v8b_A479 Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2 98.21
1t2d_A322 LDH-P, L-lactate dehydrogenase; ternary complex, o 98.19
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 98.19
3d64_A494 Adenosylhomocysteinase; structural genomics, ssgci 98.18
2z2v_A365 Hypothetical protein PH1688; L-lysine dehydrogenas 98.18
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 98.18
4dio_A405 NAD(P) transhydrogenase subunit alpha PART 1; stru 98.17
3h9u_A436 Adenosylhomocysteinase; NAD CO-factor complex, str 98.16
2ho3_A325 Oxidoreductase, GFO/IDH/MOCA family; streptococcus 98.16
2glx_A332 1,5-anhydro-D-fructose reductase; NADP(H) dependen 98.16
3c1a_A315 Putative oxidoreductase; ZP_00056571.1, oxidoreduc 98.15
3cea_A346 MYO-inositol 2-dehydrogenase; NP_786804.1, oxidore 98.14
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 98.13
1xea_A323 Oxidoreductase, GFO/IDH/MOCA family; structural ge 98.13
3bio_A304 Oxidoreductase, GFO/IDH/MOCA family; structural ge 98.12
3ezy_A344 Dehydrogenase; structural genomics, unknown functi 98.11
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 98.09
2p2s_A336 Putative oxidoreductase; YP_050235.1, structural g 98.09
3m2t_A359 Probable dehydrogenase; PSI, SGXNY, structural gen 98.09
1lld_A319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 98.08
2v6b_A304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 98.06
2p4q_A497 6-phosphogluconate dehydrogenase, decarboxylating; 98.03
3ec7_A357 Putative dehydrogenase; alpha-beta, structural gen 98.0
3mz0_A344 Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; 98.0
1ydw_A362 AX110P-like protein; structural genomics, protein 97.99
1ur5_A309 Malate dehydrogenase; oxidoreductase, tricarboxyli 97.99
1y6j_A318 L-lactate dehydrogenase; southeast collaboratory f 97.99
3d0o_A317 L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly 97.99
3hdj_A313 Probable ornithine cyclodeaminase; APC62486, borde 97.99
3ojo_A431 CAP5O; rossmann fold, complex with cofactor NAD an 97.97
3evn_A329 Oxidoreductase, GFO/IDH/MOCA family; structural ge 97.96
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 97.96
1h6d_A433 Precursor form of glucose-fructose oxidoreductase; 97.95
3ce6_A494 Adenosylhomocysteinase; protein-substrate complex, 97.95
3pqe_A326 L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas 97.94
3e82_A364 Putative oxidoreductase; NAD, GFO/IDH/MOCA family, 97.94
3don_A277 Shikimate dehydrogenase; alpha-beta structure, ros 97.89
4e21_A358 6-phosphogluconate dehydrogenase (decarboxylating; 97.89
3ohs_X334 Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; d 97.88
1iuk_A140 Hypothetical protein TT1466; structural genomics, 97.87
1oju_A294 MDH, malate dehydrogenase; hyperthermophilic, oxid 97.87
3vtf_A444 UDP-glucose 6-dehydrogenase; two discrete alpha/be 97.87
3btv_A438 Galactose/lactose metabolism regulatory protein GA 97.87
3gvi_A324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 97.86
3u62_A253 Shikimate dehydrogenase; shikimate pathway, oxidor 97.86
3n58_A464 Adenosylhomocysteinase; ssgcid, hydrolase, structu 97.85
3kux_A352 Putative oxidoreductase; oxidoreductase family, cs 97.84
2nvw_A479 Galactose/lactose metabolism regulatory protein GA 97.84
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 97.83
1ldn_A316 L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA 97.82
1u8x_X472 Maltose-6'-phosphate glucosidase; structural genom 97.82
3p7m_A321 Malate dehydrogenase; putative dehydrogenase, enzy 97.8
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 97.8
4gwg_A484 6-phosphogluconate dehydrogenase, decarboxylating; 97.8
3gvp_A435 Adenosylhomocysteinase 3; protein CO-factor comple 97.79
2b0j_A358 5,10-methenyltetrahydromethanopterin hydrogenase; 97.78
1leh_A364 Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi 97.77
3qy9_A243 DHPR, dihydrodipicolinate reductase; rossmann fold 97.77
1zh8_A340 Oxidoreductase; TM0312, structural genomics, JO ce 97.76
3upl_A446 Oxidoreductase; rossmann fold, NADPH binding; 1.50 97.76
3tl2_A315 Malate dehydrogenase; center for structural genomi 97.75
3v5n_A417 Oxidoreductase; structural genomics, PSI-biology, 97.74
1x13_A401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 97.73
2d59_A144 Hypothetical protein PH1109; COA binding, structur 97.73
3f4l_A345 Putative oxidoreductase YHHX; structural genomics, 97.72
2ixa_A444 Alpha-N-acetylgalactosaminidase; NAD, A-ECO conver 97.72
4had_A350 Probable oxidoreductase protein; structural genomi 97.7
3dty_A398 Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetram 97.69
3u3x_A361 Oxidoreductase; structural genomics, PSI-biology, 97.69
3moi_A387 Probable dehydrogenase; structural genomics, PSI2, 97.69
3fef_A450 Putative glucosidase LPLD; gulosidase, structural 97.69
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 97.68
1f06_A320 MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH 97.68
3gdo_A358 Uncharacterized oxidoreductase YVAA; structural ge 97.67
3pid_A432 UDP-glucose 6-dehydrogenase; rossmann fold, oxidor 97.66
2zyd_A480 6-phosphogluconate dehydrogenase, decarboxylating; 97.65
1ez4_A318 Lactate dehydrogenase; rossmann fold, oxidoreducta 97.64
3fi9_A343 Malate dehydrogenase; structural genomics, oxidore 97.62
3nep_X314 Malate dehydrogenase; halophIle, molecular adpatat 97.62
3o8q_A281 Shikimate 5-dehydrogenase I alpha; structural geno 97.61
1id1_A153 Putative potassium channel protein; RCK domain, E. 97.59
2i6t_A303 Ubiquitin-conjugating enzyme E2-like isoform A; L- 97.59
3ulk_A491 Ketol-acid reductoisomerase; branched-chain amino 97.59
3abi_A365 Putative uncharacterized protein PH1688; L-lysine 97.55
3ldh_A330 Lactate dehydrogenase; oxidoreductase, CHOH donor, 97.54
1l7d_A384 Nicotinamide nucleotide transhydrogenase, subunit 97.54
3fhl_A362 Putative oxidoreductase; NAD-binding domain, PSI-2 97.53
1p77_A272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 97.53
1obb_A480 Maltase, alpha-glucosidase; glycosidase, sulfinic 97.52
2zqz_A326 L-LDH, L-lactate dehydrogenase; oxidoreductase, ro 97.5
3vku_A326 L-LDH, L-lactate dehydrogenase; rossmann fold, NAD 97.5
2pgd_A482 6-phosphogluconate dehydrogenase; oxidoreductase ( 97.5
2iz1_A474 6-phosphogluconate dehydrogenase, decarboxylating; 97.5
1s6y_A450 6-phospho-beta-glucosidase; hydrolase, structural 97.5
1npy_A271 Hypothetical shikimate 5-dehydrogenase-like protei 97.48
4fb5_A393 Probable oxidoreductase protein; PSI-biology, nysg 97.48
4gqa_A412 NAD binding oxidoreductase; structural genomics, P 97.46
1pgj_A478 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; o 97.45
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 97.44
3l9w_A413 Glutathione-regulated potassium-efflux system Pro 97.42
3i23_A349 Oxidoreductase, GFO/IDH/MOCA family; structural ge 97.39
4gmf_A372 Yersiniabactin biosynthetic protein YBTU; rossmann 97.36
1ff9_A450 Saccharopine reductase; lysine biosynthesis, alpha 97.34
3oqb_A383 Oxidoreductase; structural genomics, protein struc 97.34
4ew6_A330 D-galactose-1-dehydrogenase protein; nysgrc, PSI-b 97.33
1lc0_A294 Biliverdin reductase A; oxidoreductase, tetrapyrro 97.32
1smk_A326 Malate dehydrogenase, glyoxysomal; tricarboxylic c 97.31
2xxj_A310 L-LDH, L-lactate dehydrogenase; oxidoreductase, hy 97.31
4aj2_A331 L-lactate dehydrogenase A chain; oxidoreductase-in 97.28
1mld_A314 Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D 97.27
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 97.27
2axq_A467 Saccharopine dehydrogenase; rossmann fold variant, 97.27
2nu8_A288 Succinyl-COA ligase [ADP-forming] subunit alpha; c 97.25
2d4a_B308 Malate dehydrogenase; archaea, hyperthermophIle, o 97.23
1gpj_A404 Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro 97.2
3pwz_A272 Shikimate dehydrogenase 3; alpha-beta, oxidoreduct 97.19
1j5p_A253 Aspartate dehydrogenase; TM1643, structural genomi 97.12
3mtj_A444 Homoserine dehydrogenase; rossmann-fold, PSI, MCSG 97.1
3ond_A488 Adenosylhomocysteinase; plant protein, enzyme-subs 97.09
1nvm_B312 Acetaldehyde dehydrogenase (acylating), 4-hydroxy- 97.07
4h3v_A390 Oxidoreductase domain protein; structural genomics 97.06
3oa2_A318 WBPB; oxidoreductase, sugar biosynthesis, dehydrog 97.05
4f3y_A272 DHPR, dihydrodipicolinate reductase; structural ge 97.04
1b8p_A329 Protein (malate dehydrogenase); oxidoreductase; 1. 97.04
2aef_A234 Calcium-gated potassium channel MTHK; rossmann fol 97.04
3o9z_A312 Lipopolysaccaride biosynthesis protein WBPB; oxido 97.01
3jyo_A283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 96.99
3ijp_A288 DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, 96.92
1oi7_A288 Succinyl-COA synthetase alpha chain; SCS, ligase, 96.87
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 96.84
4ina_A405 Saccharopine dehydrogenase; structural genomics, P 96.82
3ngx_A276 Bifunctional protein fold; methylenetetrahydrofola 96.81
1dih_A273 Dihydrodipicolinate reductase; oxidoreductase; HET 96.78
1nvt_A287 Shikimate 5'-dehydrogenase; structural genomics, P 96.77
3ip3_A337 Oxidoreductase, putative; structural genomics, PSI 96.73
2czc_A334 Glyceraldehyde-3-phosphate dehydrogenase; glycolys 96.72
1edz_A320 5,10-methylenetetrahydrofolate dehydrogenase; nucl 96.71
3eag_A326 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME 96.71
3ius_A286 Uncharacterized conserved protein; APC63810, silic 96.71
4g65_A461 TRK system potassium uptake protein TRKA; structur 96.7
1bg6_A359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 96.69
1cf2_P337 Protein (glyceraldehyde-3-phosphate dehydrogenase) 96.66
2yv1_A294 Succinyl-COA ligase [ADP-forming] subunit alpha; C 96.58
2ozp_A345 N-acetyl-gamma-glutamyl-phosphate reductase; amino 96.57
4a26_A300 Putative C-1-tetrahydrofolate synthase, cytoplasm; 96.57
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 96.56
2x0j_A294 Malate dehydrogenase; oxidoreductase, hyperthermop 96.56
3fbt_A282 Chorismate mutase and shikimate 5-dehydrogenase fu 96.55
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 96.52
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 96.5
1o6z_A303 MDH, malate dehydrogenase; halophilic, ION-binding 96.49
1b7g_O340 Protein (glyceraldehyde 3-phosphate dehydrogenase; 96.48
2yv2_A297 Succinyl-COA synthetase alpha chain; COA-binding d 96.47
1xyg_A359 Putative N-acetyl-gamma-glutamyl-phosphate reduct; 96.46
3lk7_A451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 96.42
1a4i_A301 Methylenetetrahydrofolate dehydrogenase / methenyl 96.4
3do5_A327 HOM, homoserine dehydrogenase; NP_069768.1, putati 96.4
1p9l_A245 Dihydrodipicolinate reductase; oxidoreductase, lys 96.38
3dr3_A337 N-acetyl-gamma-glutamyl-phosphate reductase; csgid 96.36
1z82_A335 Glycerol-3-phosphate dehydrogenase; TM0378, struct 96.34
3hhp_A312 Malate dehydrogenase; MDH, citric acid cycle, TCA 96.33
2nqt_A352 N-acetyl-gamma-glutamyl-phosphate reductase; apopr 96.32
3tnl_A315 Shikimate dehydrogenase; structural genomics, cent 96.3
2c2x_A281 Methylenetetrahydrofolate dehydrogenase- methenylt 96.29
1ys4_A354 Aspartate-semialdehyde dehydrogenase; oxidoreducta 96.27
3l07_A285 Bifunctional protein fold; structural genomics, ID 96.26
1b0a_A288 Protein (fold bifunctional protein); folate, dehyd 96.26
1evy_A366 Glycerol-3-phosphate dehydrogenase; rossmann fold, 96.25
3c8m_A331 Homoserine dehydrogenase; structural genomics, APC 96.24
2vt3_A215 REX, redox-sensing transcriptional repressor REX; 96.23
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 96.21
1vl6_A388 Malate oxidoreductase; TM0542, NAD-dependent malic 96.21
4dpl_A359 Malonyl-COA/succinyl-COA reductase; dinucleotide b 96.2
4dpk_A359 Malonyl-COA/succinyl-COA reductase; dinucleotide b 96.2
3ing_A325 Homoserine dehydrogenase; NP_394635.1, structural 96.19
3p2o_A285 Bifunctional protein fold; structural genomics, ce 96.17
1c1d_A355 L-phenylalanine dehydrogenase; amino acid dehydrog 96.15
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 96.15
3keo_A212 Redox-sensing transcriptional repressor REX; DNA b 96.05
1txg_A335 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid 96.02
2ep5_A350 350AA long hypothetical aspartate-semialdehyde deh 96.0
4a5o_A286 Bifunctional protein fold; oxidoreductase, hydrola 96.0
2fp4_A305 Succinyl-COA ligase [GDP-forming] alpha-chain, mit 95.93
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 95.8
2ejw_A332 HDH, homoserine dehydrogenase; NAD-dependent, oxid 95.77
1yqg_A263 Pyrroline-5-carboxylate reductase; structural geno 95.77
1lnq_A336 MTHK channels, potassium channel related protein; 95.75
5mdh_A333 Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH 95.65
4h7p_A345 Malate dehydrogenase; ssgcid, structural G seattle 95.65
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 95.63
2hjs_A340 USG-1 protein homolog; aspartate-semialdehyde dehy 95.58
3t4e_A312 Quinate/shikimate dehydrogenase; structural genomi 95.56
2ew2_A316 2-dehydropantoate 2-reductase, putative; alpha-str 95.53
3i6i_A346 Putative leucoanthocyanidin reductase 1; rossmann 95.51
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 95.5
2r00_A336 Aspartate-semialdehyde dehydrogenase; conformation 95.47
3ff4_A122 Uncharacterized protein; structural genomics, PSI- 95.47
1u8f_O335 GAPDH, glyceraldehyde-3-phosphate dehydrogenase, l 95.46
2yyy_A343 Glyceraldehyde-3-phosphate dehydrogenase; glyceral 95.46
1y7t_A327 Malate dehydrogenase; NAD-dependent-MDH-NADPH comp 95.46
1ks9_A291 KPA reductase;, 2-dehydropantoate 2-reductase; PAN 95.43
1qyc_A308 Phenylcoumaran benzylic ether reductase PT1; NADPH 95.35
2r6j_A318 Eugenol synthase 1; phenylpropene, PIP reductase, 95.35
1qyd_A313 Pinoresinol-lariciresinol reductase; NADPH-depende 95.16
3hsk_A381 Aspartate-semialdehyde dehydrogenase; candida albi 95.11
2wm3_A299 NMRA-like family domain containing protein 1; unkn 95.01
3pwk_A366 Aspartate-semialdehyde dehydrogenase; NADP binding 94.97
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 94.92
7mdh_A375 Protein (malate dehydrogenase); chloroplastic mala 94.91
3tum_A269 Shikimate dehydrogenase family protein; rossmann-f 94.88
3e48_A289 Putative nucleoside-diphosphate-sugar epimerase; a 94.82
1vkn_A351 N-acetyl-gamma-glutamyl-phosphate reductase; TM178 94.78
2gas_A307 Isoflavone reductase; NADPH-dependent reductase, o 94.72
3slg_A372 PBGP3 protein; structural genomics, seattle struct 94.71
2ahr_A259 Putative pyrroline carboxylate reductase; pyrrolin 94.68
3c1o_A321 Eugenol synthase; phenylpropene, PIP reductase, sh 94.68
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 94.64
2dt5_A211 AT-rich DNA-binding protein; REX, NADH, NAD, rossm 94.64
1up7_A417 6-phospho-beta-glucosidase; hydrolase, family4 hyd 94.63
1xgk_A352 Nitrogen metabolite repression regulator NMRA; ros 94.63
2x4g_A342 Nucleoside-diphosphate-sugar epimerase; isomerase; 94.63
3e5r_O337 PP38, glyceraldehyde-3-phosphate dehydrogenase, cy 94.61
3u95_A477 Glycoside hydrolase, family 4; hydrolysis, cytosol 94.52
1hye_A313 L-lactate/malate dehydrogenase; nucleotide binding 94.52
4hv4_A494 UDP-N-acetylmuramate--L-alanine ligase; MURC, yers 94.46
1ebf_A358 Homoserine dehydrogenase; dinucleotide, NAD, dimer 94.37
3rkr_A262 Short chain oxidoreductase; rossmann fold; HET: NA 94.34
2qrj_A394 Saccharopine dehydrogenase, NAD+, L-lysine- formin 94.33
4e6p_A259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 94.16
3ruf_A351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 94.02
1xq6_A253 Unknown protein; structural genomics, protein stru 94.01
2jl1_A287 Triphenylmethane reductase; oxidoreductase, biorem 93.97
3m2p_A311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 93.92
2qyt_A317 2-dehydropantoate 2-reductase; APC81190, porphyrom 93.91
1y1p_A342 ARII, aldehyde reductase II; rossmann fold, short 93.73
1yj8_A375 Glycerol-3-phosphate dehydrogenase; SGPP, structur 93.65
3op4_A248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 93.61
3ftp_A270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 93.59
3gem_A260 Short chain dehydrogenase; structural genomics, AP 93.57
3cps_A354 Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, g 93.56
4hb9_A412 Similarities with probable monooxygenase; flavin, 93.55
2d8a_A348 PH0655, probable L-threonine 3-dehydrogenase; pyro 93.55
3hn7_A524 UDP-N-acetylmuramate-L-alanine ligase; ATP-binding 93.49
1x0v_A354 GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase 93.48
3k96_A356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 93.43
2bka_A242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 93.41
1lu9_A287 Methylene tetrahydromethanopterin dehydrogenase; a 93.4
3awd_A260 GOX2181, putative polyol dehydrogenase; oxidoreduc 93.34
3r1i_A276 Short-chain type dehydrogenase/reductase; structur 93.32
3uko_A378 Alcohol dehydrogenase class-3; alcohol dehydrogena 93.3
1zud_1251 Adenylyltransferase THIF; thiamin, thiazole, prote 93.25
2xdo_A398 TETX2 protein; tetracycline degradation, tigecycli 93.22
3ioy_A319 Short-chain dehydrogenase/reductase SDR; structura 93.17
3nrc_A280 Enoyl-[acyl-carrier-protein] reductase (NADH); ros 93.14
2x5o_A439 UDP-N-acetylmuramoylalanine--D-glutamate ligase; A 93.09
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 93.04
1e3i_A376 Alcohol dehydrogenase, class II; HET: NAD; 2.08A { 93.04
3ucx_A264 Short chain dehydrogenase; ssgcid, seattle structu 92.98
2jhf_A374 Alcohol dehydrogenase E chain; oxidoreductase, met 92.96
1e3j_A352 NADP(H)-dependent ketose reductase; oxidoreductase 92.96
1t4b_A367 Aspartate-semialdehyde dehydrogenase; asadh, HOSR, 92.95
4b4o_A298 Epimerase family protein SDR39U1; isomerase; HET: 92.95
3tpc_A257 Short chain alcohol dehydrogenase-related dehydro; 92.93
1rjw_A339 ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD 92.91
2c5a_A379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 92.9
1p0f_A373 NADP-dependent alcohol dehydrogenase; ADH topology 92.85
4id9_A347 Short-chain dehydrogenase/reductase; putative dehy 92.7
2f00_A491 UDP-N-acetylmuramate--L-alanine ligase; amide bond 92.68
3oh8_A516 Nucleoside-diphosphate sugar epimerase (SULA FAMI; 92.68
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 92.67
4eso_A255 Putative oxidoreductase; NADP, structural genomics 92.61
3enk_A341 UDP-glucose 4-epimerase; seattle structural genomi 92.6
1cdo_A374 Alcohol dehydrogenase; oxidoreductase, oxidoreduct 92.59
3two_A348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 92.55
3n74_A261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 92.53
3tz6_A344 Aspartate-semialdehyde dehydrogenase; asadh, ASD, 92.51
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 92.46
2a9f_A398 Putative malic enzyme ((S)-malate:NAD+ oxidoreduct 92.45
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 92.45
3tfo_A264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 92.42
3h7a_A252 Short chain dehydrogenase; oxidoreductase, PSI-2, 92.42
2zcu_A286 Uncharacterized oxidoreductase YTFG; alpha-beta sa 92.38
2fzw_A373 Alcohol dehydrogenase class III CHI chain; S-nitro 92.35
4ibo_A271 Gluconate dehydrogenase; enzyme function initiativ 92.35
3ged_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 92.32
1xhl_A297 Short-chain dehydrogenase/reductase family member 92.31
1pl8_A356 Human sorbitol dehydrogenase; NAD, oxidoreductase; 92.29
3svt_A281 Short-chain type dehydrogenase/reductase; ssgcid, 92.29
1p3d_A475 UDP-N-acetylmuramate--alanine ligase; alpha/beta p 92.2
2gn4_A344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 92.19
4fn4_A254 Short chain dehydrogenase; NADH-binding, rossmann 92.12
4gx0_A565 TRKA domain protein; membrane protein, ION channel 92.12
1c0p_A363 D-amino acid oxidase; alpha-beta-alpha motif, flav 92.06
2a4k_A263 3-oxoacyl-[acyl carrier protein] reductase; reduct 92.05
3s2e_A340 Zinc-containing alcohol dehydrogenase superfamily; 92.04
2ydy_A315 Methionine adenosyltransferase 2 subunit beta; oxi 91.99
3guy_A230 Short-chain dehydrogenase/reductase SDR; structura 91.97
3grk_A293 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 91.96
3v8b_A283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 91.96
2dvm_A439 Malic enzyme, 439AA long hypothetical malate oxido 91.93
3l6e_A235 Oxidoreductase, short-chain dehydrogenase/reducta; 91.91
3ak4_A263 NADH-dependent quinuclidinone reductase; SDR, (R)- 91.89
4fgs_A273 Probable dehydrogenase protein; PSI-biology, nysgr 91.85
3k31_A296 Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI 91.82
>3dqq_A Putative tRNA synthase; structural genomics, unknown function, center for structural genomics of infecti diseases; 2.70A {Salmonella typhimurium} SCOP: c.146.1.1 Back     alignment and structure
Probab=100.00  E-value=2e-79  Score=704.06  Aligned_cols=407  Identities=17%  Similarity=0.161  Sum_probs=344.9

Q ss_pred             CcEEEEecCCCCccccc------ccceeEeecChhhHHHhhccCCcEEEEecCCCCCCHHHHHHHHHHHHHHHHHhcccc
Q 001973          477 AKTLIVLDDDPTGTQTV------HGIEVLTEWSVASLVEQFRKKPLCFFILTNSRALSSEKASSLITDICRNLRTASNSV  550 (988)
Q Consensus       477 ~~~~~iiaDD~TGa~~~------~g~~~~~~~~~~~~~~~~~~~~dvvvi~T~SR~l~~~~A~~~v~~~~~~l~~~~~~~  550 (988)
                      |++++|||||||||+|+      +|+++.+.++.+..  ....++|+++|+||||+++|++|++++++++++|++.+++ 
T Consensus         2 M~~l~vIADDfTGA~D~~~~l~~~G~~t~~~~~~p~~--~~~~~~d~~vi~t~SR~l~~~eA~~~~~~a~~~l~~~~~~-   78 (421)
T 3dqq_A            2 MLKIGVIADDFTGATDIASFLVENGMPTVQINDVPTG--TQPEGCDAVVISLKTRSCPAQEAIKQSLAALVWLKKQGCQ-   78 (421)
T ss_dssp             CCCEEEEESSHHHHHHHHHHHHHTTCCEEEEESSCCS--CCCSSCSEEEEECSCSSSCHHHHHHHHHHHHHHHHHTTCS-
T ss_pred             CcEEEEEecCcccHHHHHHHHHHCCCcEEEEeCCCCc--cccCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHcCCC-
Confidence            67899999999999998      89999999886421  2234789999999999999999999999999999998875 


Q ss_pred             CCCeEEEEeccCCCCCCCchhHHHHHHhhhCCCCEEEEeccccCCCeEEECcEEEEecCCceeecCCCccccCCCCCCCC
Q 001973          551 ENTEYTVVLRGDSTLRGHFPEEADAAVSVLGEMDAWIICPFFLQGGRYTIEDIHYVGDLDQLVPAGDTEFAKDASFGFKS  630 (988)
Q Consensus       551 ~~~~~~i~kkiDSTLRGnig~Ei~a~~~~~~~~~~~~v~PAfP~~GR~t~~G~~~v~g~~~~~pl~et~~a~Dp~~Pv~~  630 (988)
                       ..+|++|||||||||||||+|++|+++++|+ +.++||||||++||||++|+|||+|    +||+||+|++||+|||++
T Consensus        79 -~~~~K~cSr~DSTlRGnig~e~dal~~~lg~-~~~vv~PAfP~~GR~t~~G~~~v~g----~pl~et~~a~dp~tP~~~  152 (421)
T 3dqq_A           79 -QVYFKYCSTFDSTAEGNIGPVTDALMVALDT-SFTVISPALPVNGRTVYQGYLFVMN----HLLAESGMRHHPINPMTD  152 (421)
T ss_dssp             -EEEEECCTTCCCBTTBSHHHHHHHHHHHTTC-SCEEEECCBGGGTEEEETTEEEETT----EEGGGSGGGGCSSSCCCC
T ss_pred             -EEEEEEecCccCCCCCCcHHHHHHHHHHhCC-CeEEEEcccccCCcEEECCEEEECC----EEcCCCccccCCCCCCCc
Confidence             3566677789999999999999999999997 7999999999999999999999999    999999999999999999


Q ss_pred             CcHHHHHHhHcCCCCCCCceeEEehHHHhccChhHHHHHHhccc--CCCeEEEecCChhHHHHHHHHHHHHHHcCCcEEE
Q 001973          631 SNLREWVEEKTSGRIPASSVASISIQLLRKGGPDAVCERLCSLQ--KGSTCIVNAASERDIAVFAAGMIQAELKGKSFLC  708 (988)
Q Consensus       631 s~l~~~l~~q~~~~~~~~~v~~i~l~~v~~~~~~~~~~~l~~~~--~~~i~V~Da~t~~dL~~ia~a~~~~~~~~~~~l~  708 (988)
                      |+|+++|++||+++     |++|++++|++ +.+.+.++|.++.  +.+++||||+|++||+.|++++.     ..+ |+
T Consensus       153 s~l~~~l~~qt~~~-----v~~i~l~~v~~-g~~~~~~~l~~l~~~g~~~vV~DA~~~~DL~~ia~a~~-----~~~-l~  220 (421)
T 3dqq_A          153 SYLPRLMEAQAQGR-----CGVIPAQTLDE-GVAATRAALSRLQQEGYRYAVLDALNERHLEIQGEVLR-----DAP-LV  220 (421)
T ss_dssp             CBHHHHHHTTSSSC-----EEEECHHHHHH-CHHHHHHHHHHHHHTTCSEEEECBSSHHHHHHHHHHHT-----TCS-EE
T ss_pred             cHHHHHHHHHhCCC-----EEEEEHHHHhc-cHHHHHHHHHHHHhCCCcEEEEeCCCHHHHHHHHHHHh-----cCC-EE
Confidence            99999999999874     99999999999 6888999998775  45899999999999999999882     334 67


Q ss_pred             EcchHHHHHHhcccccCCCCccccccccCCCceEEEEeccccccHHHHHHHHhhcCCcEEEEEEehhHHHhhchHhHHHH
Q 001973          709 RTAASFVSARIGIVAKAPILPKDLGNKIESTGGLIVVGSYVPKTTKQVEELISQSGRFIRSVEVSVDKVAMKSLEERQEE  788 (988)
Q Consensus       709 vg~agl~~~L~~~~~~~~~~~~~~~~~~~~~~~L~v~GS~s~~T~~Qi~~l~~~~~~~~~~i~~~~~~ll~~~~~~~~~~  788 (988)
                      +|++||+.+|++.+...+..+......+..+|+|+||||+|++|++|+++++++    +..+++|+++++++  ...+.+
T Consensus       221 ~G~sGla~aL~~~~~~~~~~~~~~~~~~~~~~~lvv~GS~s~~T~~Ql~~l~~~----~~~i~ld~~~l~~~--~~~~~~  294 (421)
T 3dqq_A          221 TGGSGLAMGLARQWAKHGVSQARSAGYPLSGRAVVLSGSCSQMTNQQVAFYRQH----APTRDVDVARCLSS--ETREAY  294 (421)
T ss_dssp             EESHHHHHHHHHHHHTTCCC--CGGGSCCSSCEEEEECCCSHHHHHHHHHHTTT----SCEEECCGGGSSSH--HHHHHH
T ss_pred             EEcHHHHHHHHHHhhhcccccccccccCCCCcEEEEECCCCHHHHHHHHHHHhc----CCEEEeCHHHHhCC--chHHHH
Confidence            999999999987654332211111223456789999999999999999999754    46799999999852  234567


Q ss_pred             HHHHHHHHHHHHhcCCcEEEEecCccccc---CCccchHHHHHHHHHHHHHHHHHhhc-CcceeeeccccchHHHHHhhc
Q 001973          789 IIRAAEMVDVFLQARKDTLLITSRVLITG---KTPSESLEINLKVSSAMVEIVRRITT-RPRYILAKGGITSSDIATKAL  864 (988)
Q Consensus       789 ~~~~~~~~~~~l~~~~~~vi~t~~~~~~~---~~~~~~~~~~~~i~~~l~~i~~~~~~-~~~~li~tGGdTs~~v~~~~L  864 (988)
                      ++++.+++.+. .++++++|||++.....   .......+++++|++.|++|++++.. ++++||++|||||++++ ++|
T Consensus       295 ~~~~~~~~~~~-~~~~~~lv~ts~~~~~~~~~~~~~~~~~~~~~i~~~l~~i~~~l~~~~~~~livaGGdTs~~v~-~~L  372 (421)
T 3dqq_A          295 AEALAQWVLSQ-DSELAPMISATASTQALAAIQQQYGATEASHAVEALFSLLAARLAEGGITRFIVAGGETSGVVT-QSL  372 (421)
T ss_dssp             HHHHHHHHHHC-CCSSCCEEECTTGGGHHHHHSTTCCCCCCCHHHHHHHHHHHHHHHHTTCCEEEEESHHHHHHHH-HHT
T ss_pred             HHHHHHHHHhc-CCCCCEEEEECCChhhhHHHHHHhChHHHHHHHHHHHHHHHHHHHHhcCCeEEEecCHHHHHHH-HHh
Confidence            77887777665 44456899998754321   11222335688999999999999976 89999999999999996 899


Q ss_pred             cccceEEecccccCCcEEEcCCCCCCCCCcEEecCCCCCChhHHHHHHHHhc
Q 001973          865 EAKRAKVVGQALAGVPLWELGPESRHPGVPYVVFPGNVGDNNAVANVVRSWA  916 (988)
Q Consensus       865 g~~~~~~~~ei~pGvp~~~~~~~g~~~gl~ivtK~G~fG~~~~l~~~~~~l~  916 (988)
                      |++++++.+||+|||||+++. ++   +++|+|||||||++|+|.+++++|.
T Consensus       373 g~~~l~i~~ei~PGvp~~~~~-~~---~l~vv~K~G~fG~~d~l~~~~~~l~  420 (421)
T 3dqq_A          373 GITGFHIGPCISPGVPWVNAL-HA---PVSLALKSGNFGDESFFIRAQREFQ  420 (421)
T ss_dssp             TCCEEEEEEEEETTEEEEEES-SS---SCEEEEECTTCSCTTHHHHHHHTCC
T ss_pred             CCCeeeecccccCCcEEEEEC-CC---CeEEEEecCCCCCHHHHHHHHHHhc
Confidence            999999999999999999997 32   7999999999999999999999873
>1yzy_A Hypothetical protein HI1011; putative tRNA synthase, structural genomics, PSI, protein structure initiative; 2.10A {Haemophilus influenzae} SCOP: c.146.1.1 Back     alignment and structure
>3obb_A Probable 3-hydroxyisobutyrate dehydrogenase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: EPE; 2.20A {Pseudomonas aeruginosa} PDB: 3q3c_A* Back     alignment and structure
>4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Back     alignment and structure
>1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* Back     alignment and structure
>4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} Back     alignment and structure
>4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A Back     alignment and structure
>2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* Back     alignment and structure
>2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} Back     alignment and structure
>3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* Back     alignment and structure
>3ojo_A CAP5O; rossmann fold, complex with cofactor NAD and EU(PDC)3, oxidi conformation, oxidoreductase; HET: NAD PDC; 2.50A {Staphylococcus aureus} PDB: 3ojl_A* Back     alignment and structure
>2q3e_A UDP-glucose 6-dehydrogenase; hexamer, structural genomics, S genomics consortium, SGC, oxidoreductase; HET: NAD UPG; 2.00A {Homo sapiens} PDB: 2qg4_A* 3khu_A* 3itk_A* 3tdk_A* 3ptz_A* 3prj_A* 3tf5_A Back     alignment and structure
>2o3j_A UDP-glucose 6-dehydrogenase; structural genomics, PSI-2, prote structure initiative, NEW YORK SGX research center for STRU genomics; 1.88A {Caenorhabditis elegans} Back     alignment and structure
>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* Back     alignment and structure
>1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* Back     alignment and structure
>3vtf_A UDP-glucose 6-dehydrogenase; two discrete alpha/beta domains, oxidoreducta; HET: UPG; 2.00A {Pyrobaculum islandicum} Back     alignment and structure
>1dlj_A UDP-glucose dehydrogenase; rossmann fold, ternary complex, crystallographic dimer, oxidoreductase; HET: NAI UGA; 1.80A {Streptococcus pyogenes} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1dli_A* Back     alignment and structure
>2pgd_A 6-phosphogluconate dehydrogenase; oxidoreductase (CHOH(D)-NADP+(A)); 2.00A {Ovis aries} SCOP: a.100.1.1 c.2.1.6 PDB: 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A 2jkv_A* Back     alignment and structure
>1i36_A Conserved hypothetical protein MTH1747; NADP binding domain, protein NADP complex, structural genomics, PSI; HET: NAP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: a.100.1.8 c.2.1.6 Back     alignment and structure
>2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* Back     alignment and structure
>1pgj_A 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; oxidoreductase, CHOH(D)-NADP+(B); 2.82A {Trypanosoma brucei} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} Back     alignment and structure
>1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A* Back     alignment and structure
>1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 Back     alignment and structure
>1yqg_A Pyrroline-5-carboxylate reductase; structural genomics, PSI, structure initiative, midwest center for structural genomic oxidoreductase; 1.90A {Neisseria meningitidis} SCOP: a.100.1.10 c.2.1.6 PDB: 2ag8_A* Back     alignment and structure
>2izz_A Pyrroline-5-carboxylate reductase 1; amino-acid biosynthesis, NADP, oxidoreductase, proline biosy; HET: NAD; 1.95A {Homo sapiens} PDB: 2ger_A 2gr9_A* 2gra_A* Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A Back     alignment and structure
>2qyt_A 2-dehydropantoate 2-reductase; APC81190, porphyromonas gingi W83, structural genomics, PSI-2; HET: MSE; 2.15A {Porphyromonas gingivalis} Back     alignment and structure
>1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* Back     alignment and structure
>1yj8_A Glycerol-3-phosphate dehydrogenase; SGPP, structural genomics, PSI; 2.85A {Plasmodium falciparum} Back     alignment and structure
>1x0v_A GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic; two independent domains, GXGXXG motif, oxidoreductase; 2.30A {Homo sapiens} PDB: 1x0x_A* 1wpq_A* 2pla_A* Back     alignment and structure
>4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum} Back     alignment and structure
>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} Back     alignment and structure
>3obb_A Probable 3-hydroxyisobutyrate dehydrogenase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: EPE; 2.20A {Pseudomonas aeruginosa} PDB: 3q3c_A* Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli} Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} Back     alignment and structure
>3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} Back     alignment and structure
>2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} Back     alignment and structure
>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} Back     alignment and structure
>3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} Back     alignment and structure
>2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} Back     alignment and structure
>1wdk_A Fatty oxidation complex alpha subunit; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: a.100.1.3 a.100.1.3 c.2.1.6 c.14.1.3 PDB: 1wdl_A* 1wdm_A* 2d3t_A* Back     alignment and structure
>3b1f_A Putative prephenate dehydrogenase; enzyme, 4-hydroxyphenylpyruvate, oxidative decarboxylation pathway, tyrosine biosynthesis, oxidoreduct; HET: NAD; 2.10A {Streptococcus mutans} PDB: 3dzb_A Back     alignment and structure
>4fgw_A Glycerol-3-phosphate dehydrogenase [NAD(+)] 1; oxidoreductase; 2.45A {Saccharomyces cerevisiae} Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>3ktd_A Prephenate dehydrogenase; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; 2.60A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>2yjz_A Metalloreductase steap4; oxidoreductase, metabolic syndrome; HET: NAP; 2.20A {Rattus norvegicus} Back     alignment and structure
>2i76_A Hypothetical protein; NADP, dehydrogenase, TM1727, structural genomics, PSI-2, protein structure initiative; HET: NDP; 3.00A {Thermotoga maritima} SCOP: a.100.1.10 c.2.1.6 Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>3g17_A Similar to 2-dehydropantoate 2-reductase; structural genomics, putative 2-dehydropantoate 2-reductase, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Back     alignment and structure
>1gvf_A Tagatose-bisphosphate aldolase AGAY; lyase, zinc.; HET: PGH; 1.45A {Escherichia coli} SCOP: c.1.10.2 Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>3q94_A Fructose-bisphosphate aldolase, class II; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta barrel; HET: 13P; 2.30A {Bacillus anthracis} SCOP: c.1.10.0 Back     alignment and structure
>2isw_A Putative fructose-1,6-bisphosphate aldolase; class II fructose-1,6-bisphosphate aldolase, glycolytic pathway, giardia lamblia, drug target; HET: PGH; 1.75A {Giardia intestinalis} PDB: 2isv_A* 3ohi_A* 3gay_A* 3gak_A* 3gb6_A* Back     alignment and structure
>3n9r_A Fructose-bisphosphate aldolase; FBP aldolase, class II, inhibitor, lyase; HET: TD3; 1.80A {Helicobacter pylori} SCOP: c.1.10.0 PDB: 3c52_A* 3c56_A* 3c4u_A* 3n9s_A* Back     alignment and structure
>3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis} Back     alignment and structure
>3dfu_A Uncharacterized protein from 6-phosphogluconate dehydrogenase-like family; putative rossmann-like dehydrogenase, structural genomics; HET: MSE; 2.07A {Corynebacterium glutamicum} Back     alignment and structure
>1rvg_A Fructose-1,6-bisphosphate aldolase; class II aldolase, metal-depdendent aldolase, lyase; 2.00A {Thermus aquaticus} SCOP: c.1.10.2 PDB: 1rv8_A 2fjk_A* Back     alignment and structure
>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* Back     alignment and structure
>1np3_A Ketol-acid reductoisomerase; A DEEP figure-OF-eight knot, C-terminal alpha-helical domain oxidoreductase; 2.00A {Pseudomonas aeruginosa} SCOP: a.100.1.2 c.2.1.6 Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Back     alignment and structure
>3c7a_A Octopine dehydrogenase; L) stereospecific opine dehydrogenas, oxidorecutase, oxidoreductase; HET: NAD; 2.10A {Pecten maximus} PDB: 3c7c_B* 3c7d_B* 3iqd_B* Back     alignment and structure
>2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* Back     alignment and structure
>1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>3elf_A Fructose-bisphosphate aldolase; zinc enzyme, dihydroxyacetone, glyceraldehyd phosphate, aldol condensation, glycolysis, lyase; HET: 2FP; 1.31A {Mycobacterium tuberculosis} PDB: 3ekz_A* 3ekl_A* 4a22_A* 4a21_A* Back     alignment and structure
>2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* Back     alignment and structure
>3pm6_A Putative fructose-bisphosphate aldolase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.20A {Coccidioides immitis} Back     alignment and structure
>2i99_A MU-crystallin homolog; thyroid hormine binding protein, oxidoreductase; HET: NDP; 2.60A {Homo sapiens} Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} Back     alignment and structure
>1dos_A Aldolase class II; lyase, classii fructose 1,6-bisphosphate aldolase, glycolysis; 1.67A {Escherichia coli} SCOP: c.1.10.2 PDB: 1b57_A* 1gyn_A 1zen_A Back     alignment and structure
>4dgs_A Dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} Back     alignment and structure
>3qm3_A Fructose-bisphosphate aldolase; structural genomics, center for structural genomics of infec diseases, csgid, TIM beta/alpha-barrel, lyase; 1.85A {Campylobacter jejuni} SCOP: c.1.10.2 Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>2dc1_A L-aspartate dehydrogenase; NAD, oxidoreductase; HET: CIT NAD; 1.90A {Archaeoglobus fulgidus} Back     alignment and structure
>3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase; structural genomics, PSI-2, P structure initiative; 1.90A {Ralstonia solanacearum} Back     alignment and structure
>2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A Back     alignment and structure
>3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} Back     alignment and structure
>4g2n_A D-isomer specific 2-hydroxyacid dehydrogenase, Na; structural genomics, protein structure initiative, nysgrc, P biology; 1.70A {Polaromonas SP} Back     alignment and structure
>3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* Back     alignment and structure
>1mx3_A CTBP1, C-terminal binding protein 1; nuclear protein, phosphorylation, transcriptional corepresso transcription repressor; HET: NAD; 1.95A {Homo sapiens} SCOP: c.2.1.4 c.23.12.1 PDB: 1hku_A* 1hl3_A* 2hu2_A* 3ga0_A 2ome_A* Back     alignment and structure
>4e5n_A Thermostable phosphite dehydrogenase; D-2-hydroxyacid dehydrogenase, oxidoreductase; HET: NAD; 1.70A {Pseudomonas stutzeri} PDB: 4e5k_A* 4ebf_A* 4e5p_A* 4e5m_A* Back     alignment and structure
>3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} Back     alignment and structure
>1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} Back     alignment and structure
>2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B Back     alignment and structure
>1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* Back     alignment and structure
>2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, S metabolism, 2-hydroxyacid dehydrogenases; HET: NAD; 1.70A {Homo sapiens} Back     alignment and structure
>3fr7_A Putative ketol-acid reductoisomerase (OS05G057370 protein); rossmann fold, NADPH, knotted protein, branched-chain amino biosynthesis; 1.55A {Oryza sativa japonica group} PDB: 3fr8_A* 1qmg_A* 1yve_I* Back     alignment and structure
>1qp8_A Formate dehydrogenase; oxidoreductase; HET: NDP; 2.80A {Pyrobaculum aerophilum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A Back     alignment and structure
>2yq5_A D-isomer specific 2-hydroxyacid dehydrogenase; oxidoreductase; HET: NAD; 2.75A {Lactobacillus delbrueckii subsp} PDB: 2yq4_A* Back     alignment and structure
>4hy3_A Phosphoglycerate oxidoreductase; PSI-biology, structural genomics, protein structure initiati acid transport and metabolism, NAD binding domain.; 2.80A {Rhizobium etli} Back     alignment and structure
>2nac_A NAD-dependent formate dehydrogenase; oxidoreductase(aldehyde(D),NAD+(A)); 1.80A {Pseudomonas SP} SCOP: c.2.1.4 c.23.12.1 PDB: 2nad_A* 2go1_A 2gug_A* 2gsd_A* 3fn4_A Back     alignment and structure
>2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A Back     alignment and structure
>1j4a_A D-LDH, D-lactate dehydrogenase; NAD-dependent dehydrogenase, reversible interconversion of pyruvate INTO D-lactate; 1.90A {Lactobacillus delbrueckii subsp} SCOP: c.2.1.4 c.23.12.1 PDB: 1j49_A* 2dld_A* Back     alignment and structure
>2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} Back     alignment and structure
>3zwc_A Peroxisomal bifunctional enzyme; beta oxidation pathway, oxidoreductase, lipid metabolism, LY isomerase, peroxisome, fatty acid metabolism; HET: NAD HSC; 2.30A {Rattus norvegicus} PDB: 3zw9_A* 3zw8_A* 3zwa_A* 3zwb_A* 2x58_A* Back     alignment and structure
>1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosy structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2 PDB: 3dc2_A* 3ddn_A* Back     alignment and structure
>1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* Back     alignment and structure
>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>2cuk_A Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structur genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus} Back     alignment and structure
>3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infect disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} Back     alignment and structure
>3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} Back     alignment and structure
>3oet_A Erythronate-4-phosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.36A {Salmonella enterica subsp} Back     alignment and structure
>1xdw_A NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; structural variant of the BAB rossmann fold, oxidoreductase; 1.98A {Acidaminococcus fermentans} Back     alignment and structure
>1dxy_A D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarboxylate dehydrogenase, D-lactate dehydrogenas oxidoreductase; HET: NAD; 1.86A {Lactobacillus casei} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>2o4c_A Erythronate-4-phosphate dehydrogenase; erythronate-4-phsphate, NAD, tartrate, phosph oxidoreductase; HET: NAD TLA; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* Back     alignment and structure
>2o3j_A UDP-glucose 6-dehydrogenase; structural genomics, PSI-2, prote structure initiative, NEW YORK SGX research center for STRU genomics; 1.88A {Caenorhabditis elegans} Back     alignment and structure
>3txv_A Probable tagatose 6-phosphate kinase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>1y81_A Conserved hypothetical protein; hyperthermophIle, structural genomics, PSI, protein structure initiative; HET: COA; 1.70A {Pyrococcus furiosus} SCOP: c.2.1.8 Back     alignment and structure
>2q3e_A UDP-glucose 6-dehydrogenase; hexamer, structural genomics, S genomics consortium, SGC, oxidoreductase; HET: NAD UPG; 2.00A {Homo sapiens} PDB: 2qg4_A* 3khu_A* 3itk_A* 3tdk_A* 3ptz_A* 3prj_A* 3tf5_A Back     alignment and structure
>1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* Back     alignment and structure
>2fiq_A Putative tagatose 6-phosphate kinase 1; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics; 2.25A {Escherichia coli} SCOP: c.1.10.7 Back     alignment and structure
>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>1hyh_A L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydroxycarboxylate dehydrogenase, L-lactate dehydrogenas oxidoreductase (CHOH(D)-NAD+(A)); HET: NAD; 2.20A {Weissella confusa} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>1x7d_A Ornithine cyclodeaminase; binds NAD+, binds L-ornithine, binds L-proline, 2 bundle, beta barrel, rossmann fold, lyase; HET: NAD ORN MES; 1.60A {Pseudomonas putida} SCOP: c.2.1.13 PDB: 1u7h_A* Back     alignment and structure
>2duw_A Putative COA-binding protein; ligand binding protein; NMR {Klebsiella pneumoniae} Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3kb6_A D-lactate dehydrogenase; oxidoreductase, D-LDH, NAD, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; HET: MSE NAD 1PE; 2.12A {Aquifex aeolicus} Back     alignment and structure
>1dlj_A UDP-glucose dehydrogenase; rossmann fold, ternary complex, crystallographic dimer, oxidoreductase; HET: NAI UGA; 1.80A {Streptococcus pyogenes} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1dli_A* Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3uuw_A Putative oxidoreductase with NAD(P)-binding rossm domain; structural genomics, center for structural genomics of infec diseases, csgid; HET: 1PE PGE; 1.63A {Clostridium difficile} Back     alignment and structure
>3q2i_A Dehydrogenase; rossmann fold, UDP-sugar binding, NAD binding oxidoreductase; HET: NAD HP7; 1.50A {Chromobacterium violaceum} PDB: 3q2k_A* Back     alignment and structure
>3euw_A MYO-inositol dehydrogenase; protein structure initiative II (PSI II), NYSGXRC, MYO-inosi dehydrogenase, oxidoreductase, tetramer; 2.30A {Corynebacterium glutamicum} Back     alignment and structure
>1tlt_A Putative oxidoreductase (virulence factor MVIM HO; structural genomics, NYSGXRC, PSI, protein structure initiative; 2.70A {Escherichia coli} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>1i36_A Conserved hypothetical protein MTH1747; NADP binding domain, protein NADP complex, structural genomics, PSI; HET: NAP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: a.100.1.8 c.2.1.6 Back     alignment and structure
>3e9m_A Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, PSI-II, dimeric dihydodiol dehydrogenase, structural genomics; 2.70A {Enterococcus faecalis} Back     alignment and structure
>3e18_A Oxidoreductase; dehydrogenase, NAD-binding, structural genom protein structure initiative, PSI, NEW YORK structural GENO research consortium; HET: NAD; 1.95A {Listeria innocua} Back     alignment and structure
>3db2_A Putative NADPH-dependent oxidoreductase; two domain protein, rossman fold, putative dehydrogenase, ST genomics; 1.70A {Desulfitobacterium hafniense dcb-2} Back     alignment and structure
>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>1omo_A Alanine dehydrogenase; two-domain, beta-sandwich-dimer, rossmann-fold NAD domain, human MU crystallin homolog; HET: NAD; 2.32A {Archaeoglobus fulgidus} SCOP: c.2.1.13 PDB: 1vll_A Back     alignment and structure
>1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3rc1_A Sugar 3-ketoreductase; sugar biosynthesis, TDP binding, NADP binding binding protein; HET: TLO NAP; 1.71A {Actinomadura kijaniata} PDB: 3rbv_A* 3rc2_A* 3rcb_A* 3rc7_A* 3rc9_A* Back     alignment and structure
>4hkt_A Inositol 2-dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium, oxidoreductase; HET: MSE; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* Back     alignment and structure
>1v8b_A Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2.40A {Plasmodium falciparum} SCOP: c.2.1.4 c.23.12.3 Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>3d64_A Adenosylhomocysteinase; structural genomics, ssgcid, S-adenosyl-L-homocysteine hydro NAD, one-carbon metabolism; HET: NAD; 2.30A {Burkholderia pseudomallei} PDB: 3glq_A* Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* Back     alignment and structure
>2glx_A 1,5-anhydro-D-fructose reductase; NADP(H) dependent reductase, rossmann-fold, sugar metabolism, 1,5-anhydro-D-mannitol, oxidoreductase; HET: NDP; 2.20A {Ensifer adhaerens} Back     alignment and structure
>3c1a_A Putative oxidoreductase; ZP_00056571.1, oxidoreductase FAM binding rossmann fold, structural genomics; HET: MSE PG4 PGE; 1.85A {Magnetospirillum magnetotacticum} Back     alignment and structure
>3cea_A MYO-inositol 2-dehydrogenase; NP_786804.1, oxidoreductase FA NAD-binding rossmann fold, structural genomics; HET: NAD; 2.40A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>1xea_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, protein structure initiative, NYSGXRC, VCA1048, GFO/IDH/MOCA family oxidoreductase; 2.65A {Vibrio cholerae} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>3bio_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, MCSG, PSI-2, GFO/IDH/MO family, protein structure initiative; HET: MSE EPE; 1.80A {Porphyromonas gingivalis} Back     alignment and structure
>3ezy_A Dehydrogenase; structural genomics, unknown function, PSI-2, protein structure initiative; 2.04A {Thermotoga maritima} Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>2p2s_A Putative oxidoreductase; YP_050235.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.25A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>3m2t_A Probable dehydrogenase; PSI, SGXNY, structural genomics, protein structure initiative; HET: NAD; 2.30A {Chromobacterium violaceum} Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Back     alignment and structure
>2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} Back     alignment and structure
>3ec7_A Putative dehydrogenase; alpha-beta, structural genomics, PSI-2, protein structure in midwest center for structural genomics, MCSG; HET: MSE NAD EPE; 2.15A {Salmonella typhimurium} Back     alignment and structure
>3mz0_A Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; MYO-inositol dehydrogenase, bsidh, oxidoreductase; HET: MSE PGE; 1.54A {Bacillus subtilis} PDB: 3nt2_A* 3nt4_A* 3nt5_A* 3nto_A* 3ntq_A* 3ntr_A* Back     alignment and structure
>1ydw_A AX110P-like protein; structural genomics, protein structure initiative, center for eukaryotic structural genomics, CESG, AT4G09670; 2.49A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.5 PDB: 2q4e_A Back     alignment and structure
>1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* Back     alignment and structure
>1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* Back     alignment and structure
>3hdj_A Probable ornithine cyclodeaminase; APC62486, bordetella pertussis TOH structural genomics, PSI-2, protein structure initiative; 1.70A {Bordetella pertussis} Back     alignment and structure
>3ojo_A CAP5O; rossmann fold, complex with cofactor NAD and EU(PDC)3, oxidi conformation, oxidoreductase; HET: NAD PDC; 2.50A {Staphylococcus aureus} PDB: 3ojl_A* Back     alignment and structure
>3evn_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics; 2.00A {Streptococcus agalactiae serogroup V} Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>1h6d_A Precursor form of glucose-fructose oxidoreductase; protein translocation, periplasmic oxidoreductase, signal peptide, ligand binding,; HET: NDP; 2.05A {Zymomonas mobilis} SCOP: c.2.1.3 d.81.1.5 PDB: 1h6b_A* 1h6a_A* 1h6c_A* 1ryd_A* 1rye_A* 1ofg_A* 1evj_A* Back     alignment and structure
>3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* Back     alignment and structure
>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Back     alignment and structure
>3e82_A Putative oxidoreductase; NAD, GFO/IDH/MOCA family, PSI-2, NYSGXRC, 11136F, structural genomics, protein structure initiative; 2.04A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>3ohs_X Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; dimeric dihydrodiol dehydrogenase, MDD, oxidoreductase; 1.90A {Macaca fascicularis} PDB: 2o48_X 2poq_X* 2o4u_X Back     alignment and structure
>1iuk_A Hypothetical protein TT1466; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; 1.70A {Thermus thermophilus} SCOP: c.2.1.8 PDB: 1iul_A Back     alignment and structure
>1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} PDB: 1ojs_A* 2x0i_A* 2x0j_A* Back     alignment and structure
>3vtf_A UDP-glucose 6-dehydrogenase; two discrete alpha/beta domains, oxidoreducta; HET: UPG; 2.00A {Pyrobaculum islandicum} Back     alignment and structure
>3btv_A Galactose/lactose metabolism regulatory protein GAL80; eukaryotic transcription repressor, acetylation, carbohydrate metabolism; 2.10A {Saccharomyces cerevisiae} PDB: 3bts_A 3v2u_A* 3btu_A Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Back     alignment and structure
>3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} Back     alignment and structure
>3n58_A Adenosylhomocysteinase; ssgcid, hydrolase, structural genomics, seattle structural G center for infectious disease; HET: ADN NAD; 2.39A {Brucella melitensis biovar abortus} Back     alignment and structure
>3kux_A Putative oxidoreductase; oxidoreductase family, csgid, structural genomics, center FO structural genomics of infectious diseases; HET: MSE; 2.75A {Yersinia pestis} Back     alignment and structure
>2nvw_A Galactose/lactose metabolism regulatory protein GAL80; transcription, galactose metabolism, repressor; 2.10A {Kluyveromyces lactis} SCOP: c.2.1.3 d.81.1.5 PDB: 3e1k_A Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A* Back     alignment and structure
>1u8x_X Maltose-6'-phosphate glucosidase; structural genomics, PSI, protein structure initiative, MCSG glucosidase, NAD-dependent; HET: G6P NAD; 2.05A {Bacillus subtilis} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A Back     alignment and structure
>3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* Back     alignment and structure
>2b0j_A 5,10-methenyltetrahydromethanopterin hydrogenase; rossmann fold, helix bundle, oxidoreductase; 1.75A {Methanocaldococcus jannaschii} SCOP: a.100.1.11 c.2.1.6 PDB: 3f47_A* 3daf_A* 3dag_A* 3f46_A* 3h65_A* Back     alignment and structure
>1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
>3qy9_A DHPR, dihydrodipicolinate reductase; rossmann fold, NADH, NADPH, oxidoreductase; 1.80A {Staphylococcus aureus} Back     alignment and structure
>1zh8_A Oxidoreductase; TM0312, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI; HET: MSE NAP; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>3upl_A Oxidoreductase; rossmann fold, NADPH binding; 1.50A {Brucella melitensis biovar abortus 230ORGANISM_TAXID} PDB: 3upy_A* Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>3v5n_A Oxidoreductase; structural genomics, PSI-biology, protein structure initiati nysgrc, NEW YORK structural genomics research consortium; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>2d59_A Hypothetical protein PH1109; COA binding, structural genomics; 1.65A {Pyrococcus horikoshii} SCOP: c.2.1.8 PDB: 2d5a_A* 2e6u_X* 3qa9_A 3q9n_A* 3q9u_A* Back     alignment and structure
>3f4l_A Putative oxidoreductase YHHX; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Escherichia coli k-12} Back     alignment and structure
>2ixa_A Alpha-N-acetylgalactosaminidase; NAD, A-ECO conversion, hydrolase; HET: NAD; 2.3A {Flavobacterium meningosepticum} PDB: 2ixb_A* Back     alignment and structure
>4had_A Probable oxidoreductase protein; structural genomics, protein structure initiative, nysgrc, PSI-biology; 2.00A {Rhizobium etli} Back     alignment and structure
>3dty_A Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetramer, PSI-2, 11131, NYSGXRC, structural genomics, protein structure initiative; 2.04A {Pseudomonas syringae PV} Back     alignment and structure
>3u3x_A Oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.79A {Sinorhizobium meliloti} Back     alignment and structure
>3moi_A Probable dehydrogenase; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics; 2.50A {Bordetella bronchiseptica} Back     alignment and structure
>3fef_A Putative glucosidase LPLD; gulosidase, structural genomics, unknown function, glycosidase, hydrolase, manganese, metal-binding, NAD, PSI- 2; 2.20A {Bacillus subtilis} Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>1f06_A MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH-inhibitor ternary complex, oxidoreductase; HET: NDP 2NP; 2.10A {Corynebacterium glutamicum} SCOP: c.2.1.3 d.81.1.3 PDB: 1dap_A* 2dap_A* 3dap_A* Back     alignment and structure
>3gdo_A Uncharacterized oxidoreductase YVAA; structural genomics, putative oxidoreductase YVAA, oxidoredu PSI-2, protein structure initiative; 2.03A {Bacillus subtilis subsp} PDB: 3gfg_A Back     alignment and structure
>3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* Back     alignment and structure
>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* Back     alignment and structure
>1ez4_A Lactate dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.30A {Lactobacillus pentosus} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} Back     alignment and structure
>3nep_X Malate dehydrogenase; halophIle, molecular adpatation, NAD, oxidoreductase, tricarboxylic acid cycle; 1.55A {Salinibacter ruber} Back     alignment and structure
>3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>2i6t_A Ubiquitin-conjugating enzyme E2-like isoform A; L-lactate dehydrogenase, oxidoreductase, ubiquitin-protein L unknown function; 2.10A {Homo sapiens} PDB: 3dl2_A Back     alignment and structure
>3ulk_A Ketol-acid reductoisomerase; branched-chain amino acid biosynthesis, rossmann fold, acetolactate, oxidoreductase; HET: CSX NDP; 2.30A {Escherichia coli} PDB: 1yrl_A* Back     alignment and structure
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
>3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>3fhl_A Putative oxidoreductase; NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 1.93A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>1obb_A Maltase, alpha-glucosidase; glycosidase, sulfinic acid, NAD+, maltose, hydrolase; HET: MAL NAD; 1.90A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>2zqz_A L-LDH, L-lactate dehydrogenase; oxidoreductase, rossmann fold, cytoplasm, glycolysis, NAD, phosphoprotein; 2.50A {Lactobacillus casei} PDB: 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>2pgd_A 6-phosphogluconate dehydrogenase; oxidoreductase (CHOH(D)-NADP+(A)); 2.00A {Ovis aries} SCOP: a.100.1.1 c.2.1.6 PDB: 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A 2jkv_A* Back     alignment and structure
>2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* Back     alignment and structure
>1s6y_A 6-phospho-beta-glucosidase; hydrolase, structural genomics, PSI, protein structure initi midwest center for structural genomics; 2.31A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>1npy_A Hypothetical shikimate 5-dehydrogenase-like protein HI0607; structural genomics, PSI, protein structure initiative; 1.75A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>4fb5_A Probable oxidoreductase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, GFO/IDH/MOCA family; 2.61A {Rhizobium etli} Back     alignment and structure
>4gqa_A NAD binding oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: MSE; 2.42A {Klebsiella pneumoniae} Back     alignment and structure
>1pgj_A 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; oxidoreductase, CHOH(D)-NADP+(B); 2.82A {Trypanosoma brucei} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>3i23_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.30A {Enterococcus faecalis} PDB: 3fd8_A* 3hnp_A Back     alignment and structure
>4gmf_A Yersiniabactin biosynthetic protein YBTU; rossmann fold, NADPH dependent thiazoline reductase, oxidore; HET: EPE; 1.85A {Yersinia enterocolitica subsp} PDB: 4gmg_A* Back     alignment and structure
>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A Back     alignment and structure
>3oqb_A Oxidoreductase; structural genomics, protein structure INI NEW YORK structural genomix research consortium, NYSGXRC, PSI-2; 2.60A {Bradyrhizobium japonicum} Back     alignment and structure
>4ew6_A D-galactose-1-dehydrogenase protein; nysgrc, PSI-biology, structural genomics, NEW YORK structura genomics research consortium, two domain; 2.30A {Rhizobium etli} Back     alignment and structure
>1lc0_A Biliverdin reductase A; oxidoreductase, tetrapyrrole, bIle pigment, heme, bilirubin, NADH; 1.20A {Rattus norvegicus} SCOP: c.2.1.3 d.81.1.4 PDB: 1lc3_A* 1gcu_A 2h63_A* Back     alignment and structure
>1smk_A Malate dehydrogenase, glyoxysomal; tricarboxylic cycle, glyoxysome, NAD, glyoxylate bypass, oxidoreductase; HET: CIT; 2.50A {Citrullus lanatus} PDB: 1sev_A Back     alignment and structure
>2xxj_A L-LDH, L-lactate dehydrogenase; oxidoreductase, hyperthermophIle; HET: NAD; 1.964A {Thermus thermophilus} PDB: 2xxb_A* 3zzn_A* 2v7p_A* 2e37_A* 2v6m_A* 2xxe_A 4a73_A Back     alignment and structure
>4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... Back     alignment and structure
>1mld_A Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D)); HET: CIT; 1.83A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 2dfd_A* Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2nu8_A Succinyl-COA ligase [ADP-forming] subunit alpha; citric acid cycle, heterotetramer, ligase, ATP-grAsp fold, R fold; HET: COA; 2.15A {Escherichia coli} SCOP: c.2.1.8 c.23.4.1 PDB: 2nu9_A* 2nu7_A* 2nua_A* 2nu6_A* 2scu_A* 1jll_A* 1scu_A* 1jkj_A* 1cqj_A* 1cqi_A* Back     alignment and structure
>2d4a_B Malate dehydrogenase; archaea, hyperthermophIle, oxidoreductase; 2.87A {Aeropyrum pernix} Back     alignment and structure
>1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 Back     alignment and structure
>3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} Back     alignment and structure
>1j5p_A Aspartate dehydrogenase; TM1643, structural genomics, JCSG, protein structure initiative, joint center for structural G oxidoreductase; HET: NAD; 1.90A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.3 PDB: 1h2h_A* Back     alignment and structure
>3mtj_A Homoserine dehydrogenase; rossmann-fold, PSI, MCSG, structural genomics, midwest cente structural genomics; 2.15A {Thiobacillus denitrificans} Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Back     alignment and structure
>1nvm_B Acetaldehyde dehydrogenase (acylating), 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>4h3v_A Oxidoreductase domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 1.68A {Kribbella flavida} Back     alignment and structure
>3oa2_A WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>4f3y_A DHPR, dihydrodipicolinate reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Burkholderia thailandensis} Back     alignment and structure
>1b8p_A Protein (malate dehydrogenase); oxidoreductase; 1.90A {Aquaspirillum arcticum} SCOP: c.2.1.5 d.162.1.1 PDB: 1b8u_A* 1b8v_A* 3d5t_A Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Back     alignment and structure
>3o9z_A Lipopolysaccaride biosynthesis protein WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD AKG; 1.45A {Thermus thermophilus} PDB: 3oa0_A* Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Back     alignment and structure
>3ijp_A DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, decode biostructures, niaid, amino-acid biosynthesis, cytoplasm; HET: NAP; 2.30A {Bartonella henselae} Back     alignment and structure
>1oi7_A Succinyl-COA synthetase alpha chain; SCS, ligase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.23A {Thermus thermophilus} SCOP: c.2.1.8 c.23.4.1 Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} Back     alignment and structure
>3ngx_A Bifunctional protein fold; methylenetetrahydrofolate dehydrogenase/cyclohydrolase; 2.30A {Thermoplasma acidophilum} PDB: 3ngl_A Back     alignment and structure
>1dih_A Dihydrodipicolinate reductase; oxidoreductase; HET: NDP; 2.20A {Escherichia coli} SCOP: c.2.1.3 d.81.1.3 PDB: 1arz_A* 1dru_A* 1drv_A* 1drw_A* Back     alignment and structure
>1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3ip3_A Oxidoreductase, putative; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.14A {Thermotoga maritima} Back     alignment and structure
>2czc_A Glyceraldehyde-3-phosphate dehydrogenase; glycolysis, NAD, oxidoreductase, structural genomics; HET: NAD; 2.00A {Pyrococcus horikoshii} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>1edz_A 5,10-methylenetetrahydrofolate dehydrogenase; nucleotide-binding domain, monofunctional, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: c.2.1.7 c.58.1.2 PDB: 1ee9_A* Back     alignment and structure
>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>1cf2_P Protein (glyceraldehyde-3-phosphate dehydrogenase); oxydoreductase, oxidoreductase; HET: NAP; 2.10A {Methanothermus fervidus} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>2yv1_A Succinyl-COA ligase [ADP-forming] subunit alpha; COA-binding domain, structural genomics, NPPSFA; 1.70A {Methanocaldococcus jannaschii} Back     alignment and structure
>2ozp_A N-acetyl-gamma-glutamyl-phosphate reductase; amino acid biosynthesis, structural genomics, riken structur genomics/proteomics initiative; 2.01A {Thermus thermophilus} Back     alignment and structure
>4a26_A Putative C-1-tetrahydrofolate synthase, cytoplasm; oxidoreductase, hydrolase, leishmaniasis; 2.70A {Leishmania major} Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>2x0j_A Malate dehydrogenase; oxidoreductase, hyperthermophilic, tricarboxylic acid cycle; HET: ENA; 2.79A {Archaeoglobus fulgidus dsm 4304} PDB: 2x0i_A* Back     alignment and structure
>3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>1o6z_A MDH, malate dehydrogenase; halophilic, ION-binding, protein-solvent interaction, oxidoreductase; HET: NAD; 1.95A {Haloarcula marismortui} SCOP: c.2.1.5 d.162.1.1 PDB: 1gt2_A* 2x0r_A* 2j5k_A 2j5q_A 2j5r_A 1d3a_A 1hlp_A* 2hlp_A Back     alignment and structure
>1b7g_O Protein (glyceraldehyde 3-phosphate dehydrogenase; archaea, hyperthermophIle, GAPDH, hyperthermophilic dehydrog oxidoreductase; 2.05A {Sulfolobus solfataricus} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>2yv2_A Succinyl-COA synthetase alpha chain; COA-binding domain, ligase, structural genomics, NPPSFA; 2.20A {Aeropyrum pernix} Back     alignment and structure
>1xyg_A Putative N-acetyl-gamma-glutamyl-phosphate reduct; structural genomics, protein structure initiative, CENT eukaryotic structural genomics; 2.19A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.1 PDB: 2q49_A 2cvo_A Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>1a4i_A Methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase...; THF, bifunctional, oxidoreductase; HET: NDP; 1.50A {Homo sapiens} SCOP: c.2.1.7 c.58.1.2 PDB: 1dia_A* 1dib_A* 1dig_A* Back     alignment and structure
>3do5_A HOM, homoserine dehydrogenase; NP_069768.1, putative homoserine dehydrogenase, structural G joint center for structural genomics, JCSG; 2.20A {Archaeoglobus fulgidus} Back     alignment and structure
>1p9l_A Dihydrodipicolinate reductase; oxidoreductase, lysine biosynthesis, NADH binding specificity, TB structural genomics consortium; HET: NAD PDC PG4; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.3 d.81.1.3 PDB: 1c3v_A* 1yl5_A 1yl7_A* 1yl6_A* Back     alignment and structure
>3dr3_A N-acetyl-gamma-glutamyl-phosphate reductase; csgid target, ARGC, essential gene, amino-acid biosynthesis, arginine biosynthesis, cytoplasm; HET: MLT; 2.00A {Shigella flexneri} PDB: 2g17_A Back     alignment and structure
>1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} Back     alignment and structure
>3hhp_A Malate dehydrogenase; MDH, citric acid cycle, TCA cycle, NAD, oxidoreductase, tricarboxylic acid cycle; 1.45A {Escherichia coli k-12} PDB: 2pwz_A 2cmd_A* 1emd_A* 1ib6_A* 1ie3_A* 4e0b_A* Back     alignment and structure
>2nqt_A N-acetyl-gamma-glutamyl-phosphate reductase; apoprotein, dimer, rossmann fold, structural genomics, PSI, protein structure initiative; 1.58A {Mycobacterium tuberculosis} PDB: 2i3a_A* 2i3g_A Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>2c2x_A Methylenetetrahydrofolate dehydrogenase- methenyltetrahydrofolate cyclohydrolase; NADP; 2.0A {Mycobacterium tuberculosis} PDB: 2c2y_A Back     alignment and structure
>1ys4_A Aspartate-semialdehyde dehydrogenase; oxidoreductase, asadh; HET: NAP; 2.29A {Methanocaldococcus jannaschii} Back     alignment and structure
>3l07_A Bifunctional protein fold; structural genomics, IDP01849, methylenetetrahydrofolate dehydrogenase; 1.88A {Francisella tularensis} Back     alignment and structure
>1b0a_A Protein (fold bifunctional protein); folate, dehydrogenase, cyclcohydrolase, channeling, oxidoreductase,hydrolase; 2.56A {Escherichia coli K12} SCOP: c.2.1.7 c.58.1.2 Back     alignment and structure
>1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A* Back     alignment and structure
>3c8m_A Homoserine dehydrogenase; structural genomics, APC89447, PS protein structure initiative, midwest center for structural genomics; HET: MSE; 1.90A {Thermoplasma volcanium GSS1} PDB: 3jsa_A* Back     alignment and structure
>2vt3_A REX, redox-sensing transcriptional repressor REX; transcriptional regulation, redox poise; HET: ATP; 2.0A {Bacillus subtilis} PDB: 2vt2_A* Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* Back     alignment and structure
>4dpl_A Malonyl-COA/succinyl-COA reductase; dinucleotide binding, dimerization domain, NADP, oxidoreductase; HET: NAP; 1.90A {Sulfolobus tokodaii} PDB: 4dpk_A* 4dpm_A* Back     alignment and structure
>4dpk_A Malonyl-COA/succinyl-COA reductase; dinucleotide binding, dimerization domain, NADP, oxidoreductase; 2.05A {Sulfolobus tokodaii} PDB: 4dpm_A* Back     alignment and structure
>3ing_A Homoserine dehydrogenase; NP_394635.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: NDP; 1.95A {Thermoplasma acidophilum} Back     alignment and structure
>3p2o_A Bifunctional protein fold; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta-alpha sandwich; HET: NAD; 2.23A {Campylobacter jejuni subsp} Back     alignment and structure
>1c1d_A L-phenylalanine dehydrogenase; amino acid dehydrogenase, oxidative deamination mechanism, oxidoreductase; HET: PHE NAD; 1.25A {Rhodococcus SP} SCOP: c.2.1.7 c.58.1.1 PDB: 1bw9_A* 1c1x_A* 1bw9_B* 1c1d_B* 1c1x_B* 1bxg_B* 1bxg_A* Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3keo_A Redox-sensing transcriptional repressor REX; DNA binding protein, winged helix, rossmann fold, NAD+; HET: NAD; 1.50A {Streptococcus agalactiae serogroup iiiorganism_taxid} PDB: 3keq_A* 3ket_A* Back     alignment and structure
>1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 Back     alignment and structure
>2ep5_A 350AA long hypothetical aspartate-semialdehyde dehydrogenase; oxidoreductase, structural genomics, NPPSFA; 2.40A {Sulfolobus tokodaii} Back     alignment and structure
>4a5o_A Bifunctional protein fold; oxidoreductase, hydrolase; 2.20A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>2fp4_A Succinyl-COA ligase [GDP-forming] alpha-chain, mitochondrial; active site phosphohistidine residue; HET: NEP GTP; 2.08A {Sus scrofa} SCOP: c.2.1.8 c.23.4.1 PDB: 2fpg_A* 2fpi_A* 2fpp_A* 1euc_A* 1eud_A* Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>2ejw_A HDH, homoserine dehydrogenase; NAD-dependent, oxidoreductase; 1.70A {Thermus thermophilus} Back     alignment and structure
>1yqg_A Pyrroline-5-carboxylate reductase; structural genomics, PSI, structure initiative, midwest center for structural genomic oxidoreductase; 1.90A {Neisseria meningitidis} SCOP: a.100.1.10 c.2.1.6 PDB: 2ag8_A* Back     alignment and structure
>1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A Back     alignment and structure
>5mdh_A Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH(D)); HET: NAD; 2.40A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 4mdh_A* Back     alignment and structure
>4h7p_A Malate dehydrogenase; ssgcid, structural G seattle structural genomics center for infectious disease, oxidoreductase; 1.30A {Leishmania major} Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>2hjs_A USG-1 protein homolog; aspartate-semialdehyde dehydrogenase, probable hydrolase, PS aeruginosa, structurual genomics; 2.20A {Pseudomonas aeruginosa} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>2r00_A Aspartate-semialdehyde dehydrogenase; conformational change, half-OF-sites-reactivity, protein evolution, sequence homology; HET: HTI; 2.03A {Vibrio cholerae} PDB: 2qz9_A* 2r00_C* Back     alignment and structure
>3ff4_A Uncharacterized protein; structural genomics, PSI- protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>1u8f_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase, liver; rossmann fold, oxidoreductase, mammalian GAPDH; HET: NAD; 1.75A {Homo sapiens} SCOP: c.2.1.3 d.81.1.1 PDB: 1znq_O* 1j0x_O* 3gpd_R* 1dss_G* 1crw_G* 1szj_G* 1ihx_A* 1ihy_A* 1gpd_G* 4gpd_1 Back     alignment and structure
>2yyy_A Glyceraldehyde-3-phosphate dehydrogenase; glyceraldehyde 3-phosphate binding, alpha and beta proteins (A/B) class, MJ1146; HET: NAP; 1.85A {Methanocaldococcus jannaschii} Back     alignment and structure
>1y7t_A Malate dehydrogenase; NAD-dependent-MDH-NADPH complex, oxidoreductase; HET: NDP; 1.65A {Thermus thermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1iz9_A* 2cvq_A* 1bmd_A* 1bdm_A* 1wze_A* 1wzi_A* Back     alignment and structure
>1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>3hsk_A Aspartate-semialdehyde dehydrogenase; candida albicans NADP complex, amino-acid biosynthesis; HET: NAP; 2.20A {Candida albicans} Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Back     alignment and structure
>3pwk_A Aspartate-semialdehyde dehydrogenase; NADP binding, oxidoreductase-oxidoreductase I complex; HET: 25A L14; 1.50A {Streptococcus pneumoniae} PDB: 2gyy_A* 2gz2_A* 2gz3_A* 2gz1_A* 3pws_A* 3pyl_A 3pyx_A* 3pzb_A* 3q11_A* 3q1l_A Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>7mdh_A Protein (malate dehydrogenase); chloroplastic malate dehydrogenase (NADP+), activated by LIG chloroplastic malate dehydrogenase; 2.40A {Sorghum bicolor} SCOP: c.2.1.5 d.162.1.1 PDB: 1civ_A* Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} Back     alignment and structure
>1vkn_A N-acetyl-gamma-glutamyl-phosphate reductase; TM1782, structu genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; 1.80A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>2dt5_A AT-rich DNA-binding protein; REX, NADH, NAD, rossmann fold, redox sensing, winged helix, themophilus; HET: NAD; 2.16A {Thermus thermophilus} SCOP: a.4.5.38 c.2.1.12 PDB: 1xcb_A* 3ikt_A* 3ikv_A 3il2_A* Back     alignment and structure
>1up7_A 6-phospho-beta-glucosidase; hydrolase, family4 hydrolase, Na dependent; HET: G6P NAD; 2.4A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.2 PDB: 1up6_A* 1up4_A Back     alignment and structure
>1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>3e5r_O PP38, glyceraldehyde-3-phosphate dehydrogenase, cytosolic; GAPDH, RICE, oxidoreductase, cytoplasm, glycolysis, NAD; HET: NAD; 2.30A {Oryza sativa subsp} PDB: 3e6a_O Back     alignment and structure
>3u95_A Glycoside hydrolase, family 4; hydrolysis, cytosol; 2.00A {Thermotoga neapolitana} PDB: 1vjt_A* Back     alignment and structure
>1hye_A L-lactate/malate dehydrogenase; nucleotide binding domain, oxidoreductase; HET: NAP; 1.90A {Methanocaldococcus jannaschii} SCOP: c.2.1.5 d.162.1.1 PDB: 1hyg_A* Back     alignment and structure
>4hv4_A UDP-N-acetylmuramate--L-alanine ligase; MURC, yersinia pestis peptidoglycan synthesis; HET: AMP; 2.25A {Yersinia pestis} PDB: 2f00_A Back     alignment and structure
>1ebf_A Homoserine dehydrogenase; dinucleotide, NAD, dimer, oxidoreductase; HET: NAD; 2.30A {Saccharomyces cerevisiae} SCOP: c.2.1.3 d.81.1.2 PDB: 1ebu_A* 1tve_A* 1q7g_A* Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>2qrj_A Saccharopine dehydrogenase, NAD+, L-lysine- forming; sulfate, rossmann fold, alpha-aminoadipate pathway, fungal lysine biosynthesis; 1.60A {Saccharomyces cerevisiae} PDB: 2qrk_A* 2qrl_A* 2q99_A 3ugk_A 3uh1_A* 3uha_A* Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>2qyt_A 2-dehydropantoate 2-reductase; APC81190, porphyromonas gingi W83, structural genomics, PSI-2; HET: MSE; 2.15A {Porphyromonas gingivalis} Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>1yj8_A Glycerol-3-phosphate dehydrogenase; SGPP, structural genomics, PSI; 2.85A {Plasmodium falciparum} Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Back     alignment and structure
>3cps_A Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, glycolysis, malaria, structural genomics; HET: NAD; 1.90A {Cryptosporidium parvum iowa II} PDB: 1vsv_A* 1vsu_A* 3chz_A 3cie_A* 3cif_A* 3sth_A* Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* Back     alignment and structure
>3hn7_A UDP-N-acetylmuramate-L-alanine ligase; ATP-binding, nucleotide-binding, structural genomics, joint for structural genomics, JCSG; HET: MSE; 1.65A {Psychrobacter arcticus 273-4} Back     alignment and structure
>1x0v_A GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic; two independent domains, GXGXXG motif, oxidoreductase; 2.30A {Homo sapiens} PDB: 1x0x_A* 1wpq_A* 2pla_A* Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>3uko_A Alcohol dehydrogenase class-3; alcohol dehydrogenase III, homodimer, reduction of GSNO, NAD binding, oxidoreductase; HET: NAD SO4; 1.40A {Arabidopsis thaliana} Back     alignment and structure
>1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Back     alignment and structure
>3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* Back     alignment and structure
>2x5o_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; ATP-binding, cell cycle, cell division, cell shape, cell WAL biogenesis/degradation; HET: KCX VSV; 1.46A {Escherichia coli} PDB: 2wjp_A* 2xpc_A* 2y1o_A* 2jff_A* 2jfh_A* 2uuo_A* 2uup_A* 2vtd_A* 2vte_A* 2jfg_A* 2y66_A* 2y67_A* 2y68_A* 4uag_A* 1e0d_A* 1uag_A* 1eeh_A* 3uag_A* 2uag_A* Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A* Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>2jhf_A Alcohol dehydrogenase E chain; oxidoreductase, metal coordination, NAD, zinc, inhibition, acetylation, metal-binding; HET: NAD; 1.0A {Equus caballus} SCOP: b.35.1.2 c.2.1.1 PDB: 1adc_A* 1adf_A* 1adg_A* 1adb_A* 1bto_A* 1heu_A* 1hf3_A* 1hld_A* 1lde_A* 1ldy_A* 1mg0_A* 1n92_A* 1p1r_A* 1ye3_A 1het_A* 2jhg_A* 2ohx_A* 2oxi_A* 3bto_A* 4dwv_A* ... Back     alignment and structure
>1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1t4b_A Aspartate-semialdehyde dehydrogenase; asadh, HOSR, lysine biosynthesis, NADP+ oxidoreductase (phosphorylating), domain movement; 1.60A {Escherichia coli} SCOP: c.2.1.3 d.81.1.1 PDB: 1t4d_A 1brm_A 1gl3_A* 1nwc_A 1ta4_A 1tb4_A 1ps8_A 1pr3_A 1oza_A 1pqu_A* 1pqp_A 1nwh_A* 1nx6_A* 1pu2_A* 1q2x_A* Back     alignment and structure
>4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Back     alignment and structure
>1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Back     alignment and structure
>1p0f_A NADP-dependent alcohol dehydrogenase; ADH topology, NADP(H)-dependent, oxidoreductase; HET: NAP; 1.80A {Rana perezi} SCOP: b.35.1.2 c.2.1.1 PDB: 1p0c_A* Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>2f00_A UDP-N-acetylmuramate--L-alanine ligase; amide bond ligase, ATPase, bacterial cell WALL; 2.50A {Escherichia coli} Back     alignment and structure
>3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>1cdo_A Alcohol dehydrogenase; oxidoreductase, oxidoreductase (CH-OH(D)-NAD(A)); HET: NAD; 2.05A {Gadus callarias} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Back     alignment and structure
>3tz6_A Aspartate-semialdehyde dehydrogenase; asadh, ASD, ASA, amino-acid biosynthesis, diaminopimelate biosynthesis, lysine biosynthesis; HET: SO4; 1.95A {Mycobacterium tuberculosis} PDB: 3vos_A* 3kub_A 3llg_A Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* Back     alignment and structure
>2fzw_A Alcohol dehydrogenase class III CHI chain; S-nitrosoglutathione reductase, glutathione-dependent formaldehyde dehydrogenase, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 3qj5_A* 1mc5_A* 2fze_A* 1m6w_A* 1ma0_A* 1mp0_A* 1teh_A* 1m6h_A* Back     alignment and structure
>4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} Back     alignment and structure
>3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A* Back     alignment and structure
>1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Back     alignment and structure
>1p3d_A UDP-N-acetylmuramate--alanine ligase; alpha/beta protein; HET: UMA ANP; 1.70A {Haemophilus influenzae} SCOP: c.5.1.1 c.59.1.1 c.72.2.1 PDB: 1gqq_A* 1p31_A* 1gqy_A* Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
>4gx0_A TRKA domain protein; membrane protein, ION channel, ADP binding, NAD binding, MEM transport protein; HET: MAL GLC; 2.60A {Geobacter sulfurreducens} PDB: 4gx1_A* 4gx2_A* 4gx5_A 4gvl_A* Back     alignment and structure
>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Back     alignment and structure
>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* Back     alignment and structure
>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A Back     alignment and structure
>3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} Back     alignment and structure
>3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Back     alignment and structure
>2dvm_A Malic enzyme, 439AA long hypothetical malate oxidoreductase; NAD, structural genomics, NPPSFA; HET: NAD MES; 1.60A {Pyrococcus horikoshii} PDB: 1ww8_A* Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Back     alignment and structure
>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 988
d1yzya1412 c.146.1.1 (A:1-412) Hypothetical protein HI1011 {H 2e-59
d1vpda2161 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase 5e-29
d1vpda1133 a.100.1.1 (A:164-296) Hydroxyisobutyrate dehydroge 1e-27
d1vpda1133 a.100.1.1 (A:164-296) Hydroxyisobutyrate dehydroge 3e-16
d3cuma2162 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase 2e-27
d2cvza1132 a.100.1.1 (A:158-289) Hydroxyisobutyrate dehydroge 1e-26
d2cvza1132 a.100.1.1 (A:158-289) Hydroxyisobutyrate dehydroge 2e-14
d3cuma1134 a.100.1.1 (A:163-296) Hydroxyisobutyrate dehydroge 5e-26
d3cuma1134 a.100.1.1 (A:163-296) Hydroxyisobutyrate dehydroge 3e-13
d1i36a2152 c.2.1.6 (A:1-152) Conserved hypothetical protein M 7e-19
d1pgja2178 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase 2e-17
d2cvza2156 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase 1e-16
d1gvfa_ 284 c.1.10.2 (A:) Tagatose-1,6-bisphosphate aldolase { 8e-15
d1rvga_ 305 c.1.10.2 (A:) Fructose-bisphosphate aldolase (FBP 1e-14
d2pgda2176 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase 4e-14
d1dosa_ 358 c.1.10.2 (A:) Fructose-bisphosphate aldolase (FBP 1e-13
d2i76a2153 c.2.1.6 (A:2-154) Hypothetical protein TM1727 {The 4e-10
d2b0ja2242 c.2.1.6 (A:1-242) 5,10-methenyltetrahydromethanopt 1e-08
d2pv7a2152 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA { 1e-07
d2f1ka2165 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {S 5e-07
d2ahra2152 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductas 1e-04
d1bg6a2184 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvalin 4e-04
d1yqga2152 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductas 0.002
d1wdka3186 c.2.1.6 (A:311-496) Fatty oxidation complex alpha 0.003
d1f0ya2192 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA 0.003
>d1yzya1 c.146.1.1 (A:1-412) Hypothetical protein HI1011 {Haemophilus influenzae [TaxId: 727]} Length = 412 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: YgbK-like
superfamily: YgbK-like
family: YgbK-like
domain: Hypothetical protein HI1011
species: Haemophilus influenzae [TaxId: 727]

 Score =  207 bits (527), Expect = 2e-59
 Identities = 72/435 (16%), Positives = 143/435 (32%), Gaps = 49/435 (11%)

Query: 482 VLDDDPTGTQTV------HGIEVLTEWSVASLVEQFRKKPLCFFILTNSRALSSEKASSL 535
           V+ DD TG   +      +G+  +    V +  +    K     I   SR+    +A   
Sbjct: 3   VIADDFTGASDIASFLVENGLSTVQMNGVPT--QSLNSKVDAIVISLKSRSNPVNEAIEQ 60

Query: 536 ITDICRNLRTASNSVENTEYTVVLRGDSTLRGHFPEEADAAVSVLGEMDAWIICPFFLQG 595
                + L+          +      DST +G+     DA +  L E D  +I P     
Sbjct: 61  SLRAYQWLKENG--CTQFYFKYCSTFDSTAKGNIGPVTDALLDELNE-DFTVITPALPVN 117

Query: 596 GRYTIEDIHYVGDLDQLVPAGDTEFAKDASFGFKSSNLREWVEEKTSGRIPASSVASISI 655
           GR       +VGD    V   ++            +NL   ++ +  G+    + A +  
Sbjct: 118 GRTIFNGYLFVGD----VLLSESGMKNHPITPMVDANLMRLMDAQAKGKTGLVAYADV-- 171

Query: 656 QLLRKGGPDAVCERLCSLQKGSTC--IVNAASERDIAVFAAGMIQAELKGKSFLCRTAAS 713
                 G   V E    L+       +V+A     + V A  +   +L           +
Sbjct: 172 ----IKGASRVQECFAELKAQGYRYAVVDAVDNSQLEVLAEAVADFKL---VTGGSGLGA 224

Query: 714 FVSARIGIVAKAPILPKDLGNKIESTGGLIVVGSYVPKTTKQVEELISQSGRFIRSVEVS 773
           +++AR+    K          K      +++ GS    T KQVE+   ++       ++ 
Sbjct: 225 YMAARLSGGKKGTNAFTPTKGKT-----VVLSGSCSVMTNKQVEKYREKA----PHFQLD 275

Query: 774 VDKVAMKSLEERQEEIIRAAEMVDVFLQARKDTLLITSR---VLITGKTPSESLEINLKV 830
           V++         +  I +  + V   L +    ++  +     L   +      + +  +
Sbjct: 276 VEQAI-----HNENYIEQLYQWVIANLDSEFAPMVYATVPPDALKAIQHQFGVDQASHAI 330

Query: 831 SSAMVEIVRRI-TTRPRYILAKGGITSSDIATKALEAKRAKVVGQALAGVPLWELGPESR 889
            +   ++  ++        +  GG TSS +  + L      +  Q   GVP      ++ 
Sbjct: 331 ENTFAKLAAKLKQYGVTNFITAGGETSSIV-VQELGFTGFHIGKQIAPGVPWL----KAV 385

Query: 890 HPGVPYVVFPGNVGD 904
              +   +  GN G 
Sbjct: 386 EEDIFLALKSGNFGK 400
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Length = 161 Back     information, alignment and structure
>d1vpda1 a.100.1.1 (A:164-296) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Length = 133 Back     information, alignment and structure
>d1vpda1 a.100.1.1 (A:164-296) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Length = 133 Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Length = 162 Back     information, alignment and structure
>d2cvza1 a.100.1.1 (A:158-289) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} Length = 132 Back     information, alignment and structure
>d2cvza1 a.100.1.1 (A:158-289) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} Length = 132 Back     information, alignment and structure
>d3cuma1 a.100.1.1 (A:163-296) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Length = 134 Back     information, alignment and structure
>d3cuma1 a.100.1.1 (A:163-296) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Length = 134 Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 152 Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Length = 178 Back     information, alignment and structure
>d2cvza2 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} Length = 156 Back     information, alignment and structure
>d1gvfa_ c.1.10.2 (A:) Tagatose-1,6-bisphosphate aldolase {Escherichia coli [TaxId: 562]} Length = 284 Back     information, alignment and structure
>d1rvga_ c.1.10.2 (A:) Fructose-bisphosphate aldolase (FBP aldolase) {Thermus aquaticus [TaxId: 271]} Length = 305 Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Length = 176 Back     information, alignment and structure
>d1dosa_ c.1.10.2 (A:) Fructose-bisphosphate aldolase (FBP aldolase) {Escherichia coli [TaxId: 562]} Length = 358 Back     information, alignment and structure
>d2i76a2 c.2.1.6 (A:2-154) Hypothetical protein TM1727 {Thermotoga maritima [TaxId: 2336]} Length = 153 Back     information, alignment and structure
>d2b0ja2 c.2.1.6 (A:1-242) 5,10-methenyltetrahydromethanopterin hydrogenase, HMD {Archaeon Methanocaldococcus jannaschii [TaxId: 2190]} Length = 242 Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Length = 152 Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Length = 165 Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Length = 152 Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Length = 184 Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Length = 152 Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Length = 186 Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query988
d1yzya1412 Hypothetical protein HI1011 {Haemophilus influenza 100.0
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 99.96
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 99.95
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 99.9
d1vpda1133 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 99.89
d2cvza2156 Hydroxyisobutyrate dehydrogenase {Thermus thermoph 99.89
d2cvza1132 Hydroxyisobutyrate dehydrogenase {Thermus thermoph 99.88
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 99.88
d3cuma1134 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 99.85
d1vpda1133 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 99.83
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 99.81
d2cvza1132 Hydroxyisobutyrate dehydrogenase {Thermus thermoph 99.8
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 99.78
d3cuma1134 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 99.75
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 99.64
d2i76a2153 Hypothetical protein TM1727 {Thermotoga maritima [ 99.64
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 99.62
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 99.55
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 99.53
d1rvga_ 305 Fructose-bisphosphate aldolase (FBP aldolase) {The 99.42
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 99.42
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 99.4
d2b0ja2242 5,10-methenyltetrahydromethanopterin hydrogenase, 99.39
d1gvfa_ 284 Tagatose-1,6-bisphosphate aldolase {Escherichia co 99.37
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 99.32
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 99.3
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 99.25
d1dosa_ 358 Fructose-bisphosphate aldolase (FBP aldolase) {Esc 99.2
d1dlja2196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 99.17
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 99.15
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 98.85
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 98.73
d1mx3a1193 Transcription corepressor CtbP {Human (Homo sapien 98.73
d1gdha1191 D-glycerate dehydrogenase {Hyphomicrobium methylov 98.69
d2naca1188 Formate dehydrogenase {Pseudomonas sp., strain 101 98.61
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 98.59
d1dxya1199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 98.55
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 98.51
d1ygya1184 Phosphoglycerate dehydrogenase {Mycobacterium tube 98.48
d1sc6a1188 Phosphoglycerate dehydrogenase {Escherichia coli [ 98.44
d1mv8a198 GDP-mannose 6-dehydrogenase, middle domain {Pseudo 98.41
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 98.28
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 98.15
d1vjta1193 Putative alpha-glucosidase TM0752 {Thermotoga mari 98.15
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 98.1
d1dlja198 UDP-glucose dehydrogenase (UDPGDH), middle domain 98.05
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 98.03
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 98.0
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 97.96
d1np3a2182 Class I ketol-acid reductoisomerase (KARI) {Pseudo 97.92
d1tlta1164 Virulence factor MviM {Escherichia coli [TaxId: 56 97.88
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 97.87
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 97.84
d1ydwa1184 Probable oxidoreductase At4g09670 {Thale cress (Ar 97.73
d1qmga2226 Class II ketol-acid reductoisomerase (KARI) {Spina 97.66
d1f06a1170 Diaminopimelic acid dehydrogenase (DAPDH) {Coryneb 97.63
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 97.63
d1zh8a1181 Hypothetical protein TM0312 {Thermotoga maritima [ 97.61
d1xeaa1167 Putative oxidoreductase VCA1048 {Vibrio cholerae [ 97.57
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 97.55
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 97.5
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 97.5
d1nvmb1157 Acetaldehyde dehydrogenase (acylating) {Pseudomona 97.5
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 97.47
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 97.41
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 97.41
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 97.4
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 97.38
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 97.35
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 97.34
d1h6da1221 Glucose-fructose oxidoreductase, N-terminal domain 97.34
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 97.33
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 97.32
d1obba1171 Alpha-glucosidase AglA {Thermotoga maritima [TaxId 97.22
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 97.22
d1c1da1201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 97.2
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 97.18
d1j5pa4132 Hypothetical protein TM1643 {Thermotoga maritima [ 97.1
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 97.09
d1j6ua189 UDP-N-acetylmuramate-alanine ligase MurC {Thermoto 97.09
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 97.04
d1omoa_320 Archaeal alanine dehydrogenase {Archaeon Archaeogl 96.98
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 96.89
d1y7ta1154 Malate dehydrogenase {Thermus thermophilus [TaxId: 96.77
d1x7da_340 Ornithine cyclodeaminase {Pseudomonas putida [TaxI 96.77
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 96.73
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 96.67
d2nvwa1237 Galactose/lactose metabolism regulatory protein GA 96.61
d1u8xx1167 Maltose-6'-phosphate glucosidase GlvA {Bacillus su 96.61
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 96.59
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 96.55
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 96.52
d1up7a1162 6-phospho-beta-glucosidase {Thermotoga maritima [T 96.51
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 96.32
d2hjsa1144 Usg-1 protein homolog PA3116 {Pseudomonas aerugino 96.26
d1lc0a1172 Biliverdin reductase {Rat (Rattus norvegicus) [Tax 96.24
d5mdha1154 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 96.2
d2pgda1297 6-phosphogluconate dehydrogenase (6PGD) {Sheep (Ov 96.16
d1t4ba1146 Aspartate beta-semialdehyde dehydrogenase {Escheri 96.15
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 96.13
d1b7go1178 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 96.07
d1vm6a3128 Dihydrodipicolinate reductase {Thermotoga maritima 96.04
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 95.99
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 95.87
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 95.83
d7mdha1175 Malate dehydrogenase {Sorghum (Sorghum vulgare), c 95.8
d1s6ya1169 6-phospho-beta-glucosidase {Bacillus stearothermop 95.78
d1vkna1176 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 95.76
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 95.75
d1pgja1300 6-phosphogluconate dehydrogenase (6PGD) {Trypanoso 95.74
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 95.69
d1y81a1116 Hypothetical protein PF0725 {Pyrococcus furiosus [ 95.68
d1mv8a3136 GDP-mannose 6-dehydrogenase, GDP-binding domain {P 95.62
d1txga1155 Glycerol-3-phosphate dehydrogenase {Archaeoglobus 95.54
d2czca2172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 95.54
d1b0aa1166 Methylenetetrahydrofolate dehydrogenase/cyclohydro 95.51
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 95.45
d1cf2o1171 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 95.42
d1a4ia1170 Methylenetetrahydrofolate dehydrogenase/cyclohydro 95.27
d1id1a_153 Rck domain from putative potassium channel Kch {Es 95.02
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 95.01
d2d59a1139 Hypothetical protein PH1109 {Pyrococcus horikoshii 94.94
d1diha1162 Dihydrodipicolinate reductase {Escherichia coli [T 94.83
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 94.82
d2g17a1179 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 94.8
d1i36a1112 Conserved hypothetical protein MTH1747 {Archaeon M 94.79
d2csua1129 Acetate-CoA ligase alpha chain, AcdA, N-terminal d 94.76
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 94.72
d1leha1230 Leucine dehydrogenase {Bacillus sphaericus [TaxId: 94.66
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 94.55
d1n1ea1160 Glycerol-3-phosphate dehydrogenase {Trypanosome (L 94.51
d1gega_255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 94.48
d2fy8a1129 Potassium channel-related protein MthK {Archaeon M 94.47
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 94.45
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 94.32
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 94.28
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 94.26
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 94.02
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 94.02
d1iuka_136 Hypothetical protein TT1466 {Thermus thermophilus 93.99
d2rhca1257 beta-keto acyl carrier protein reductase {Streptom 93.99
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 93.94
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 93.87
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 93.86
d1mb4a1147 Aspartate beta-semialdehyde dehydrogenase {Vibrio 93.84
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 93.62
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 93.4
d2q46a1252 Hypothetical protein At5g02240 (T7H20_290) {Thale 93.39
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 93.35
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 93.33
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 93.29
d2gz1a1154 Aspartate beta-semialdehyde dehydrogenase {Strepto 93.17
d1q7ba_243 beta-keto acyl carrier protein reductase {Escheric 93.17
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 93.1
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 93.06
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 93.02
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 93.01
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 92.99
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 92.92
d2ae2a_259 Tropinone reductase {Jimsonweed (Datura stramonium 92.86
d1ulsa_242 beta-keto acyl carrier protein reductase {Thermus 92.82
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 92.79
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 92.75
d1ydea1250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 92.72
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 92.71
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 92.64
d2cvoa1183 Putative semialdehyde dehydrogenase {Rice (Oryza s 92.63
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 92.6
d1ks9a1124 Ketopantoate reductase PanE {Escherichia coli [Tax 92.58
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 92.57
d1w6ua_294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 92.56
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 92.4
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 92.33
d1zk4a1251 R-specific alcohol dehydrogenase {Lactobacillus br 92.24
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 92.19
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 92.18
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 92.16
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 92.03
d1bdba_276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 92.0
d1pr9a_244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 91.89
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 91.82
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 91.77
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 91.77
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 91.7
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 91.59
d1hdca_254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 91.51
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 91.48
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 91.46
d1hxha_253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 91.43
d1yl7a1135 Dihydrodipicolinate reductase {Mycobacterium tuber 91.35
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 91.33
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 91.28
d1k2wa_256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 91.26
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 91.21
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 91.1
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 91.06
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 91.05
d2c5aa1363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 90.95
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 90.8
d2dw4a2449 Lysine-specific histone demethylase 1, LSD1 {Human 90.76
d1yxma1297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 90.69
d1yovb1426 UBA3 {Human (Homo sapiens) [TaxId: 9606]} 90.62
d1h5qa_260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 90.39
d1spxa_264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 90.32
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 90.27
d1xq1a_259 Tropinone reductase {Thale cress (Arabidopsis thal 90.18
d1edza1171 Methylenetetrahydrofolate dehydrogenase/cyclohydro 90.17
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 90.15
d1xgka_350 Negative transcriptional regulator NmrA {Aspergill 90.07
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 89.92
d2bgka1268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 89.82
d2bd0a1240 Bacterial sepiapterin reductase {Chlorobium tepidu 89.55
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 89.54
d1wmaa1275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 89.49
d2pgda1297 6-phosphogluconate dehydrogenase (6PGD) {Sheep (Ov 89.47
d2gdza1254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 89.44
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 89.44
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 89.27
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 89.24
d1ulua_256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 89.11
d1i8ta1298 UDP-galactopyranose mutase, N-terminal domain {Esc 88.97
d1xkqa_272 Hypothetical protein R05D8.7 {Caenorhabditis elega 88.88
d1cyda_242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 88.8
d2pd4a1274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 88.78
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 88.63
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 88.55
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 88.37
d1xhla_274 Hypothetical protein F25D1.5 {Caenorhabditis elega 88.34
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 88.33
d2a4ka1241 beta-keto acyl carrier protein reductase {Thermus 88.27
d1jw9b_247 Molybdenum cofactor biosynthesis protein MoeB {Esc 88.14
d2d1ya1248 Hypothetical protein TTHA0369 {Thermus thermophilu 88.13
d2o23a1248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 87.77
d1vl0a_281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 87.73
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 87.63
d1b26a1234 Glutamate dehydrogenase {Thermotoga maritima [TaxI 87.62
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 87.38
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 87.37
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 87.32
d1geea_261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 87.12
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 87.01
d1edoa_244 beta-keto acyl carrier protein reductase {Oil seed 86.97
d2ag5a1245 Dehydrogenase/reductase SDR family member 6, DHRS6 86.67
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 86.33
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 86.22
d1udca_338 Uridine diphosphogalactose-4-epimerase (UDP-galact 85.97
d2ew8a1247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 85.95
d1g0oa_272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 85.72
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 85.54
d2v5za1383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 84.87
d1y1pa1342 Aldehyde reductase II {Sporobolomyces salmonicolor 84.87
d1x1ta1260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 84.8
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 84.47
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 84.33
d1ja9a_259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 84.29
d1mv8a198 GDP-mannose 6-dehydrogenase, middle domain {Pseudo 83.92
d2blla1342 Polymyxin resistance protein ArnA (PrmI) {Escheric 83.71
d1v9la1242 Glutamate dehydrogenase {Pyrobaculum islandicum [T 83.64
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 83.6
d2bkaa1232 TAT-interacting protein TIP30 {Human (Homo sapiens 83.34
d1xu9a_269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 83.26
d1fjha_257 3-alpha-hydroxysteroid dehydrogenase {Comamonas te 83.23
d1hwxa1293 Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 82.94
d2nu7a1119 Succinyl-CoA synthetase, alpha-chain, N-terminal ( 82.75
d1rkxa_356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 82.48
d1pn0a1360 Phenol hydroxylase {Soil-living yeast (Trichosporo 81.97
d1qsga_258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 81.24
d2h1qa1251 Hypothetical protein Dhaf_3308 {Desulfitobacterium 81.2
d1e7wa_284 Dihydropteridin reductase (pteridine reductase) {L 80.61
d1e5da1152 Rubredoxin oxygen:oxidoreductase (ROO), C-terminal 80.41
>d1yzya1 c.146.1.1 (A:1-412) Hypothetical protein HI1011 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: YgbK-like
superfamily: YgbK-like
family: YgbK-like
domain: Hypothetical protein HI1011
species: Haemophilus influenzae [TaxId: 727]

Probab=100.00  E-value=2.6e-76  Score=675.22  Aligned_cols=399  Identities=17%  Similarity=0.194  Sum_probs=342.6

Q ss_pred             EEEecCCCCccccc------ccceeEeecChhhHHHhhccCCcEEEEecCCCCCCHHHHHHHHHHHHHHHHHhccccCCC
Q 001973          480 LIVLDDDPTGTQTV------HGIEVLTEWSVASLVEQFRKKPLCFFILTNSRALSSEKASSLITDICRNLRTASNSVENT  553 (988)
Q Consensus       480 ~~iiaDD~TGa~~~------~g~~~~~~~~~~~~~~~~~~~~dvvvi~T~SR~l~~~~A~~~v~~~~~~l~~~~~~~~~~  553 (988)
                      |.|||||||||+++      +|+++.+.++.+.  .....++|+++|+||||++++++|+++|++++++++..+++  ..
T Consensus         1 i~iIADDlTGA~dt~~~~~~~G~~t~~~~~~~~--~~~~~~~dvv~i~t~SR~l~~~eA~~~v~~~~~~l~~~~~~--~~   76 (412)
T d1yzya1           1 LGVIADDFTGASDIASFLVENGLSTVQMNGVPT--QSLNSKVDAIVISLKSRSNPVNEAIEQSLRAYQWLKENGCT--QF   76 (412)
T ss_dssp             CEEEESSHHHHHHHHHHHHTTTCCEEEEESCCS--SCCCSCCSEEEEECCCSSSCHHHHHHHHHHHHHHHHHTTCC--SE
T ss_pred             CeEEecCchhHHHHHHHHHHCCCeEEEEcCCCc--ccccCCCCEEEEEcCCCCCCHHHHHHHHHHHHHHHHhcCCC--ee
Confidence            57999999999998      7999999888652  23456789999999999999999999999999999998866  34


Q ss_pred             eEEEEeccCCCCCCCchhHHHHHHhhhCCCCEEEEeccccCCCeEEECcEEEEecCCceeecCCCccccCCCCCCCCCcH
Q 001973          554 EYTVVLRGDSTLRGHFPEEADAAVSVLGEMDAWIICPFFLQGGRYTIEDIHYVGDLDQLVPAGDTEFAKDASFGFKSSNL  633 (988)
Q Consensus       554 ~~~i~kkiDSTLRGnig~Ei~a~~~~~~~~~~~~v~PAfP~~GR~t~~G~~~v~g~~~~~pl~et~~a~Dp~~Pv~~s~l  633 (988)
                      ++++|||||||||||||+|++++++++++ +.++||||||++||||++|+|||||    +||++|+|++||+|||++|+|
T Consensus        77 ~~Kv~s~~DStlRGnig~Ei~a~~~~~~~-~~~~v~PA~P~~gR~t~~G~~~v~g----~pl~~t~~a~dP~tP~~~s~l  151 (412)
T d1yzya1          77 YFKYCSTFDSTAKGNIGPVTDALLDELNE-DFTVITPALPVNGRTIFNGYLFVGD----VLLSESGMKNHPITPMVDANL  151 (412)
T ss_dssp             EEECCTTCCCCTTCTHHHHHHHHHHHHTC-CCEEECCCBGGGTEEEETTEEEETT----EEGGGSGGGGCSSSCCCCCBH
T ss_pred             EEEEEecccCCCcCCcHHHHHHHHHhcCC-CeEEEecCcccCCeEEECCEEEECC----EEccCcccccCCCCCCCcchH
Confidence            55677789999999999999999999996 7999999999999999999999999    999999999999999999999


Q ss_pred             HHHHHhHcCCCCCCCceeEEehHHHhccChhHHHHHHhccc--CCCeEEEecCChhHHHHHHHHHHHHHHcCCcEEEEcc
Q 001973          634 REWVEEKTSGRIPASSVASISIQLLRKGGPDAVCERLCSLQ--KGSTCIVNAASERDIAVFAAGMIQAELKGKSFLCRTA  711 (988)
Q Consensus       634 ~~~l~~q~~~~~~~~~v~~i~l~~v~~~~~~~~~~~l~~~~--~~~i~V~Da~t~~dL~~ia~a~~~~~~~~~~~l~vg~  711 (988)
                      +++|++|++.+     |.++++.+++. +.+.+.+++.++.  ..+++||||+|++||+.|++++     .+ ..+|+||
T Consensus       152 ~~ll~~qs~~~-----v~~i~~~~v~~-~~~~~~~~l~~~~~~~~~~vv~Da~t~~dL~~ia~a~-----~~-~~~~~Gs  219 (412)
T d1yzya1         152 MRLMDAQAKGK-----TGLVAYADVIK-GASRVQECFAELKAQGYRYAVVDAVDNSQLEVLAEAV-----AD-FKLVTGG  219 (412)
T ss_dssp             HHHHHHHCSSC-----EEEECHHHHTT-CHHHHHHHHHHHHHTTCSEEEECBSSTHHHHHHHHHT-----TT-CSEEEES
T ss_pred             HHHhhhhcCCc-----cccccHHHHhc-chhHHHHHHHHHhcCCCceEEEecCCHHHHHHHHHHh-----cC-CeEEEec
Confidence            99999999974     99999999998 6788888887653  4589999999999999999877     23 3478999


Q ss_pred             hHHHHHHhcccccCCCCccccccccCCCceEEEEeccccccHHHHHHHHhhcCCcEEEEEEehhHHHhhchHhHHHHHHH
Q 001973          712 ASFVSARIGIVAKAPILPKDLGNKIESTGGLIVVGSYVPKTTKQVEELISQSGRFIRSVEVSVDKVAMKSLEERQEEIIR  791 (988)
Q Consensus       712 agl~~~L~~~~~~~~~~~~~~~~~~~~~~~L~v~GS~s~~T~~Qi~~l~~~~~~~~~~i~~~~~~ll~~~~~~~~~~~~~  791 (988)
                      +|++.+|+..+......+.  ...+..+|+|+||||+|++|++|++++.++.    ..+++|++++++.     +.++++
T Consensus       220 aGla~~l~~~~~~~~~~~~--~~~~~~~~~Lvv~GS~s~~T~~Ql~~~~~~~----~~~~l~~~~~~~~-----~~~~~~  288 (412)
T d1yzya1         220 SGLGAYMAARLSGGKKGTN--AFTPTKGKTVVLSGSCSVMTNKQVEKYREKA----PHFQLDVEQAIHN-----ENYIEQ  288 (412)
T ss_dssp             HHHHHHHHHHHHTSCCGGG--CCCCCSCCEEEEECCCSHHHHHHHHHHTTTS----CEEECCHHHHHHC-----TTHHHH
T ss_pred             ccHHHHHHHhhcccccccc--ccCCCCCcEEEEEccCcHHHHHHHHHHHhcC----CeEEecHHHhcCC-----cHHHHH
Confidence            9999999765543221111  1234457999999999999999999998763    4578999999842     345677


Q ss_pred             HHHHHHHHHhcCCcEEEEecCcccc---cCCccchHHHHHHHHHHHHHHHHHhhc-CcceeeeccccchHHHHHhhcccc
Q 001973          792 AAEMVDVFLQARKDTLLITSRVLIT---GKTPSESLEINLKVSSAMVEIVRRITT-RPRYILAKGGITSSDIATKALEAK  867 (988)
Q Consensus       792 ~~~~~~~~l~~~~~~vi~t~~~~~~---~~~~~~~~~~~~~i~~~l~~i~~~~~~-~~~~li~tGGdTs~~v~~~~Lg~~  867 (988)
                      +.+++.+.+.+++.+++++++....   ........+.+++|+..|+++++++.+ ++++||++|||||.+++ ++||++
T Consensus       289 ~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~l~~~~~~l~~~~~~~lv~tGGdTa~av~-~~Lg~~  367 (412)
T d1yzya1         289 LYQWVIANLDSEFAPMVYATVPPDALKAIQHQFGVDQASHAIENTFAKLAAKLKQYGVTNFITAGGETSSIVV-QELGFT  367 (412)
T ss_dssp             HHHHHHTTTTSSSCCEEECCCCHHHHHHHHTTTCHHHHHHHHHHHHHHHHHHHHHHTCCEEEEESHHHHHHHH-HHHTCC
T ss_pred             HHHHHHHHHhcCCCeEEEecCchhhhhhhhhhhhhHHHHHHHHHHHHHHHHHHHhcCCCeEEEeccHHHHHHH-HHcCCC
Confidence            7788888889999999999875321   122334678899999999999999876 79999999999999995 899999


Q ss_pred             ceEEecccccCCcEEEcCCCCCCCCCcEEecCCCCCChhHHHHHHHHh
Q 001973          868 RAKVVGQALAGVPLWELGPESRHPGVPYVVFPGNVGDNNAVANVVRSW  915 (988)
Q Consensus       868 ~~~~~~ei~pGvp~~~~~~~g~~~gl~ivtK~G~fG~~~~l~~~~~~l  915 (988)
                      ++++++||+||+|+++.. +   +|+++|||+|+||++|+|.++++++
T Consensus       368 ~l~~~~ei~pGvp~~~~~-~---~gl~ivtK~G~fG~~D~~~~a~~~~  411 (412)
T d1yzya1         368 GFHIGKQIAPGVPWLKAV-E---EDIFLALKSGNFGKEDFFEYAQGMF  411 (412)
T ss_dssp             EEEEEEEEETTEEEEEES-S---SSCEEEEECTTCSCTTHHHHHHHTT
T ss_pred             eeeEcCcccCCceEEEec-C---CCeEEEEECCCCCChhHHHHHHHHh
Confidence            999999999999999975 2   5899999999999999999999875
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1vpda1 a.100.1.1 (A:164-296) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2cvza2 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2cvza1 a.100.1.1 (A:158-289) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d3cuma1 a.100.1.1 (A:163-296) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1vpda1 a.100.1.1 (A:164-296) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2cvza1 a.100.1.1 (A:158-289) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d3cuma1 a.100.1.1 (A:163-296) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2i76a2 c.2.1.6 (A:2-154) Hypothetical protein TM1727 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1rvga_ c.1.10.2 (A:) Fructose-bisphosphate aldolase (FBP aldolase) {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d2b0ja2 c.2.1.6 (A:1-242) 5,10-methenyltetrahydromethanopterin hydrogenase, HMD {Archaeon Methanocaldococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1gvfa_ c.1.10.2 (A:) Tagatose-1,6-bisphosphate aldolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1dosa_ c.1.10.2 (A:) Fructose-bisphosphate aldolase (FBP aldolase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mv8a1 a.100.1.4 (A:203-300) GDP-mannose 6-dehydrogenase, middle domain {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1dlja1 a.100.1.4 (A:197-294) UDP-glucose dehydrogenase (UDPGDH), middle domain {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1np3a2 c.2.1.6 (A:1-182) Class I ketol-acid reductoisomerase (KARI) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1tlta1 c.2.1.3 (A:5-127,A:268-308) Virulence factor MviM {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1qmga2 c.2.1.6 (A:82-307) Class II ketol-acid reductoisomerase (KARI) {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1zh8a1 c.2.1.3 (A:4-131,A:276-328) Hypothetical protein TM0312 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xeaa1 c.2.1.3 (A:2-122,A:267-312) Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1nvmb1 c.2.1.3 (B:1-131,B:287-312) Acetaldehyde dehydrogenase (acylating) {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6da1 c.2.1.3 (A:51-212,A:375-433) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1obba1 c.2.1.5 (A:2-172) Alpha-glucosidase AglA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1omoa_ c.2.1.13 (A:) Archaeal alanine dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1x7da_ c.2.1.13 (A:) Ornithine cyclodeaminase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2nvwa1 c.2.1.3 (A:2-154,A:374-457) Galactose/lactose metabolism regulatory protein GAL80 {Yeast (Kluyveromyces lactis) [TaxId: 28985]} Back     information, alignment and structure
>d1u8xx1 c.2.1.5 (X:3-169) Maltose-6'-phosphate glucosidase GlvA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1up7a1 c.2.1.5 (A:1-162) 6-phospho-beta-glucosidase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2hjsa1 c.2.1.3 (A:3-129,A:320-336) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1lc0a1 c.2.1.3 (A:2-128,A:247-291) Biliverdin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2pgda1 a.100.1.1 (A:177-473) 6-phosphogluconate dehydrogenase (6PGD) {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1t4ba1 c.2.1.3 (A:1-133,A:355-367) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1b7go1 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d7mdha1 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} Back     information, alignment and structure
>d1s6ya1 c.2.1.5 (A:4-172) 6-phospho-beta-glucosidase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1vkna1 c.2.1.3 (A:1-144,A:308-339) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1pgja1 a.100.1.1 (A:179-478) 6-phosphogluconate dehydrogenase (6PGD) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y81a1 c.2.1.8 (A:6-121) Hypothetical protein PF0725 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1mv8a3 c.26.3.1 (A:301-436) GDP-mannose 6-dehydrogenase, GDP-binding domain {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1txga1 a.100.1.6 (A:181-335) Glycerol-3-phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2czca2 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1cf2o1 c.2.1.3 (O:1-138,O:304-336) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} Back     information, alignment and structure
>d1a4ia1 c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2d59a1 c.2.1.8 (A:4-142) Hypothetical protein PH1109 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1diha1 c.2.1.3 (A:2-130,A:241-273) Dihydrodipicolinate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2g17a1 c.2.1.3 (A:1-153,A:309-334) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1i36a1 a.100.1.8 (A:153-264) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2csua1 c.2.1.8 (A:1-129) Acetate-CoA ligase alpha chain, AcdA, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1n1ea1 a.100.1.6 (A:198-357) Glycerol-3-phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iuka_ c.2.1.8 (A:) Hypothetical protein TT1466 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1mb4a1 c.2.1.3 (A:1-132,A:355-369) Aspartate beta-semialdehyde dehydrogenase {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gz1a1 c.2.1.3 (A:2-127,A:330-357) Aspartate beta-semialdehyde dehydrogenase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d2cvoa1 c.2.1.3 (A:68-218,A:384-415) Putative semialdehyde dehydrogenase {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ks9a1 a.100.1.7 (A:168-291) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1edza1 c.2.1.7 (A:149-319) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pgda1 a.100.1.1 (A:177-473) 6-phosphogluconate dehydrogenase (6PGD) {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1b26a1 c.2.1.7 (A:179-412) Glutamate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1mv8a1 a.100.1.4 (A:203-300) GDP-mannose 6-dehydrogenase, middle domain {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v9la1 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1hwxa1 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2nu7a1 c.2.1.8 (A:2-120) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2h1qa1 c.67.3.1 (A:1-251) Hypothetical protein Dhaf_3308 {Desulfitobacterium hafniense [TaxId: 49338]} Back     information, alignment and structure
>d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1e5da1 c.23.5.1 (A:251-402) Rubredoxin oxygen:oxidoreductase (ROO), C-terminal domain {Desulfovibrio gigas [TaxId: 879]} Back     information, alignment and structure