Citrus Sinensis ID: 002012

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980--
MASRRLTKTTFAALKSARHNKLSLAQSGSRAKSISTFTNFSNSLSRPPIENKLILPPNDVVSAKLSFTTVGFARKFHSSTPLRSSTTGVSQITPTEFTEKAWEGIVGAVDAARVNNQQVVETEHLMKALLEQKDGLARRILTKAGQDNTKVLQATEDFISKQPKVTGATSGPIVGSNFGLLLSNAQRIKKEMEDDFVSVEHLLLAFLSDDRFGRLLFNDIRLNEKDLKDAVKAVRGHQRVTDQNPEGKYQALEKYGNDLTELARSGKLDPVIGRDDEIRRCIQILSRRTKNNPVIIGEPGVGKTAIAEGLAQRIVRGDVPETLQNRKLISLDMASLVAGTCYRGDFEKRLKAVLKEVTKSNGQIILFIDELHTIIGAGNQSGAMDASNMLKPMLGRGELRCIGATTLNEYRNYIEKDPALERRFQQVFCDQPSVENTISILRGLRERYELHHGVKISDSALVSAAVLADRYITERFLPDKAIDLVDEAAAKLKMEITSKPIELDEIDRAVLKLEMEKLSLKNDTDKASKERLSKLEHDLNSLKQKQKELNDQWSREKDLMSRIRSIKEEIDRVNLEMEAAERDYDLNRAAELKYGTMISLQRQLEEAEKNLSEFQKSGHSLLREEVTDLDIAEIVSKWTGIPLSSLQQSEREKLVMLEEVLHKRVIGQDIAVKSVADAIRRSRAGLSDPARPIASFMFMGPTGVGKTELGKALADFLFNTENALVRIDMSEYMEKHSVSRLVGAPPGYVGYEEGGQLTEVVRRRPYSVVLFDEIEKAHQDVFNILLQLLDDGRITDSQGRTVSFTNCVVIMTSNIGSHYILETLQSVQDSKEAVYEVMKKQVVELARQTFRPEFLNRIDEYIVFQPLDSKEISKIVEIQMNRVKDRLKQKKIDLHYTKEAVTLLGILGFDPNFGARPVKRVIQQLVENEIAVAILKGDIKEEDSVIIDVDDSPSAKDLPPRNKLCIKKLESSSSIDAMVAND
cccccccHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHccccccHHHHHHHHcccHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHccccEEEHHHHHHHHHccccHHHHHHHHccccHHHHHHHHHHHHcccccccccccHHHHHHHHHHHcHHHHHHcccccccccccHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHccccccccccccEEEEcHHHHHHccccccHHHHHHHHHHHHHHHccccEEEEEEccccccccccccccccccccccccccccccccccccccHHHHHHHccccHHHccccccccccccHHHHHHHHHcccHHHccccccccccHHHHHHHHHHccccccccccccHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHccccHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHccccccccHHHHHHHHHHccHHHHHcccccHHHHHHHHHHHHHHHHcccccccccccccEEcccccccHHHHHHHHHHHcccccccccccccccccHHHHHHHHccccccccccccccccHHHHccccccEEEHHHHccccccHHHHHHHHHccccccccccccccccccEEEEcccccHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHccccccccccccEEEcccccHHHHHHHHHHHHHHHHHHHHHccccEEccHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHccccccccEEEEEEcccccccccccccccEEEEcccccccccccccc
ccHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccHHHHHHcccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHcccccHHHHHHHccccHHHHHHHHHHHHHHccccccccccEEccHHHHHHHHHHHHHHHHccccEEHHHHHHHHHHHcccHHHHHHHHccccHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHcccccEEEccccccHHHHHHHHHHHHHcccccHHHHccEEEEEHHHHHHHHcccccHHHHHHHHHHHHHHHHcccEEEEEEcHHHEEccccccccccHHHHHHHHHHccccEEEccccHHHHHHHHHHHHHHHHHHcHHEcccccHHHHHHHHHHHHHHHHHHcccEEccHHHHHHHHHHcHHHHcccccHHHHHHHHHHHHHHHEEccccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHccccccHHHcccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccccccccEEEEEcccccccHHHHHHHHHHHHccccccEEEEcHHHHHHHHHHHHHccccccccccccccHHHHHHHccccEEEEEHHHHHHcHHHHHHHHHHHcccccccccccEEEcEcEEEEEEccccHHHHHHHccccccccHHHHHHHHHHHHHHHHHHccHHHHHHccEEEEEccccHHHHHHHHHHHHHHHHHHHHHcccEEEEcHHHHHHHHHccccccccccHHHHHHHHHHHcHHHHHHHccccccccEEEEEEcccEEEEEcccccEEEEEEccccccHHHHHccc
MASRRLTKTTFAALKSARHNKLSLaqsgsraksistftnfsnslsrppienklilppndvvsAKLSFTTVGfarkfhsstplrssttgvsqitptefTEKAWEGIVGAVDAARVNNQQVVETEHLMKALLEQKDGLARRILTKAGQDNTKVLQATEDfiskqpkvtgatsgpivgsnfGLLLSNAQRIKKEMEDDFVSVEHLLLAFLSDDRFGRLLFNDIRLNEKDLKDAVKAVrghqrvtdqnpegKYQALEKYGNDLTelarsgkldpvigrddEIRRCIQILSrrtknnpviigepgvgkTAIAEGLAqrivrgdvpetlqNRKLISLDMASLVAGTCYRGDFEKRLKAVLKEVTKSNGQIILFIDELHTIIgagnqsgamdasnmlkpmlgrgelrcigATTLNEYRNYIEKDPALERRFQQvfcdqpsveNTISILRGLRERYelhhgvkisdSALVSAAVLADRYiterflpdkaIDLVDEAAAKLKMEItskpieldEIDRAVLKLEMEKLSLKNDTDKASKERLSKLEHDLNSLKQKQKELNDQWSREKDLMSRIRSIKEEIDRVNLEMEAAERDYDLNRAAELKYGTMISLQRQLEEAEKNLSEFQKSGHSLLREEVTDLDIAEIVSKwtgiplsslqqSEREKLVMLEEVLHKRVIGQDIAVKSVADAIRRsraglsdparpiasfmfmgptgvgkTELGKALADFLFNTENALVRIDmseymekhsvsrlvgappgyvgyeeggqltevvrrrpysvvLFDEIEKAHQDVFNILLQLLddgritdsqgrtvSFTNCVVIMTSNIGSHYILETLQSVQDSKEAVYEVMKKQVVELARQTFRPEFLNRIDeyivfqpldskEISKIVEIQMNRVKDRLKQKKIDLHYTKEAVTLLGilgfdpnfgarpVKRVIQQLVENEIAVAILKgdikeedsviidvddspsakdlpprnklcikklesSSSIDAMVAND
MASRRLTKTTFAALKSARHNKLslaqsgsraksistftnfsnslsrppIENKLILPPNDVVSAKLSFTTVGFArkfhsstplrssttgvsqitptEFTEKAWEGIVGAVDAARVNNQQVVETEHLMKALLEQKDGLARRILTKAGQDNTKVLQATEdfiskqpkvtgatsgpivgsnFGLLLSNAQRIKKEMEDDFVSVEHLLLAFLSDDRFGRLLFNDIRLNEKDLKDAVKavrghqrvtdqnpegkyQALEKYGNDltelarsgkldpvigrddeIRRCIQilsrrtknnpviigepgvGKTAIAEGLaqrivrgdvpetLQNRKLISLDMASLVAGTCYRGDFEKRLKAVLKEVTKSNGQIILFIDELHTIIGAGNQSGAMDASNMLKPMLGRGELRCIGATTLNEYRNYIEKDPALERRFQQVFCDQPSVENTISILRGLRERYELHHgvkisdsalvSAAVLADRYITerflpdkaiDLVDEAAAKLKmeitskpieldeIDRAVLKLEMEklslkndtdkaSKERLSKLEhdlnslkqkqkelndqwsrekdlmsrirsikeeidrvnlemeaaerdydlnRAAELKYGTMISLQRQLEEAEKNLSEFQKSGHSLLREEVTDLDIAEIVSKWtgiplsslqqsEREKLVMLEEVLHkrvigqdiavksVADAIRRsraglsdparpiASFMFMGPTGVGKTELGKALADFLFNTENALVRIDMSEYMEKHSVSRLVGAPPGYVGYEEGGQLTEVVRRRPYSVVLFDEIEKAHQDVFNILLQLLDDGRITDSQGRTVSFTNCVVIMTSNIGSHYILETLQSVQDSKEAVYEVMKKQVVELARQtfrpeflnrideyivfqpldskeISKIVEIQMNRVKDRLKQKKIDLHYTKEAVTLLGILGFDPNFGARPVKRVIQQLVENEIAVAilkgdikeedsviidvddspsakdlpprnklcikklessssidamvand
MASRRLTKTTFAALKSARHNKLSLAQSGSRAKSISTFTNFSNSLSRPPIENKLILPPNDVVSAKLSFTTVGFARKFHSSTPLRSSTTGVSQITPTEFTEKAWEGIVGAVDAARVNNQQVVETEHLMKALLEQKDGLARRILTKAGQDNTKVLQATEDFISKQPKVTGATSGPIVGSNFGLLLSNAQRIKKEMEDDFVSVEHLLLAFLSDDRFGRLLFNDIRLNEKDLKDAVKAVRGHQRVTDQNPEGKYQALEKYGNDLTELARSGKLDPVIGRDDEIRRCIQILSRRTKNNPVIIGEPGVGKTAIAEGLAQRIVRGDVPETLQNRKLISLDMASLVAGTCYRGDFEKRLKAVLKEVTKSNGQIILFIDELHTIIGAGNQSGAMDASNMLKPMLGRGELRCIGATTLNEYRNYIEKDPALERRFQQVFCDQPSVENTISILRGLRERYELHHGVKIsdsalvsaavladRYITERFLPDKAIDLVDEAAAKLKMEITSKPIELDEIDRAVLKLEMEKLSLKNDTDKASKERLSKLEHDLNSLKQKQKELNDQWSREKDLMSRIRSIKEEIDRVNLEMEAAERDYDLNRAAELKYGTMISLQRQLEEAEKNLSEFQKSGHSLLREEVTDLDIAEIVSKWTGIPLSSLQQSEREKLVMLEEVLHKRVIGQDIAVKSVADAIRRSRAGLSDPARPIASFMFMGPTGVGKTELGKALADFLFNTENALVRIDMSEYMEKHSVSRLVGAPPGYVGYEEGGQLTEVVRRRPYSVVLFDEIEKAHQDVFNILLQLLDDGRITDSQGRTVSFTNCVVIMTSNIGSHYILETLQSVQDSKEAVYEVMKKQVVELARQTFRPEFLNRIDEYIVFQPLDSKEISKIVEIQMNRVKDRLKQKKIDLHYTKEAVTLLGILGFDPNFGARPVKRVIQQLVENEIAVAILKGDIKeedsviidvddsPSAKDLPPRNKLCIKKLESSSSIDAMVAND
***************************************************KLILPPNDVVSAKLSFTTVGFARKFH*************QITPTEFTEKAWEGIVGAVDAARVNNQQVVETEHLMKALLEQKDGLARRILTKAGQ*NTKVLQATEDFI******TGATSGPIVGSNFGLLLSNAQRIKKEMEDDFVSVEHLLLAFLSDDRFGRLLFNDIRLNEKDLKDAVKAV********************YGNDLTELARSGKLDPVIGRDDEIRRCIQILSRRTKNNPVIIGEPGVGKTAIAEGLAQRIVRGDVPETLQNRKLISLDMASLVAGTCYRGDFEKRLKAVLKEVTKSNGQIILFIDELHTIIGAGNQS******NMLKPMLGRGELRCIGATTLNEYRNYIEKDPALERRFQQVFCDQPSVENTISILRGLRERYELHHGVKISDSALVSAAVLADRYITERFLPDKAIDLVDEAAAKLKMEITSKPIELDEIDRAVLK************************************************************************DLNRAAELKYGTMI***********************LREEVTDLDIAEIVSKWTGIPLSSLQ***REKLVMLEEVLHKRVIGQDIAVKSVADAIRRS*******ARPIASFMFMGPTGVGKTELGKALADFLFNTENALVRIDMSEYMEKHSVSRLVGAPPGYVGYEEGGQLTEVVRRRPYSVVLFDEIEKAHQDVFNILLQLLDDGRITDSQGRTVSFTNCVVIMTSNIGSHYILETLQSVQDSKEAVYEVMKKQVVELARQTFRPEFLNRIDEYIVFQPLDSKEISKIVEIQMNRVKDRLKQKKIDLHYTKEAVTLLGILGFDPNFGARPVKRVIQQLVENEIAVAILKGDIKEEDSVIID**********************************
*******************************************************************************************ITPTEFTEKAWEGIVGAVDAARVNNQQVVETEHLMKALLEQKDGLARRILTKAGQDNTKVLQATEDFISK**************SNFGLLLSNAQRIKKEMEDDFVSVEHLLLAFLSDDRFGRLLFNDIRLNEKDLKDAVKAVRG***********KYQALEKYGNDLTELARSGKLDPVIGRDDEIRRCIQILSRRTKNNPVIIGEPGVGKTAIAEGLAQRIVRGDVPETLQNRKLISLDMASLVAGTCYRGDFEKRLKAVLKEVTKSNGQIILFIDELHTIIGAGNQSGAMDASNMLKPMLGRGELRCIGATTLNEYRNYIEKDPALERRFQQVFCDQPSVENTISILRGLRERYELHHGVKISDSALVSAAVLADRYITERFLPDKAIDLVDEAAAKLKMEITSKPIELDEIDRAVLKLEMEK******************E*********************************IDRVNLEMEAAERDYDLNRAAELKYGTMISLQR**********************EVTDLDIAEIVSKWTGIPLSSLQQSEREKLVMLEEVLHKRVIGQDIAVKSVADAIRRSRAGLSDPARPIASFMFMGPTGVGKTELGKALADFLFNTENALVRIDMSEYMEKHSVSRLVGAPPGYVGYEEGGQLTEVVRRRPYSVVLFDEIEKAHQDVFNILLQLLDDGRITDSQGRTVSFTNCVVIMTSNIGSHYILET*************VMKKQVVELARQTFRPEFLNRIDEYIVFQPLDSKEISKIVEIQMNRVKDRLKQKKIDLHYTKEAVTLLGILGFDPNFGARPVKRVIQQLVENEIAVAILKGDIKEEDSVIIDVDDSPSAKDLPPR*********************
********TTFAALKSA***************SISTFTNFSNSLSRPPIENKLILPPNDVVSAKLSFTTVGFARKFH**************ITPTEFTEKAWEGIVGAVDAARVNNQQVVETEHLMKALLEQKDGLARRILTKAGQDNTKVLQATEDFISKQPKVTGATSGPIVGSNFGLLLSNAQRIKKEMEDDFVSVEHLLLAFLSDDRFGRLLFNDIRLNEKDLKDAVKAVRGHQRVTDQNPEGKYQALEKYGNDLTELARSGKLDPVIGRDDEIRRCIQILSRRTKNNPVIIGEPGVGKTAIAEGLAQRIVRGDVPETLQNRKLISLDMASLVAGTCYRGDFEKRLKAVLKEVTKSNGQIILFIDELHTIIGAGNQSGAMDASNMLKPMLGRGELRCIGATTLNEYRNYIEKDPALERRFQQVFCDQPSVENTISILRGLRERYELHHGVKISDSALVSAAVLADRYITERFLPDKAIDLVDEAAAKLKMEITSKPIELDEIDRAVLKLEMEKLSLKNDTDKASKERLSKLEHDLNSLKQKQKELNDQWSREKDLMSRIRSIKEEIDRVNLEMEAAERDYDLNRAAELKYGTMISLQRQLEEAEKNLSEFQKSGHSLLREEVTDLDIAEIVSKWTGIPLSSLQQSEREKLVMLEEVLHKRVIGQDIAVKSVADAIRRSRAGLSDPARPIASFMFMGPTGVGKTELGKALADFLFNTENALVRIDMSEYMEKHSVSRLVGAPPGYVGYEEGGQLTEVVRRRPYSVVLFDEIEKAHQDVFNILLQLLDDGRITDSQGRTVSFTNCVVIMTSNIGSHYILETLQSVQDSKEAVYEVMKKQVVELARQTFRPEFLNRIDEYIVFQPLDSKEISKIVEIQMNRVKDRLKQKKIDLHYTKEAVTLLGILGFDPNFGARPVKRVIQQLVENEIAVAILKGDIKEEDSVIIDVDDSPSAKDLPPRNKLCIKKLESSSSIDAMVAND
**********************************************************************GFARKFHSSTPLRSSTTGVSQITPTEFTEKAWEGIVGAVDAARVNNQQVVETEHLMKALLEQKDGLARRILTKAGQDNTKVLQATEDFISKQPKVTGATSGPIVGSNFGLLLSNAQRIKKEMEDDFVSVEHLLLAFLSDDRFGRLLFNDIRLNEKDLKDAVKAVRGHQRVTDQNPEGKYQALEKYGNDLTELARSGKLDPVIGRDDEIRRCIQILSRRTKNNPVIIGEPGVGKTAIAEGLAQRIVRGDVPETLQNRKLISLDMASLVAGTCYRGDFEKRLKAVLKEVTKSNGQIILFIDELHTIIGAGNQSGAMDASNMLKPMLGRGELRCIGATTLNEYRNYIEKDPALERRFQQVFCDQPSVENTISILRGLRERYELHHGVKISDSALVSAAVLADRYITERFLPDKAIDLVDEAAAKLKMEITSKPIELDEIDRAVLKLEMEKLSLKNDTDKASKERLSKLEHDLNSLKQKQKELNDQWSREKDLMSRIRSIKEEIDRVNLEMEAAERDYDLNRAAELKYGTMISLQRQLEEAEKNLSEFQKSGHSLLREEVTDLDIAEIVSKWTGIPLSSLQQSEREKLVMLEEVLHKRVIGQDIAVKSVADAIRRSRAGLSDPARPIASFMFMGPTGVGKTELGKALADFLFNTENALVRIDMSEYMEKHSVSRLVGAPPGYVGYEEGGQLTEVVRRRPYSVVLFDEIEKAHQDVFNILLQLLDDGRITDSQGRTVSFTNCVVIMTSNIGSHYILETLQSVQDSKEAVYEVMKKQVVELARQTFRPEFLNRIDEYIVFQPLDSKEISKIVEIQMNRVKDRLKQKKIDLHYTKEAVTLLGILGFDPNFGARPVKRVIQQLVENEIAVAILKGDIKEEDSVIIDVDDSPSAKDLPPRNKLCIKKLES***********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASRRLTKTTFAALKSARHNKLSLAQSGSRAKSISTFTNFSNSLSRPPIENKLILPPNDVVSAKLSFTTVGFARKFHSSTPLRSSTTGVSQITPTEFTEKAWEGIVGAVDAARVNNQQVVETEHLMKALLEQKDGLARRILTKAGQDNTKVLQATEDFISKQPKVTGATSGPIVGSNFGLLLSNAQRIKKEMEDDFVSVEHLLLAFLSDDRFGRLLFNDIRLNEKDLKDAVKAVRGHQRVTDQNPEGKYQALEKYGNDLTELARSGKLDPVIGRDDEIRRCIQILSRRTKNNPVIIGEPGVGKTAIAEGLAQRIVRGDVPETLQNRKLISLDMASLVAGTCYRGDFEKRLKAVLKEVTKSNGQIILFIDELHTIIGAGNQSGAMDASNMLKPMLGRGELRCIGATTLNEYRNYIEKDPALERRFQQVFCDQPSVENTISILRGLRERYELHHGVKISDSALVSAAVLADRYITERFLPDKAIDLVDEAAAKLKMEITSKPIExxxxxxxxxxxxxxxxxxxxxTxxxxxxxxxxxxxxxxxxxxxxxxxxxxWSRxxxxxxxxxxxxxxxxxxxxxxxxxxxxYDLNRAAELKYGTxxxxxxxxxxxxxxxxxxxxxxxxxxxxEVTDLDIAEIVSKWTGIPLSSLQQSEREKLVMLEEVLHKRVIGQDIAVKSVADAIRRSRAGLSDPARPIASFMFMGPTGVGKTELGKALADFLFNTENALVRIDMSEYMEKHSVSRLVGAPPGYVGYEEGGQLTEVVRRRPYSVVLFDEIEKAHQDVFNILLQLLDDGRITDSQGRTVSFTNCVVIMTSNIGSHYILETLQSVQDSKEAVYEVMKKQVVELARQTFRPEFLNRIDEYIVFQPLDSKEISKIVEIQMNRVKDRLKQKKIDLHYTKEAVTLLGILGFDPNFGARPVKRVIQQLVENEIAVAILKGDIKEEDSVIIDVDDSPSAKDLPPRNKLCIKKLESSSSIDAMVAND
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query982 2.2.26 [Sep-21-2011]
Q8VYJ7964 Chaperone protein ClpB4, yes no 0.981 1.0 0.755 0.0
Q0E3C8983 Chaperone protein ClpB3, yes no 0.921 0.920 0.787 0.0
Q9LF37968 Chaperone protein ClpB3, no no 0.953 0.966 0.667 0.0
Q75GT3978 Chaperone protein ClpB2, no no 0.899 0.902 0.688 0.0
Q8YM56872 Chaperone protein ClpB 2 yes no 0.865 0.974 0.657 0.0
P53533874 Chaperone protein ClpB 1 yes no 0.867 0.974 0.643 0.0
Q8DJ40871 Chaperone protein ClpB 1 yes no 0.864 0.974 0.654 0.0
Q7NFE9872 Chaperone protein ClpB OS yes no 0.869 0.979 0.637 0.0
P74361872 Chaperone protein ClpB 2 N/A no 0.867 0.977 0.631 0.0
O87444873 Chaperone protein ClpB OS N/A no 0.863 0.971 0.641 0.0
>sp|Q8VYJ7|CLPB4_ARATH Chaperone protein ClpB4, mitochondrial OS=Arabidopsis thaliana GN=CLPB4 PE=1 SV=1 Back     alignment and function desciption
 Score = 1481 bits (3834), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 740/980 (75%), Positives = 831/980 (84%), Gaps = 16/980 (1%)

Query: 1   MASRRLTKTTFAALKSARHNKLSLAQSGSRAKSISTFTNFSNSLSRPPIENKLILPPNDV 60
           MA RRL+K+  +A+K+          S        + +    S+ RP   N  I   N+ 
Sbjct: 1   MALRRLSKSVSSAIKA---QYTLSRPSPLLRSRSLSSSPHYTSIGRPT--NSFIGKINN- 54

Query: 61  VSAKLSFTTVGFARKFHSSTPLRSSTTGVSQITPTEFTEKAWEGIVGAVDAARVNNQQVV 120
             + ++  T    + F  S+P R  TT  +Q+   EFTE AWEG++ A DAAR + QQ+V
Sbjct: 55  --SSITHATTTHGQLFPLSSPRRFCTT-TAQVNQNEFTEMAWEGLINAFDAARESKQQIV 111

Query: 121 ETEHLMKALLEQKDGLARRILTKAGQDNTKVLQATEDFISKQPKVTGATSGPIVGSNFGL 180
           E+EHLMKALLEQKDG+AR+I TKAG DN+ VLQAT+ FISKQP V+ A SG  +GS+  +
Sbjct: 112 ESEHLMKALLEQKDGMARKIFTKAGIDNSSVLQATDLFISKQPTVSDA-SGQRLGSSLSV 170

Query: 181 LLSNAQRIKKEMEDDFVSVEHLLLAFLSDDRFGRLLFNDIRLNEKDLKDAVKAVRGHQRV 240
           +L NA+R KK+M D +VSVEH LLA+ SD RFG+  F D++L+ + LKDA+K VRG QRV
Sbjct: 171 ILENAKRHKKDMLDSYVSVEHFLLAYYSDTRFGQEFFRDMKLDIQVLKDAIKDVRGDQRV 230

Query: 241 TDQNPEGKYQALEKYGNDLTELARSGKLDPVIGRDDEIRRCIQILSRRTKNNPVIIGEPG 300
           TD+NPE KYQALEKYGNDLTE+AR GKLDPVIGRDDEIRRCIQIL RRTKNNPVIIGEPG
Sbjct: 231 TDRNPESKYQALEKYGNDLTEMARRGKLDPVIGRDDEIRRCIQILCRRTKNNPVIIGEPG 290

Query: 301 VGKTAIAEGLAQRIVRGDVPETLQNRKLISLDMASLVAGTCYRGDFEKRLKAVLKEVTKS 360
           VGKTAIAEGLAQRIVRGDVPE L NRKLISLDM SL+AG  +RGDFE+RLKAV+KEV+ S
Sbjct: 291 VGKTAIAEGLAQRIVRGDVPEPLMNRKLISLDMGSLLAGAKFRGDFEERLKAVMKEVSAS 350

Query: 361 NGQIILFIDELHTIIGAGNQSGAMDASNMLKPMLGRGELRCIGATTLNEYRNYIEKDPAL 420
           NGQ ILFIDE+HT++GAG   GAMDASN+LKPMLGRGELRCIGATTL EYR YIEKDPAL
Sbjct: 351 NGQTILFIDEIHTVVGAGAMDGAMDASNLLKPMLGRGELRCIGATTLTEYRKYIEKDPAL 410

Query: 421 ERRFQQVFCDQPSVENTISILRGLRERYELHHGVKISDSALVSAAVLADRYITERFLPDK 480
           ERRFQQV C QPSVE+TISILRGLRERYELHHGV ISDSALVSAAVLADRYITERFLPDK
Sbjct: 411 ERRFQQVLCVQPSVEDTISILRGLRERYELHHGVTISDSALVSAAVLADRYITERFLPDK 470

Query: 481 AIDLVDEAAAKLKMEITSKPIELDEIDRAVLKLEMEKLSLKNDTDKASKERLSKLEHDLN 540
           AIDLVDEA AKLKMEITSKP ELD IDRAV+KLEMEKLSLKNDTDKASKERL K+E+DL+
Sbjct: 471 AIDLVDEAGAKLKMEITSKPTELDGIDRAVIKLEMEKLSLKNDTDKASKERLQKIENDLS 530

Query: 541 SLKQKQKELNDQWSREKDLMSRIRSIKEEIDRVNLEMEAAERDYDLNRAAELKYGTMISL 600
           +LKQKQKELN QW +EK LM++IRS KEEIDRVNLE+E+AER+YDLNRAAELKYGT++SL
Sbjct: 531 TLKQKQKELNVQWEKEKSLMTKIRSFKEEIDRVNLEIESAEREYDLNRAAELKYGTLLSL 590

Query: 601 QRQLEEAEKNLSEFQKSGHSLLREEVTDLDIAEIVSKWTGIPLSSLQQSEREKLVMLEEV 660
           QRQLEEAEKNL+ F++ G SLLRE VTDLDIAEIVSKWTGIPLS+LQQSEREKLVMLEEV
Sbjct: 591 QRQLEEAEKNLTNFRQFGQSLLREVVTDLDIAEIVSKWTGIPLSNLQQSEREKLVMLEEV 650

Query: 661 LHKRVIGQDIAVKSVADAIRRSRAGLSDPARPIASFMFMGPTGVGKTELGKALADFLFNT 720
           LH RVIGQD+AVKSVADAIRRSRAGLSDP RPIASFMFMGPTGVGKTEL KALA +LFNT
Sbjct: 651 LHHRVIGQDMAVKSVADAIRRSRAGLSDPNRPIASFMFMGPTGVGKTELAKALAGYLFNT 710

Query: 721 ENALVRIDMSEYMEKHSVSRLVGAPPGYVGYEEGGQLTEVVRRRPYSVVLFDEIEKAHQD 780
           ENA+VR+DMSEYMEKHSVSRLVGAPPGYVGYEEGGQLTEVVRRRPYSVVLFDEIEKAH D
Sbjct: 711 ENAIVRVDMSEYMEKHSVSRLVGAPPGYVGYEEGGQLTEVVRRRPYSVVLFDEIEKAHPD 770

Query: 781 VFNILLQLLDDGRITDSQGRTVSFTNCVVIMTSNIGSHYILETLQSVQDSKEAVYEVMKK 840
           VFNILLQLLDDGRITDSQGRTVSF NCVVIMTSNIGSH+ILETL++ +DSKEAVYE+MK+
Sbjct: 771 VFNILLQLLDDGRITDSQGRTVSFKNCVVIMTSNIGSHHILETLRNNEDSKEAVYEIMKR 830

Query: 841 QVVELARQTFRPEFLNRIDEYIVFQPLDSKEISKIVEIQMNRVKDRLKQKKIDLHYTKEA 900
           QVVELARQ FRPEF+NRIDEYIVFQPLDS EISKIVE+QM RVK+ L+QKKI L YTKEA
Sbjct: 831 QVVELARQNFRPEFMNRIDEYIVFQPLDSNEISKIVELQMRRVKNSLEQKKIKLQYTKEA 890

Query: 901 VTLLGILGFDPNFGARPVKRVIQQLVENEIAVAILKGDIKEEDSVIIDVDDSPSAKDLPP 960
           V LL  LGFDPN+GARPVKRVIQQ+VENEIAV ILKGD  EED+V++DVD       L  
Sbjct: 891 VDLLAQLGFDPNYGARPVKRVIQQMVENEIAVGILKGDFAEEDTVLVDVD------HLAS 944

Query: 961 RNKLCIKKLESSSSIDAMVA 980
            NKL IKKLES++S + M A
Sbjct: 945 DNKLVIKKLESNASAEEMAA 964
Molecular chaperone that does not seem to be involved in heat stress response or tolerance.
Arabidopsis thaliana (taxid: 3702)
>sp|Q0E3C8|CLPB3_ORYSJ Chaperone protein ClpB3, mitochondrial OS=Oryza sativa subsp. japonica GN=CLPB3 PE=2 SV=3 Back     alignment and function description
>sp|Q9LF37|CLPB3_ARATH Chaperone protein ClpB3, chloroplastic OS=Arabidopsis thaliana GN=CLPB3 PE=1 SV=1 Back     alignment and function description
>sp|Q75GT3|CLPB2_ORYSJ Chaperone protein ClpB2, chloroplastic OS=Oryza sativa subsp. japonica GN=CLPB2 PE=2 SV=1 Back     alignment and function description
>sp|Q8YM56|CLPB2_NOSS1 Chaperone protein ClpB 2 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=clpB2 PE=3 SV=2 Back     alignment and function description
>sp|P53533|CLPB1_SYNE7 Chaperone protein ClpB 1 OS=Synechococcus elongatus (strain PCC 7942) GN=clpB1 PE=2 SV=3 Back     alignment and function description
>sp|Q8DJ40|CLPB1_THEEB Chaperone protein ClpB 1 OS=Thermosynechococcus elongatus (strain BP-1) GN=clpB1 PE=3 SV=1 Back     alignment and function description
>sp|Q7NFE9|CLPB_GLOVI Chaperone protein ClpB OS=Gloeobacter violaceus (strain PCC 7421) GN=clpB PE=3 SV=1 Back     alignment and function description
>sp|P74361|CLPB2_SYNY3 Chaperone protein ClpB 2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=clpB2 PE=3 SV=1 Back     alignment and function description
>sp|O87444|CLPB_PLEBO Chaperone protein ClpB OS=Plectonema boryanum GN=clpB PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query982
255548768976 chaperone clpb, putative [Ricinus commun 0.984 0.990 0.807 0.0
357466045980 Chaperone protein clpB [Medicago truncat 0.994 0.996 0.807 0.0
356507345974 PREDICTED: chaperone protein ClpB4, mito 0.987 0.995 0.803 0.0
449521860983 PREDICTED: chaperone protein ClpB4, mito 0.997 0.996 0.795 0.0
449455531983 PREDICTED: chaperone protein ClpB4, mito 0.997 0.996 0.793 0.0
225430366962 PREDICTED: chaperone protein ClpB4, mito 0.916 0.935 0.839 0.0
9651530977 ClpB [Phaseolus lunatus] 0.985 0.990 0.781 0.0
297825543972 predicted protein [Arabidopsis lyrata su 0.986 0.996 0.763 0.0
312282615970 unnamed protein product [Thellungiella h 0.981 0.993 0.758 0.0
224089350877 predicted protein [Populus trichocarpa] 0.892 0.998 0.835 0.0
>gi|255548768|ref|XP_002515440.1| chaperone clpb, putative [Ricinus communis] gi|223545384|gb|EEF46889.1| chaperone clpb, putative [Ricinus communis] Back     alignment and taxonomy information
 Score = 1616 bits (4185), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 800/991 (80%), Positives = 877/991 (88%), Gaps = 24/991 (2%)

Query: 1   MASRRLTKTTFAALKSA--RHNKLSLAQSGSRAKSISTFTN--FSNS-----LSRPPIEN 51
           MASRR TK+ FAA+KS+  R   LS A   + A S S+F +  F NS      SR  I  
Sbjct: 1   MASRRFTKSAFAAMKSSSLRRAPLSHATRATSASSSSSFPDNLFGNSANAQFFSRASING 60

Query: 52  KLILPPNDVVSAKLSFTTVGFARKFHSSTPLRSSTTGVSQITPTEFTEKAWEGIVGAVDA 111
            ++ P            T  F R FHSS+P  S++   SQ  P+E+TE AWEGIVGAVDA
Sbjct: 61  NVVFP------------TATFTRAFHSSSPRFSTSATSSQANPSEYTEMAWEGIVGAVDA 108

Query: 112 ARVNNQQVVETEHLMKALLEQKDGLARRILTKAGQDNTKVLQATEDFISKQPKVTGATSG 171
           AR + QQVVETEHLMK+LLEQKDGLARRI TKAG DNT VLQAT+DFIS QPKV G TSG
Sbjct: 109 ARASKQQVVETEHLMKSLLEQKDGLARRIFTKAGVDNTSVLQATDDFISHQPKVVGDTSG 168

Query: 172 PIVGSNFGLLLSNAQRIKKEMEDDFVSVEHLLLAFLSDDRFGRLLFNDIRLNEKDLKDAV 231
           PI+GS  G+LL NA++ KKEM DDFVSVEH +L+F  D RFG+ L   ++L+EKDLKDA+
Sbjct: 169 PIMGSYLGVLLDNARKHKKEMGDDFVSVEHFVLSFHLDKRFGQQLLKSLQLSEKDLKDAI 228

Query: 232 KAVRGHQRVTDQNPEGKYQALEKYGNDLTELARSGKLDPVIGRDDEIRRCIQILSRRTKN 291
           +AVRG QRV DQNPEGKY+AL+KYGNDLTELAR GKLDPVIGRDDEIRRCIQILSRRTKN
Sbjct: 229 QAVRGSQRVIDQNPEGKYEALDKYGNDLTELARRGKLDPVIGRDDEIRRCIQILSRRTKN 288

Query: 292 NPVIIGEPGVGKTAIAEGLAQRIVRGDVPETLQNRKLISLDMASLVAGTCYRGDFEKRLK 351
           NPVIIGEPGVGKTAIAEGLAQRIVRGDVPE L NRKLISLDM SLVAG  YRGDFE+RLK
Sbjct: 289 NPVIIGEPGVGKTAIAEGLAQRIVRGDVPEPLLNRKLISLDMGSLVAGAKYRGDFEERLK 348

Query: 352 AVLKEVTKSNGQIILFIDELHTIIGAGNQSGAMDASNMLKPMLGRGELRCIGATTLNEYR 411
           AVLKEVT SNGQIILFIDE+HT++GAG  +GAMDA N+LKPMLGRGELRCIGATTLNEYR
Sbjct: 349 AVLKEVTASNGQIILFIDEIHTVVGAGATTGAMDAGNLLKPMLGRGELRCIGATTLNEYR 408

Query: 412 NYIEKDPALERRFQQVFCDQPSVENTISILRGLRERYELHHGVKISDSALVSAAVLADRY 471
            YIEKDPALERRFQQVFCDQPSVE+TISILRGLRERYELHHGVKISDSALVSAA+LADRY
Sbjct: 409 KYIEKDPALERRFQQVFCDQPSVEDTISILRGLRERYELHHGVKISDSALVSAAILADRY 468

Query: 472 ITERFLPDKAIDLVDEAAAKLKMEITSKPIELDEIDRAVLKLEMEKLSLKNDTDKASKER 531
           ITERFLPDKAIDLVDEAAAKLKMEITSKP ELDEIDRAVLKLEMEKLSLKNDTDKASKER
Sbjct: 469 ITERFLPDKAIDLVDEAAAKLKMEITSKPTELDEIDRAVLKLEMEKLSLKNDTDKASKER 528

Query: 532 LSKLEHDLNSLKQKQKELNDQWSREKDLMSRIRSIKEEIDRVNLEMEAAERDYDLNRAAE 591
           LSKLE+DLN LKQKQKELN+QW REK LM+RIRSIKEEIDRVNLEMEAAERDY+LNRAAE
Sbjct: 529 LSKLENDLNELKQKQKELNEQWDREKALMTRIRSIKEEIDRVNLEMEAAERDYNLNRAAE 588

Query: 592 LKYGTMISLQRQLEEAEKNLSEFQKSGHSLLREEVTDLDIAEIVSKWTGIPLSSLQQSER 651
           LKYGT++SLQRQLEEAEKNL++F++SG S+LREEVTDLDIAEIVSKWTGIP+S+LQQSER
Sbjct: 589 LKYGTLMSLQRQLEEAEKNLADFRESGKSMLREEVTDLDIAEIVSKWTGIPVSNLQQSER 648

Query: 652 EKLVMLEEVLHKRVIGQDIAVKSVADAIRRSRAGLSDPARPIASFMFMGPTGVGKTELGK 711
           EKLV LE+VLHKRV+GQD+AVKSVADAIRRSRAGLSDP RPIASFMFMGPTGVGKTEL K
Sbjct: 649 EKLVFLEDVLHKRVVGQDMAVKSVADAIRRSRAGLSDPNRPIASFMFMGPTGVGKTELAK 708

Query: 712 ALADFLFNTENALVRIDMSEYMEKHSVSRLVGAPPGYVGYEEGGQLTEVVRRRPYSVVLF 771
           ALA +LFNTENA+VRIDMSEYMEKH+VSRLVGAPPGYVGYEEGGQLTEVVRRRPYSVVLF
Sbjct: 709 ALAGYLFNTENAMVRIDMSEYMEKHAVSRLVGAPPGYVGYEEGGQLTEVVRRRPYSVVLF 768

Query: 772 DEIEKAHQDVFNILLQLLDDGRITDSQGRTVSFTNCVVIMTSNIGSHYILETLQSVQDSK 831
           DEIEKAH DVFNILLQLLDDGRITDSQGRTVSFTNCVVIMTSNIGSH ILETL+S QDSK
Sbjct: 769 DEIEKAHHDVFNILLQLLDDGRITDSQGRTVSFTNCVVIMTSNIGSHLILETLRSTQDSK 828

Query: 832 EAVYEVMKKQVVELARQTFRPEFLNRIDEYIVFQPLDSKEISKIVEIQMNRVKDRLKQKK 891
           EAVY++MK+QVVELAR+TFRPEF+NRIDEYIVFQPLDSKEISKIVEIQMNRVK+RLKQKK
Sbjct: 829 EAVYDIMKRQVVELARKTFRPEFMNRIDEYIVFQPLDSKEISKIVEIQMNRVKERLKQKK 888

Query: 892 IDLHYTKEAVTLLGILGFDPNFGARPVKRVIQQLVENEIAVAILKGDIKEEDSVIIDVDD 951
           IDLHYTKEA+ LL  LGFDPNFGARPVKRVIQQLVENEIA+ +L+GD K+EDS+ ID D 
Sbjct: 889 IDLHYTKEAIDLLATLGFDPNFGARPVKRVIQQLVENEIAMGVLRGDFKDEDSIAIDADV 948

Query: 952 SPSAKDLPPRNKLCIKKLESSSSIDAMVAND 982
           S    DLPP+N+L ++KLE+SS ++AMVAND
Sbjct: 949 S---SDLPPQNRLRVRKLENSSPMEAMVAND 976

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|357466045|ref|XP_003603307.1| Chaperone protein clpB [Medicago truncatula] gi|355492355|gb|AES73558.1| Chaperone protein clpB [Medicago truncatula] Back     alignment and taxonomy information
>gi|356507345|ref|XP_003522428.1| PREDICTED: chaperone protein ClpB4, mitochondrial-like [Glycine max] Back     alignment and taxonomy information
>gi|449521860|ref|XP_004167947.1| PREDICTED: chaperone protein ClpB4, mitochondrial-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449455531|ref|XP_004145506.1| PREDICTED: chaperone protein ClpB4, mitochondrial-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|225430366|ref|XP_002282880.1| PREDICTED: chaperone protein ClpB4, mitochondrial [Vitis vinifera] gi|296082076|emb|CBI21081.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|9651530|gb|AAF91178.1|AF203700_1 ClpB [Phaseolus lunatus] Back     alignment and taxonomy information
>gi|297825543|ref|XP_002880654.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297326493|gb|EFH56913.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|312282615|dbj|BAJ34173.1| unnamed protein product [Thellungiella halophila] Back     alignment and taxonomy information
>gi|224089350|ref|XP_002308700.1| predicted protein [Populus trichocarpa] gi|222854676|gb|EEE92223.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query982
UNIPROTKB|Q0E3C8983 CLPB3 "Chaperone protein ClpB3 0.923 0.922 0.768 0.0
TAIR|locus:2040159964 CLPB4 "casein lytic proteinase 0.981 1.0 0.739 0.0
TAIR|locus:2180922968 CLPB3 "casein lytic proteinase 0.955 0.969 0.651 0.0
UNIPROTKB|Q75GT3978 CLPB2 "Chaperone protein ClpB2 0.898 0.901 0.675 0.0
TIGR_CMR|GSU_0658865 GSU_0658 "ClpB protein" [Geoba 0.851 0.966 0.548 3.8e-243
TIGR_CMR|BA_1177866 BA_1177 "ATP-dependent Clp pro 0.854 0.968 0.545 1.2e-241
GENEDB_PFALCIPARUM|PF08_00631070 PF08_0063 "ClpB protein, putat 0.442 0.406 0.555 3.3e-241
UNIPROTKB|Q8IB031070 PF08_0063 "ClpB protein, putat 0.442 0.406 0.555 3.3e-241
UNIPROTKB|Q9KU18857 clpB "Chaperone protein ClpB" 0.845 0.968 0.540 3.5e-233
TIGR_CMR|VC_0711857 VC_0711 "clpB protein" [Vibrio 0.845 0.968 0.540 3.5e-233
UNIPROTKB|Q0E3C8 CLPB3 "Chaperone protein ClpB3, mitochondrial" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
 Score = 3570 (1261.8 bits), Expect = 0., P = 0.
 Identities = 699/909 (76%), Positives = 794/909 (87%)

Query:    74 RKFHSSTPLRSSTTGVSQITPTEFTEKAWEGIVGAVDAARVNNQQVVETEHLMKALLEQK 133
             R FH +   R ST+  SQITP EFTE AWEG+VGAVDAAR++ QQVVE EHLMKALLEQK
Sbjct:    77 RLFHPTQAARYSTSSSSQITPGEFTEMAWEGVVGAVDAARMSKQQVVEAEHLMKALLEQK 136

Query:   134 DGLARRILTKAGQDNTKVLQATEDFISKQPKVTGATSGPIVGSNFGLLLSNAQRIKKEME 193
             DGLARRI +KAG DNT VLQAT++FIS+QPKV G TSGPI+GS+F  +L NA++ KKE  
Sbjct:   137 DGLARRIFSKAGIDNTSVLQATDEFISRQPKVVGDTSGPIIGSSFVSILDNARKHKKEYA 196

Query:   194 DDFVSVEHLLLAFLSDDRFGRLLFNDIRLNEKDLKDAVKAVRGHQRVTDQNPEGKYQALE 253
             D+FVSVEH+L AF  D RFG+ LF D+++ E +LK+A+ AVRG QRVTDQNPEGKYQALE
Sbjct:   197 DEFVSVEHILRAFTEDKRFGQQLFRDLKIGENELKEAISAVRGSQRVTDQNPEGKYQALE 256

Query:   254 KYGNDLTELARSGKLDPVIGRDDEIRRCIQILSRRTKNNPVIIGEPGVGKTAIAEGLAQR 313
             KYG D+TELAR GKLDPVIGRDDE+RRCIQIL RRTKNNPVIIGEPGVGKTAIAEGLAQR
Sbjct:   257 KYGIDMTELARRGKLDPVIGRDDEVRRCIQILCRRTKNNPVIIGEPGVGKTAIAEGLAQR 316

Query:   314 IVRGDVPETLQNRKLISLDMASLVAGTCYRGDFEKRLKAVLKEVTKSNGQIILFIDELHT 373
             IVRGDVPE LQNRKLISLDM +L+AG  ++G FE+RLKAVLKE+T SNGQIILFIDE+HT
Sbjct:   317 IVRGDVPEPLQNRKLISLDMGALLAGAKFQGQFEERLKAVLKEITASNGQIILFIDEIHT 376

Query:   374 IIGAGNQSGAMDASNMLKPMLGRGELRCIGATTLNEYRNYIEKDPALERRFQQVFCDQPS 433
             I+GAG   GAMDA N+LKPMLGRGELRCIGATTL+EYR YIEKD ALERRFQQV+C +P+
Sbjct:   377 IVGAGAAGGAMDAGNLLKPMLGRGELRCIGATTLDEYRKYIEKDAALERRFQQVYCGEPA 436

Query:   434 VENTISILRGLRERYELHHGVKIXXXXXXXXXXXXXRYITERFLPDKAIDLVDEAAAKLK 493
             VE+TISILRGLRERYELHHGVKI             RYIT RFLPDKAIDLVDEAAAKLK
Sbjct:   437 VEDTISILRGLRERYELHHGVKISDGALVSAAVLSDRYITGRFLPDKAIDLVDEAAAKLK 496

Query:   494 MEITSKPIELDEIDRAVLKLEMEKLSLKNDTDKASKERLSKLEHDLNSLKQKQKELNDQW 553
             MEITSKPIELDE+DR +++LEMEKLSLKNDTDKASK+RLSKLE DL SLKQKQK L++ W
Sbjct:   497 MEITSKPIELDEVDREIIRLEMEKLSLKNDTDKASKQRLSKLEADLESLKQKQKNLSEHW 556

Query:   554 SREKDLMSRIRSIKEEIDRVNLEMEAAERDYDLNRAAELKYGTMISLQRQLEEAEKNLSE 613
               EK LM+RIRSIKEE DRVNLE+EAAER+YDLNRAAELKYGT++SLQ+QLEEAE  L E
Sbjct:   557 EYEKSLMTRIRSIKEETDRVNLEIEAAEREYDLNRAAELKYGTLLSLQKQLEEAENKLME 616

Query:   614 FQKSGHSLLREEVTDLDIAEIVSKWTGIPLSSLQQSEREKLVMLEEVLHKRVIGQDIAVK 673
             FQ+SG S+LREEVTD+DIAEIVSKWTGIP+S+LQQSE+EKL++LE+VLHKRVIGQDIAVK
Sbjct:   617 FQQSGKSMLREEVTDVDIAEIVSKWTGIPVSNLQQSEKEKLLLLEDVLHKRVIGQDIAVK 676

Query:   674 SVADAIRRSRAGLSDPARPIASFMFMGPTGVGKTELGKALADFLFNTENALVRIDMSEYM 733
             SVA+AIRRSRAGLSDP RPIAS MFMGPTGVGKTELGK LA+FLFNTENAL+RIDMSEYM
Sbjct:   677 SVANAIRRSRAGLSDPNRPIASLMFMGPTGVGKTELGKTLAEFLFNTENALIRIDMSEYM 736

Query:   734 EKHSVSRLVGAPPGYVGYEEGGQLTEVVRRRPYSVVLFDEIEKAHQDVFNILLQLLDDGR 793
             EKH+VSRLVGAPPGY+GY EGGQLTE VRRRPYSVVLFDEIEKAHQDVFNILLQLLDDGR
Sbjct:   737 EKHAVSRLVGAPPGYIGYGEGGQLTEAVRRRPYSVVLFDEIEKAHQDVFNILLQLLDDGR 796

Query:   794 ITDSQGRTVSFTNCVVIMTSNIGSHYILETLQSVQDSKEAVYEVMKKQVVELARQTFRPE 853
             ITDSQGRTVSFTNCV+IMTSNIGS  IL+TL++  DSKEAVYE+MKKQV+++ARQ+FRPE
Sbjct:   797 ITDSQGRTVSFTNCVIIMTSNIGSPLILDTLRNTSDSKEAVYEIMKKQVIDMARQSFRPE 856

Query:   854 FLNRIDEYIVFQPLDSKEISKIVEIQMNRVKDRLKQKKIDLHYTKEAVTLLGILGFDPNF 913
             FLNRIDEYIVFQPLD+ EI++IVEIQ+NRVK+RL+Q+KI L YT EAV  LG LGFDPN+
Sbjct:   857 FLNRIDEYIVFQPLDTTEINRIVEIQLNRVKNRLRQQKIHLQYTPEAVEHLGSLGFDPNY 916

Query:   914 GARPVKRVIQQLVENEIAVAILKGDIKXXXXXXXXXXXXPSAKDLPPRNKLCIKKLESSS 973
             GARPVKRVIQQ+VENEIA+++LKGD K              AK L P+ KL +++LE+++
Sbjct:   917 GARPVKRVIQQMVENEIALSVLKGDFKEDDTVLVDVSSVAIAKGLAPQKKLVLQRLENAN 976

Query:   974 SIDAMVAND 982
                 +VAND
Sbjct:   977 L--ELVAND 983
GO:0005739 "mitochondrion" evidence=IDA
TAIR|locus:2040159 CLPB4 "casein lytic proteinase B4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2180922 CLPB3 "casein lytic proteinase B3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q75GT3 CLPB2 "Chaperone protein ClpB2, chloroplastic" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_0658 GSU_0658 "ClpB protein" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
TIGR_CMR|BA_1177 BA_1177 "ATP-dependent Clp protease, ATP-binding subunit ClpB" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
GENEDB_PFALCIPARUM|PF08_0063 PF08_0063 "ClpB protein, putative" [Plasmodium falciparum (taxid:5833)] Back     alignment and assigned GO terms
UNIPROTKB|Q8IB03 PF08_0063 "ClpB protein, putative" [Plasmodium falciparum 3D7 (taxid:36329)] Back     alignment and assigned GO terms
UNIPROTKB|Q9KU18 clpB "Chaperone protein ClpB" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms
TIGR_CMR|VC_0711 VC_0711 "clpB protein" [Vibrio cholerae O1 biovar El Tor (taxid:686)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8FM94CLPB_COREFNo assigned EC number0.52190.85530.9859yesno
Q72AW6CLPB_DESVHNo assigned EC number0.55550.85840.9745yesno
Q6MIV0CLPB_BDEBANo assigned EC number0.53310.86350.9918yesno
Q898C7CLPB_CLOTENo assigned EC number0.53310.84520.9595yesno
Q89YY3CLPB_BACTNNo assigned EC number0.53220.86150.9814yesno
Q8DEV2CLPB_VIBVUNo assigned EC number0.54440.84820.9719yesno
Q7MVE7CLPB_PORGINo assigned EC number0.52620.86550.9849yesno
Q74FF1CLPB_GEOSLNo assigned EC number0.55050.86450.9815yesno
Q7V8B1CLPB_PROMMNo assigned EC number0.61780.86960.9872yesno
Q81TT4CLPB_BACANNo assigned EC number0.54880.86760.9838yesno
Q7VNH1CLPB_HAEDUNo assigned EC number0.52850.86150.9883yesno
O83110CLPB_TREPANo assigned EC number0.54200.86250.9646yesno
Q929G7CLPB_LISINNo assigned EC number0.53060.85740.9722yesno
P74361CLPB2_SYNY3No assigned EC number0.63170.86760.9770N/Ano
P74459CLPB1_SYNY3No assigned EC number0.59100.86860.9498N/Ano
Q7NFE9CLPB_GLOVINo assigned EC number0.63790.86960.9793yesno
Q9CKC0CLPB_PASMUNo assigned EC number0.53850.85940.9871yesno
Q97KG0CLPB_CLOABNo assigned EC number0.54250.84920.9641yesno
P63288CLPB_MYCTUNo assigned EC number0.53820.82680.9575yesno
Q7U637CLPB1_SYNPXNo assigned EC number0.61090.87060.9918yesno
Q8YM56CLPB2_NOSS1No assigned EC number0.65770.86550.9747yesno
Q8VYJ7CLPB4_ARATHNo assigned EC number0.75510.98161.0yesno
Q72IK9CLPB_THET2No assigned EC number0.55950.86150.9906yesno
Q81GM5CLPB_BACCRNo assigned EC number0.55330.86550.9815yesno
Q7VBL0CLPB_PROMANo assigned EC number0.56010.86760.9861yesno
P63287CLPB_MYCBONo assigned EC number0.53820.82680.9575yesno
Q7AMH5CLPB_SALTINo assigned EC number0.53730.84820.9719N/Ano
Q9KU18CLPB_VIBCHNo assigned EC number0.53850.86150.9871yesno
Q7X2S8CLPB_MEIRUNo assigned EC number0.53970.83910.9648yesno
Q8Y570CLPB_LISMONo assigned EC number0.53340.85640.9711yesno
Q73T66CLPB_MYCPANo assigned EC number0.53700.82680.9575N/Ano
Q8RHQ8CLPB_FUSNNNo assigned EC number0.52580.85740.9824yesno
Q73BY1CLPB_BACC1No assigned EC number0.54760.86760.9838yesno
Q73K92CLPB_TREDENo assigned EC number0.54980.85740.9802yesno
O87444CLPB_PLEBONo assigned EC number0.64170.86350.9713N/Ano
P53532CLPB_CORGLNo assigned EC number0.51610.85530.9859yesno
P53533CLPB1_SYNE7No assigned EC number0.64330.86760.9748yesno
Q8DJ40CLPB1_THEEBNo assigned EC number0.65420.86450.9747yesno
Q0E3C8CLPB3_ORYSJNo assigned EC number0.78720.92150.9206yesno
Q7MNK1CLPB_VIBVYNo assigned EC number0.54440.84820.9719yesno
Q826F2CLPB2_STRAWNo assigned EC number0.55520.86450.9658yesno
Q9RA63CLPB_THET8No assigned EC number0.55720.86150.9906yesno
G2K265CLPB_LISM4No assigned EC number0.53340.85640.9711yesno
Q87S63CLPB_VIBPANo assigned EC number0.54380.84720.9708yesno
Q7CQ01CLPB_SALTYNo assigned EC number0.53730.84820.9719yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query982
TIGR03346852 TIGR03346, chaperone_ClpB, ATP-dependent chaperone 0.0
COG0542786 COG0542, clpA, ATP-binding subunits of Clp proteas 0.0
PRK10865857 PRK10865, PRK10865, protein disaggregation chapero 0.0
CHL00095821 CHL00095, clpC, Clp protease ATP binding subunit 0.0
TIGR03345852 TIGR03345, VI_ClpV1, type VI secretion ATPase, Clp 0.0
TIGR02639730 TIGR02639, ClpA, ATP-dependent Clp protease ATP-bi 1e-124
TIGR02639730 TIGR02639, ClpA, ATP-dependent Clp protease ATP-bi 1e-107
PRK11034758 PRK11034, clpA, ATP-dependent Clp protease ATP-bin 9e-90
pfam07724168 pfam07724, AAA_2, AAA domain (Cdc48 subfamily) 2e-89
PRK11034758 PRK11034, clpA, ATP-dependent Clp protease ATP-bin 4e-73
pfam1043181 pfam10431, ClpB_D2-small, C-terminal, D2-small dom 6e-25
smart0108690 smart01086, ClpB_D2-small, C-terminal, D2-small do 1e-24
cd00009151 cd00009, AAA, The AAA+ (ATPases Associated with a 2e-22
cd00009151 cd00009, AAA, The AAA+ (ATPases Associated with a 8e-17
pfam00004131 pfam00004, AAA, ATPase family associated with vari 9e-15
smart00382148 smart00382, AAA, ATPases associated with a variety 6e-13
pfam0286153 pfam02861, Clp_N, Clp amino terminal domain 4e-10
pfam07728135 pfam07728, AAA_5, AAA domain (dynein-related subfa 8e-10
pfam0286153 pfam02861, Clp_N, Clp amino terminal domain 2e-08
COG0714329 COG0714, COG0714, MoxR-like ATPases [General funct 8e-08
pfam00004131 pfam00004, AAA, ATPase family associated with vari 3e-06
COG0464494 COG0464, SpoVK, ATPases of the AAA+ class [Posttra 3e-06
smart00382148 smart00382, AAA, ATPases associated with a variety 4e-06
pfam13401124 pfam13401, AAA_22, AAA domain 2e-05
pfam13191154 pfam13191, AAA_16, AAA ATPase domain 2e-05
COG11961163 COG1196, Smc, Chromosome segregation ATPases [Cell 1e-04
pfam07728135 pfam07728, AAA_5, AAA domain (dynein-related subfa 2e-04
COG2256436 COG2256, MGS1, ATPase related to the helicase subu 2e-04
TIGR021691164 TIGR02169, SMC_prok_A, chromosome segregation prot 5e-04
TIGR03922557 TIGR03922, T7SS_EccA, type VII secretion AAA-ATPas 7e-04
PRK13341725 PRK13341, PRK13341, recombination factor protein R 8e-04
COG11961163 COG1196, Smc, Chromosome segregation ATPases [Cell 9e-04
pfam13401124 pfam13401, AAA_22, AAA domain 0.001
COG5271 4600 COG5271, MDN1, AAA ATPase containing von Willebran 0.001
PRK12704520 PRK12704, PRK12704, phosphodiesterase; Provisional 0.002
TIGR00382413 TIGR00382, clpX, endopeptidase Clp ATP-binding reg 0.002
TIGR00390 441 TIGR00390, hslU, ATP-dependent protease HslVU, ATP 0.002
COG1220 444 COG1220, HslU, ATP-dependent protease HslVU (ClpYQ 0.003
PRK13342413 PRK13342, PRK13342, recombination factor protein R 0.003
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 0.004
COG0419 908 COG0419, SbcC, ATPase involved in DNA repair [DNA 0.004
COG1579239 COG1579, COG1579, Zn-ribbon protein, possibly nucl 0.004
TIGR01243733 TIGR01243, CDC48, AAA family ATPase, CDC48 subfami 0.004
>gnl|CDD|234173 TIGR03346, chaperone_ClpB, ATP-dependent chaperone ClpB Back     alignment and domain information 
 Score = 1340 bits (3470), Expect = 0.0
 Identities = 517/855 (60%), Positives = 662/855 (77%), Gaps = 8/855 (0%)

Query: 97  FTEKAWEGIVGAVDAARVNNQQVVETEHLMKALLEQKDGLARRILTKAGQDNTKVLQATE 156
           FTEK  E +  A   A   + Q +E EHL+KALL+Q+ GLARR+L KAG +   + QA E
Sbjct: 1   FTEKFQEALQAAQSLALGRDHQQIEPEHLLKALLDQEGGLARRLLQKAGVNVGALRQALE 60

Query: 157 DFISKQPKVTGATSGPIVGSNFGLLLSNAQRIKKEMEDDFVSVEHLLLAFLSDDRFGRLL 216
             + K PKV+G      +      LL+ A+++ ++  D+F+S EHLLLA L D      L
Sbjct: 61  KELEKLPKVSGPGGQVYLSPELNRLLNLAEKLAQKRGDEFISSEHLLLALLDDKGTLGKL 120

Query: 217 FNDIRLNEKDLKDAVKAVRGHQRVTDQNPEGKYQALEKYGNDLTELARSGKLDPVIGRDD 276
             +       L+ A+ AVRG Q+VT  N E +Y+ALEKY  DLTE AR GKLDPVIGRD+
Sbjct: 121 LKEAGATADALEAAINAVRGGQKVTSANAEDQYEALEKYARDLTERAREGKLDPVIGRDE 180

Query: 277 EIRRCIQILSRRTKNNPVIIGEPGVGKTAIAEGLAQRIVRGDVPETLQNRKLISLDMASL 336
           EIRR IQ+LSRRTKNNPV+IGEPGVGKTAI EGLAQRIV GDVPE+L+N++L++LDM +L
Sbjct: 181 EIRRTIQVLSRRTKNNPVLIGEPGVGKTAIVEGLAQRIVNGDVPESLKNKRLLALDMGAL 240

Query: 337 VAGTCYRGDFEKRLKAVLKEVTKSNGQIILFIDELHTIIGAGNQSGAMDASNMLKPMLGR 396
           +AG  YRG+FE+RLKAVL EVTKS GQIILFIDELHT++GAG   GAMDA NMLKP L R
Sbjct: 241 IAGAKYRGEFEERLKAVLNEVTKSEGQIILFIDELHTLVGAGKAEGAMDAGNMLKPALAR 300

Query: 397 GELRCIGATTLNEYRNYIEKDPALERRFQQVFCDQPSVENTISILRGLRERYELHHGVKI 456
           GEL CIGATTL+EYR YIEKD ALERRFQ VF D+P+VE+TISILRGL+ERYE+HHGV+I
Sbjct: 301 GELHCIGATTLDEYRKYIEKDAALERRFQPVFVDEPTVEDTISILRGLKERYEVHHGVRI 360

Query: 457 SDSALVSAAVLADRYITERFLPDKAIDLVDEAAAKLKMEITSKPIELDEIDRAVLKLEME 516
           +D A+V+AA L+ RYIT+RFLPDKAIDL+DEAAA+++MEI SKP ELDE+DR +++LE+E
Sbjct: 361 TDPAIVAAATLSHRYITDRFLPDKAIDLIDEAAARIRMEIDSKPEELDELDRRIIQLEIE 420

Query: 517 KLSLKNDTDKASKERLSKLEHDLNSLKQKQKELNDQWSREKDLMSRIRSIKEEIDRVNLE 576
           + +LK + D+ASKERL  LE +L  L+++  +L +QW  EK  +  I+ IKEEI++V LE
Sbjct: 421 REALKKEKDEASKERLEDLEKELAELEEEYADLEEQWKAEKAAIQGIQQIKEEIEQVRLE 480

Query: 577 MEAAERDYDLNRAAELKYGTMISLQRQLEEAEKNLSEFQKSGHSLLREEVTDLDIAEIVS 636
           +E AER+ DL +AAEL+YG +  L+++L+ AE  L E  K    LLREEVT  +IAE+VS
Sbjct: 481 LEQAEREGDLAKAAELQYGKLPELEKRLQAAEAKLGEETKP--RLLREEVTAEEIAEVVS 538

Query: 637 KWTGIPLSSLQQSEREKLVMLEEVLHKRVIGQDIAVKSVADAIRRSRAGLSDPARPIASF 696
           +WTGIP+S + + EREKL+ +EEVLH+RV+GQD AV++V+DAIRRSRAGLSDP RPI SF
Sbjct: 539 RWTGIPVSKMLEGEREKLLHMEEVLHERVVGQDEAVEAVSDAIRRSRAGLSDPNRPIGSF 598

Query: 697 MFMGPTGVGKTELGKALADFLFNTENALVRIDMSEYMEKHSVSRLVGAPPGYVGYEEGGQ 756
           +F+GPTGVGKTEL KALA+FLF+ E+A+VRIDMSEYMEKHSV+RL+GAPPGYVGYEEGGQ
Sbjct: 599 LFLGPTGVGKTELAKALAEFLFDDEDAMVRIDMSEYMEKHSVARLIGAPPGYVGYEEGGQ 658

Query: 757 LTEVVRRRPYSVVLFDEIEKAHQDVFNILLQLLDDGRITDSQGRTVSFTNCVVIMTSNIG 816
           LTE VRR+PYSVVLFDE+EKAH DVFN+LLQ+LDDGR+TD QGRTV F N V+IMTSN+G
Sbjct: 659 LTEAVRRKPYSVVLFDEVEKAHPDVFNVLLQVLDDGRLTDGQGRTVDFRNTVIIMTSNLG 718

Query: 817 SHYILETLQSVQDSKEAVYEVMKKQVVELARQTFRPEFLNRIDEYIVFQPLDSKEISKIV 876
           S +I E       +    YE M++ V+E+ R  FRPEFLNRIDE +VF PL  ++I++IV
Sbjct: 719 SQFIQE------LAGGDDYEEMREAVMEVLRAHFRPEFLNRIDEIVVFHPLGREQIARIV 772

Query: 877 EIQMNRVKDRLKQKKIDLHYTKEAVTLLGILGFDPNFGARPVKRVIQQLVENEIAVAILK 936
           EIQ+ R++ RL ++KI L  +  A+  L   G+DP +GARP+KR IQ+ +EN +A  IL 
Sbjct: 773 EIQLGRLRKRLAERKITLELSDAALDFLAEAGYDPVYGARPLKRAIQREIENPLAKKILA 832

Query: 937 GDIKEEDSVIIDVDD 951
           G++ + D++++DV+ 
Sbjct: 833 GEVADGDTIVVDVEG 847

Members of this protein family are the bacterial ATP-dependent chaperone ClpB. This protein belongs to the AAA family, ATPases associated with various cellular activities (pfam00004). This molecular chaperone does not act as a protease, but rather serves to disaggregate misfolded and aggregated proteins [Protein fate, Protein folding and stabilization]. Length = 852
>gnl|CDD|223616 COG0542, clpA, ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|182791 PRK10865, PRK10865, protein disaggregation chaperone; Provisional Back     alignment and domain information
>gnl|CDD|214361 CHL00095, clpC, Clp protease ATP binding subunit Back     alignment and domain information
>gnl|CDD|234172 TIGR03345, VI_ClpV1, type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>gnl|CDD|233959 TIGR02639, ClpA, ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>gnl|CDD|233959 TIGR02639, ClpA, ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>gnl|CDD|236828 PRK11034, clpA, ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|219536 pfam07724, AAA_2, AAA domain (Cdc48 subfamily) Back     alignment and domain information
>gnl|CDD|236828 PRK11034, clpA, ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|204486 pfam10431, ClpB_D2-small, C-terminal, D2-small domain, of ClpB protein Back     alignment and domain information
>gnl|CDD|198154 smart01086, ClpB_D2-small, C-terminal, D2-small domain, of ClpB protein Back     alignment and domain information
>gnl|CDD|99707 cd00009, AAA, The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>gnl|CDD|99707 cd00009, AAA, The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>gnl|CDD|215649 pfam00004, AAA, ATPase family associated with various cellular activities (AAA) Back     alignment and domain information
>gnl|CDD|214640 smart00382, AAA, ATPases associated with a variety of cellular activities Back     alignment and domain information
>gnl|CDD|217254 pfam02861, Clp_N, Clp amino terminal domain Back     alignment and domain information
>gnl|CDD|219538 pfam07728, AAA_5, AAA domain (dynein-related subfamily) Back     alignment and domain information
>gnl|CDD|217254 pfam02861, Clp_N, Clp amino terminal domain Back     alignment and domain information
>gnl|CDD|223786 COG0714, COG0714, MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|215649 pfam00004, AAA, ATPase family associated with various cellular activities (AAA) Back     alignment and domain information
>gnl|CDD|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|214640 smart00382, AAA, ATPases associated with a variety of cellular activities Back     alignment and domain information
>gnl|CDD|222104 pfam13401, AAA_22, AAA domain Back     alignment and domain information
>gnl|CDD|221970 pfam13191, AAA_16, AAA ATPase domain Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|219538 pfam07728, AAA_5, AAA domain (dynein-related subfamily) Back     alignment and domain information
>gnl|CDD|225165 COG2256, MGS1, ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|188437 TIGR03922, T7SS_EccA, type VII secretion AAA-ATPase EccA Back     alignment and domain information
>gnl|CDD|237354 PRK13341, PRK13341, recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|222104 pfam13401, AAA_22, AAA domain Back     alignment and domain information
>gnl|CDD|227596 COG5271, MDN1, AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional Back     alignment and domain information
>gnl|CDD|232949 TIGR00382, clpX, endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>gnl|CDD|213527 TIGR00390, hslU, ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>gnl|CDD|224141 COG1220, HslU, ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|237355 PRK13342, PRK13342, recombination factor protein RarA; Reviewed Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|224495 COG1579, COG1579, Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>gnl|CDD|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 982
COG0542786 clpA ATP-binding subunits of Clp protease and DnaK 100.0
PRK10865857 protein disaggregation chaperone; Provisional 100.0
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 100.0
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 100.0
CHL00095821 clpC Clp protease ATP binding subunit 100.0
KOG1051898 consensus Chaperone HSP104 and related ATP-depende 100.0
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 100.0
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 100.0
KOG0733802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 100.0
KOG0730693 consensus AAA+-type ATPase [Posttranslational modi 100.0
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 100.0
TIGR00382413 clpX endopeptidase Clp ATP-binding regulatory subu 99.97
KOG0736953 consensus Peroxisome assembly factor 2 containing 99.97
PRK05342412 clpX ATP-dependent protease ATP-binding subunit Cl 99.96
KOG0735952 consensus AAA+-type ATPase [Posttranslational modi 99.95
PRK10787 784 DNA-binding ATP-dependent protease La; Provisional 99.95
TIGR00763 775 lon ATP-dependent protease La. This protein is ind 99.95
COG0466 782 Lon ATP-dependent Lon protease, bacterial type [Po 99.94
PF07724171 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR 99.92
KOG0741744 consensus AAA+-type ATPase [Posttranslational modi 99.92
COG2256436 MGS1 ATPase related to the helicase subunit of the 99.91
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [P 99.9
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational 99.89
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 99.89
PRK05201443 hslU ATP-dependent protease ATP-binding subunit Hs 99.89
COG2204464 AtoC Response regulator containing CheY-like recei 99.89
KOG2004 906 consensus Mitochondrial ATP-dependent protease PIM 99.88
COG1223368 Predicted ATPase (AAA+ superfamily) [General funct 99.87
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 99.87
COG3829560 RocR Transcriptional regulator containing PAS, AAA 99.87
TIGR00390441 hslU ATP-dependent protease HslVU, ATPase subunit. 99.86
COG0542786 clpA ATP-binding subunits of Clp protease and DnaK 99.86
COG3604550 FhlA Transcriptional regulator containing GAF, AAA 99.86
KOG0745564 consensus Putative ATP-dependent Clp-type protease 99.86
KOG0738491 consensus AAA+-type ATPase [Posttranslational modi 99.85
TIGR02974329 phageshock_pspF psp operon transcriptional activat 99.84
CHL00181287 cbbX CbbX; Provisional 99.84
KOG0989346 consensus Replication factor C, subunit RFC4 [Repl 99.83
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 99.83
KOG0730693 consensus AAA+-type ATPase [Posttranslational modi 99.83
KOG0733802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 99.82
KOG2028554 consensus ATPase related to the helicase subunit o 99.82
PRK14956484 DNA polymerase III subunits gamma and tau; Provisi 99.82
TIGR01817534 nifA Nif-specific regulatory protein. This model r 99.81
KOG0734752 consensus AAA+-type ATPase containing the peptidas 99.81
PRK11608326 pspF phage shock protein operon transcriptional ac 99.81
CHL00195489 ycf46 Ycf46; Provisional 99.81
CHL00095821 clpC Clp protease ATP binding subunit 99.81
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 99.81
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 99.81
PRK05022509 anaerobic nitric oxide reductase transcription reg 99.8
PRK15424538 propionate catabolism operon regulatory protein Pr 99.8
COG1221403 PspF Transcriptional regulators containing an AAA- 99.8
TIGR02329526 propionate_PrpR propionate catabolism operon regul 99.8
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 99.8
PRK12323700 DNA polymerase III subunits gamma and tau; Provisi 99.79
PRK10820520 DNA-binding transcriptional regulator TyrR; Provis 99.79
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 99.79
PRK13342413 recombination factor protein RarA; Reviewed 99.78
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 99.78
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 99.78
KOG0736953 consensus Peroxisome assembly factor 2 containing 99.78
PRK14960702 DNA polymerase III subunits gamma and tau; Provisi 99.78
CHL00195489 ycf46 Ycf46; Provisional 99.78
PRK07994647 DNA polymerase III subunits gamma and tau; Validat 99.77
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 99.77
PRK11388638 DNA-binding transcriptional regulator DhaR; Provis 99.77
PRK03992389 proteasome-activating nucleotidase; Provisional 99.76
KOG2170344 consensus ATPase of the AAA+ superfamily [General 99.76
KOG0739439 consensus AAA+-type ATPase [Posttranslational modi 99.76
PLN03025319 replication factor C subunit; Provisional 99.76
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 99.76
PRK15429686 formate hydrogenlyase transcriptional activator Fh 99.76
COG2255332 RuvB Holliday junction resolvasome, helicase subun 99.75
PRK14962472 DNA polymerase III subunits gamma and tau; Provisi 99.75
PF00158168 Sigma54_activat: Sigma-54 interaction domain; Inte 99.75
PRK13341725 recombination factor protein RarA/unknown domain f 99.75
COG3283511 TyrR Transcriptional regulator of aromatic amino a 99.75
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 99.75
PRK14958509 DNA polymerase III subunits gamma and tau; Provisi 99.75
PRK14964491 DNA polymerase III subunits gamma and tau; Provisi 99.75
CHL00181287 cbbX CbbX; Provisional 99.75
TIGR02915445 PEP_resp_reg putative PEP-CTERM system response re 99.74
PLN00020413 ribulose bisphosphate carboxylase/oxygenase activa 99.74
PRK14957546 DNA polymerase III subunits gamma and tau; Provisi 99.74
COG1223368 Predicted ATPase (AAA+ superfamily) [General funct 99.74
PRK10923469 glnG nitrogen regulation protein NR(I); Provisiona 99.74
TIGR01241495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 99.74
PRK14951618 DNA polymerase III subunits gamma and tau; Provisi 99.73
PRK14952584 DNA polymerase III subunits gamma and tau; Provisi 99.73
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 99.73
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 99.73
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 99.73
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 99.72
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 99.72
KOG0731774 consensus AAA+-type ATPase containing the peptidas 99.72
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 99.72
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational 99.72
PRK06645507 DNA polymerase III subunits gamma and tau; Validat 99.72
PRK14959624 DNA polymerase III subunits gamma and tau; Provisi 99.71
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 99.71
COG2256 436 MGS1 ATPase related to the helicase subunit of the 99.71
TIGR02902531 spore_lonB ATP-dependent protease LonB. Members of 99.7
PRK08691709 DNA polymerase III subunits gamma and tau; Validat 99.7
CHL00176638 ftsH cell division protein; Validated 99.7
PRK14969527 DNA polymerase III subunits gamma and tau; Provisi 99.7
PRK08451535 DNA polymerase III subunits gamma and tau; Validat 99.7
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 99.7
COG1220444 HslU ATP-dependent protease HslVU (ClpYQ), ATPase 99.7
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 99.7
PRK05563559 DNA polymerase III subunits gamma and tau; Validat 99.7
KOG0991333 consensus Replication factor C, subunit RFC2 [Repl 99.7
KOG0727408 consensus 26S proteasome regulatory complex, ATPas 99.7
TIGR02902 531 spore_lonB ATP-dependent protease LonB. Members of 99.7
KOG0728404 consensus 26S proteasome regulatory complex, ATPas 99.69
KOG0740428 consensus AAA+-type ATPase [Posttranslational modi 99.69
KOG0737386 consensus AAA+-type ATPase [Posttranslational modi 99.69
KOG0989346 consensus Replication factor C, subunit RFC4 [Repl 99.69
TIGR01818463 ntrC nitrogen regulation protein NR(I). This model 99.69
PRK11361457 acetoacetate metabolism regulatory protein AtoC; P 99.69
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 99.69
KOG0735952 consensus AAA+-type ATPase [Posttranslational modi 99.68
PRK15115444 response regulator GlrR; Provisional 99.68
PRK14965576 DNA polymerase III subunits gamma and tau; Provisi 99.68
PRK05896605 DNA polymerase III subunits gamma and tau; Validat 99.68
PRK09111598 DNA polymerase III subunits gamma and tau; Validat 99.68
PRK14956 484 DNA polymerase III subunits gamma and tau; Provisi 99.67
PRK14963504 DNA polymerase III subunits gamma and tau; Provisi 99.67
PRK07133725 DNA polymerase III subunits gamma and tau; Validat 99.67
PHA02544316 44 clamp loader, small subunit; Provisional 99.67
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 99.67
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 99.67
KOG0726440 consensus 26S proteasome regulatory complex, ATPas 99.66
COG2255332 RuvB Holliday junction resolvasome, helicase subun 99.66
KOG0652424 consensus 26S proteasome regulatory complex, ATPas 99.66
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 99.65
COG5271 4600 MDN1 AAA ATPase containing von Willebrand factor t 99.65
CHL002062281 ycf2 Ycf2; Provisional 99.65
PRK12402337 replication factor C small subunit 2; Reviewed 99.65
PRK04195482 replication factor C large subunit; Provisional 99.65
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 99.64
PRK06647563 DNA polymerase III subunits gamma and tau; Validat 99.64
COG2812515 DnaX DNA polymerase III, gamma/tau subunits [DNA r 99.64
PRK14953486 DNA polymerase III subunits gamma and tau; Provisi 99.64
KOG0729435 consensus 26S proteasome regulatory complex, ATPas 99.64
PRK06305451 DNA polymerase III subunits gamma and tau; Validat 99.64
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 99.63
PRK14958 509 DNA polymerase III subunits gamma and tau; Provisi 99.63
PRK14954620 DNA polymerase III subunits gamma and tau; Provisi 99.62
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 99.62
COG5271 4600 MDN1 AAA ATPase containing von Willebrand factor t 99.62
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 99.62
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 99.62
KOG0734 752 consensus AAA+-type ATPase containing the peptidas 99.61
PRK10365441 transcriptional regulatory protein ZraR; Provision 99.61
PRK00440319 rfc replication factor C small subunit; Reviewed 99.61
PRK14948620 DNA polymerase III subunits gamma and tau; Provisi 99.6
PRK14971614 DNA polymerase III subunits gamma and tau; Provisi 99.6
COG0465596 HflB ATP-dependent Zn proteases [Posttranslational 99.6
PRK14970367 DNA polymerase III subunits gamma and tau; Provisi 99.6
PRK14952 584 DNA polymerase III subunits gamma and tau; Provisi 99.6
PLN03025319 replication factor C subunit; Provisional 99.6
PRK14957 546 DNA polymerase III subunits gamma and tau; Provisi 99.6
PRK14951 618 DNA polymerase III subunits gamma and tau; Provisi 99.6
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 99.59
PRK14964 491 DNA polymerase III subunits gamma and tau; Provisi 99.59
COG3284606 AcoR Transcriptional activator of acetoin/glycerol 99.59
COG2812 515 DnaX DNA polymerase III, gamma/tau subunits [DNA r 99.58
KOG0738491 consensus AAA+-type ATPase [Posttranslational modi 99.58
PRK14950585 DNA polymerase III subunits gamma and tau; Provisi 99.57
PRK10733644 hflB ATP-dependent metalloprotease; Reviewed 99.57
TIGR00763775 lon ATP-dependent protease La. This protein is ind 99.57
TIGR02903 615 spore_lon_C ATP-dependent protease, Lon family. Me 99.57
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 99.57
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 99.57
KOG0742630 consensus AAA+-type ATPase [Posttranslational modi 99.57
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 99.56
PF00004132 AAA: ATPase family associated with various cellula 99.56
PRK04132846 replication factor C small subunit; Provisional 99.56
PRK14962 472 DNA polymerase III subunits gamma and tau; Provisi 99.56
PRK14969 527 DNA polymerase III subunits gamma and tau; Provisi 99.56
PRK07133 725 DNA polymerase III subunits gamma and tau; Validat 99.56
PRK14959 624 DNA polymerase III subunits gamma and tau; Provisi 99.56
TIGR02903615 spore_lon_C ATP-dependent protease, Lon family. Me 99.55
PRK03992389 proteasome-activating nucleotidase; Provisional 99.55
PRK14965 576 DNA polymerase III subunits gamma and tau; Provisi 99.55
PRK08084235 DNA replication initiation factor; Provisional 99.55
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 99.55
PRK13342 413 recombination factor protein RarA; Reviewed 99.55
PRK05563 559 DNA polymerase III subunits gamma and tau; Validat 99.55
PRK07940 394 DNA polymerase III subunit delta'; Validated 99.54
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 99.54
PF01078206 Mg_chelatase: Magnesium chelatase, subunit ChlI; I 99.54
PRK13341 725 recombination factor protein RarA/unknown domain f 99.54
PRK05896 605 DNA polymerase III subunits gamma and tau; Validat 99.54
PRK06645 507 DNA polymerase III subunits gamma and tau; Validat 99.54
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 99.53
PRK08451 535 DNA polymerase III subunits gamma and tau; Validat 99.53
PRK14963 504 DNA polymerase III subunits gamma and tau; Provisi 99.52
PRK09111 598 DNA polymerase III subunits gamma and tau; Validat 99.52
KOG0651388 consensus 26S proteasome regulatory complex, ATPas 99.52
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 99.51
PRK12402337 replication factor C small subunit 2; Reviewed 99.5
KOG0727408 consensus 26S proteasome regulatory complex, ATPas 99.5
PTZ001121164 origin recognition complex 1 protein; Provisional 99.5
COG0466782 Lon ATP-dependent Lon protease, bacterial type [Po 99.5
PRK14954 620 DNA polymerase III subunits gamma and tau; Provisi 99.5
PRK05201443 hslU ATP-dependent protease ATP-binding subunit Hs 99.5
PRK07940394 DNA polymerase III subunit delta'; Validated 99.5
PRK14953 486 DNA polymerase III subunits gamma and tau; Provisi 99.49
PRK06305 451 DNA polymerase III subunits gamma and tau; Validat 99.49
KOG0732 1080 consensus AAA+-type ATPase containing the bromodom 99.49
PLN00020413 ribulose bisphosphate carboxylase/oxygenase activa 99.48
PRK06893229 DNA replication initiation factor; Validated 99.48
PRK10787784 DNA-binding ATP-dependent protease La; Provisional 99.48
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 99.48
PRK14955 397 DNA polymerase III subunits gamma and tau; Provisi 99.47
TIGR00390441 hslU ATP-dependent protease HslVU, ATPase subunit. 99.47
PRK13531 498 regulatory ATPase RavA; Provisional 99.47
TIGR01241 495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 99.47
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 99.47
KOG2004906 consensus Mitochondrial ATP-dependent protease PIM 99.47
CHL00176 638 ftsH cell division protein; Validated 99.46
PRK06647 563 DNA polymerase III subunits gamma and tau; Validat 99.46
TIGR02928365 orc1/cdc6 family replication initiation protein. M 99.45
PRK05342412 clpX ATP-dependent protease ATP-binding subunit Cl 99.45
KOG0731 774 consensus AAA+-type ATPase containing the peptidas 99.45
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 99.45
PRK14948 620 DNA polymerase III subunits gamma and tau; Provisi 99.45
PHA02544316 44 clamp loader, small subunit; Provisional 99.44
CHL00081350 chlI Mg-protoporyphyrin IX chelatase 99.44
PRK09112351 DNA polymerase III subunit delta'; Validated 99.44
KOG2035351 consensus Replication factor C, subunit RFC3 [Cell 99.44
PRK14971 614 DNA polymerase III subunits gamma and tau; Provisi 99.43
KOG0739439 consensus AAA+-type ATPase [Posttranslational modi 99.43
PRK04195 482 replication factor C large subunit; Provisional 99.42
PRK14950 585 DNA polymerase III subunits gamma and tau; Provisi 99.42
PRK13407334 bchI magnesium chelatase subunit I; Provisional 99.41
PRK07399314 DNA polymerase III subunit delta'; Validated 99.41
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 99.41
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 99.41
PRK00411394 cdc6 cell division control protein 6; Reviewed 99.41
TIGR00602637 rad24 checkpoint protein rad24. This family is bas 99.41
PRK05642234 DNA replication initiation factor; Validated 99.41
KOG0742630 consensus AAA+-type ATPase [Posttranslational modi 99.4
TIGR00368499 Mg chelatase-related protein. The N-terminal end m 99.4
TIGR02442 633 Cob-chelat-sub cobaltochelatase subunit. A number 99.4
KOG0728404 consensus 26S proteasome regulatory complex, ATPas 99.4
PHA02244383 ATPase-like protein 99.39
COG0606490 Predicted ATPase with chaperone activity [Posttran 99.39
COG1224450 TIP49 DNA helicase TIP49, TBP-interacting protein 99.39
PRK10865857 protein disaggregation chaperone; Provisional 99.39
TIGR02030337 BchI-ChlI magnesium chelatase ATPase subunit I. Th 99.39
PRK07471365 DNA polymerase III subunit delta'; Validated 99.39
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 99.39
PRK08903227 DnaA regulatory inactivator Hda; Validated 99.39
PRK14970367 DNA polymerase III subunits gamma and tau; Provisi 99.38
PRK08727233 hypothetical protein; Validated 99.38
PRK08903227 DnaA regulatory inactivator Hda; Validated 99.37
KOG0744423 consensus AAA+-type ATPase [Posttranslational modi 99.37
PF05673249 DUF815: Protein of unknown function (DUF815); Inte 99.37
PRK00440319 rfc replication factor C small subunit; Reviewed 99.37
TIGR00382413 clpX endopeptidase Clp ATP-binding regulatory subu 99.37
CHL00206 2281 ycf2 Ycf2; Provisional 99.37
KOG2028 554 consensus ATPase related to the helicase subunit o 99.36
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 99.36
PRK13531498 regulatory ATPase RavA; Provisional 99.35
PRK08084235 DNA replication initiation factor; Provisional 99.35
KOG0990360 consensus Replication factor C, subunit RFC5 [Repl 99.35
KOG0991333 consensus Replication factor C, subunit RFC2 [Repl 99.34
PRK06893229 DNA replication initiation factor; Validated 99.34
PF06068398 TIP49: TIP49 C-terminus; InterPro: IPR010339 This 99.34
PRK09112351 DNA polymerase III subunit delta'; Validated 99.34
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 99.33
COG0714329 MoxR-like ATPases [General function prediction onl 99.33
TIGR01650327 PD_CobS cobaltochelatase, CobS subunit. This model 99.33
PRK07471365 DNA polymerase III subunit delta'; Validated 99.32
PRK00149450 dnaA chromosomal replication initiation protein; R 99.32
PRK13407334 bchI magnesium chelatase subunit I; Provisional 99.32
TIGR01650327 PD_CobS cobaltochelatase, CobS subunit. This model 99.32
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 99.32
PRK08727233 hypothetical protein; Validated 99.31
TIGR00362405 DnaA chromosomal replication initiator protein Dna 99.31
PF00004132 AAA: ATPase family associated with various cellula 99.31
PRK12422445 chromosomal replication initiation protein; Provis 99.31
PRK05564313 DNA polymerase III subunit delta'; Validated 99.3
KOG0729435 consensus 26S proteasome regulatory complex, ATPas 99.3
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 99.3
PRK06620214 hypothetical protein; Validated 99.29
KOG0652424 consensus 26S proteasome regulatory complex, ATPas 99.29
PRK05564313 DNA polymerase III subunit delta'; Validated 99.29
COG3829560 RocR Transcriptional regulator containing PAS, AAA 99.29
KOG0726440 consensus 26S proteasome regulatory complex, ATPas 99.29
PRK06871325 DNA polymerase III subunit delta'; Validated 99.28
PRK08058329 DNA polymerase III subunit delta'; Validated 99.28
PRK08769319 DNA polymerase III subunit delta'; Validated 99.27
PRK14088440 dnaA chromosomal replication initiation protein; P 99.27
PTZ00112 1164 origin recognition complex 1 protein; Provisional 99.27
PRK07399314 DNA polymerase III subunit delta'; Validated 99.27
PRK14086617 dnaA chromosomal replication initiation protein; P 99.26
PRK05642234 DNA replication initiation factor; Validated 99.25
CHL00081350 chlI Mg-protoporyphyrin IX chelatase 99.25
KOG0737386 consensus AAA+-type ATPase [Posttranslational modi 99.25
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 99.25
COG0714329 MoxR-like ATPases [General function prediction onl 99.25
PRK04132846 replication factor C small subunit; Provisional 99.24
PRK10733 644 hflB ATP-dependent metalloprotease; Reviewed 99.24
PRK06090319 DNA polymerase III subunit delta'; Validated 99.23
PRK07993334 DNA polymerase III subunit delta'; Validated 99.23
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 99.23
TIGR02030337 BchI-ChlI magnesium chelatase ATPase subunit I. Th 99.22
COG3604550 FhlA Transcriptional regulator containing GAF, AAA 99.22
PTZ00111 915 DNA replication licensing factor MCM4; Provisional 99.22
smart00350509 MCM minichromosome maintenance proteins. 99.22
KOG2035351 consensus Replication factor C, subunit RFC3 [Cell 99.22
COG1221403 PspF Transcriptional regulators containing an AAA- 99.22
TIGR02928365 orc1/cdc6 family replication initiation protein. M 99.22
PF14532138 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 99.21
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 99.21
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [P 99.21
PRK09087226 hypothetical protein; Validated 99.21
PRK05707328 DNA polymerase III subunit delta'; Validated 99.21
TIGR02974329 phageshock_pspF psp operon transcriptional activat 99.21
COG2204464 AtoC Response regulator containing CheY-like recei 99.2
TIGR02031 589 BchD-ChlD magnesium chelatase ATPase subunit D. Th 99.2
PRK09862506 putative ATP-dependent protease; Provisional 99.2
PF07726131 AAA_3: ATPase family associated with various cellu 99.19
COG1220444 HslU ATP-dependent protease HslVU (ClpYQ), ATPase 99.19
COG0465 596 HflB ATP-dependent Zn proteases [Posttranslational 99.19
TIGR00362405 DnaA chromosomal replication initiator protein Dna 99.19
PRK11608326 pspF phage shock protein operon transcriptional ac 99.19
COG0470325 HolB ATPase involved in DNA replication [DNA repli 99.19
KOG1969877 consensus DNA replication checkpoint protein CHL12 99.18
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 99.18
PRK08058329 DNA polymerase III subunit delta'; Validated 99.18
KOG0743457 consensus AAA+-type ATPase [Posttranslational modi 99.17
PRK11331459 5-methylcytosine-specific restriction enzyme subun 99.16
PRK12422445 chromosomal replication initiation protein; Provis 99.16
COG0470325 HolB ATPase involved in DNA replication [DNA repli 99.16
PRK14087450 dnaA chromosomal replication initiation protein; P 99.16
PRK11331459 5-methylcytosine-specific restriction enzyme subun 99.16
TIGR01817534 nifA Nif-specific regulatory protein. This model r 99.16
PRK06964342 DNA polymerase III subunit delta'; Validated 99.16
KOG1942456 consensus DNA helicase, TBP-interacting protein [R 99.15
TIGR00764 608 lon_rel lon-related putative ATP-dependent proteas 99.15
PRK00149450 dnaA chromosomal replication initiation protein; R 99.15
COG4650531 RtcR Sigma54-dependent transcription regulator con 99.15
PRK00411394 cdc6 cell division control protein 6; Reviewed 99.14
KOG0745564 consensus Putative ATP-dependent Clp-type protease 99.14
PF07724171 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR 99.14
PRK13765 637 ATP-dependent protease Lon; Provisional 99.14
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 99.13
PF01078206 Mg_chelatase: Magnesium chelatase, subunit ChlI; I 99.13
KOG0740428 consensus AAA+-type ATPase [Posttranslational modi 99.12
PHA02244383 ATPase-like protein 99.12
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 99.12
KOG0744423 consensus AAA+-type ATPase [Posttranslational modi 99.12
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 99.11
PRK15429686 formate hydrogenlyase transcriptional activator Fh 99.11
PRK14087450 dnaA chromosomal replication initiation protein; P 99.11
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 99.1
TIGR02329526 propionate_PrpR propionate catabolism operon regul 99.1
PRK14086617 dnaA chromosomal replication initiation protein; P 99.1
PRK08769319 DNA polymerase III subunit delta'; Validated 99.09
PRK05707328 DNA polymerase III subunit delta'; Validated 99.09
PRK14088440 dnaA chromosomal replication initiation protein; P 99.09
PRK05022509 anaerobic nitric oxide reductase transcription reg 99.09
PRK15424538 propionate catabolism operon regulatory protein Pr 99.08
PF1043181 ClpB_D2-small: C-terminal, D2-small domain, of Clp 99.08
KOG0743457 consensus AAA+-type ATPase [Posttranslational modi 99.08
COG1224450 TIP49 DNA helicase TIP49, TBP-interacting protein 99.08
TIGR02442633 Cob-chelat-sub cobaltochelatase subunit. A number 99.07
PRK10820520 DNA-binding transcriptional regulator TyrR; Provis 99.07
PRK11388638 DNA-binding transcriptional regulator DhaR; Provis 99.06
KOG0732 1080 consensus AAA+-type ATPase containing the bromodom 99.05
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 99.05
PF06068398 TIP49: TIP49 C-terminus; InterPro: IPR010339 This 99.05
PF00158168 Sigma54_activat: Sigma-54 interaction domain; Inte 99.05
PF05673249 DUF815: Protein of unknown function (DUF815); Inte 99.04
PRK07993334 DNA polymerase III subunit delta'; Validated 99.04
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 99.03
COG1239423 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolis 99.02
PRK05917290 DNA polymerase III subunit delta'; Validated 99.01
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 99.01
PRK08699325 DNA polymerase III subunit delta'; Validated 99.0
COG0593408 DnaA ATPase involved in DNA replication initiation 99.0
PRK07276290 DNA polymerase III subunit delta'; Validated 99.0
PRK06620214 hypothetical protein; Validated 99.0
COG2607287 Predicted ATPase (AAA+ superfamily) [General funct 98.99
PRK06871325 DNA polymerase III subunit delta'; Validated 98.99
PF07726131 AAA_3: ATPase family associated with various cellu 98.99
KOG0651388 consensus 26S proteasome regulatory complex, ATPas 98.98
TIGR00764608 lon_rel lon-related putative ATP-dependent proteas 98.97
PRK09087226 hypothetical protein; Validated 98.96
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 98.95
smart00350509 MCM minichromosome maintenance proteins. 98.95
PRK06964342 DNA polymerase III subunit delta'; Validated 98.94
) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309127 Torsin: Torsin; InterPro: IPR010448 This family co 98.93
KOG2680454 consensus DNA helicase TIP49, TBP-interacting prot 98.93
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 98.92
KOG1051898 consensus Chaperone HSP104 and related ATP-depende 98.91
KOG0741 744 consensus AAA+-type ATPase [Posttranslational modi 98.91
TIGR02915445 PEP_resp_reg putative PEP-CTERM system response re 98.88
PRK06090319 DNA polymerase III subunit delta'; Validated 98.87
COG1239423 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolis 98.87
TIGR00368499 Mg chelatase-related protein. The N-terminal end m 98.85
PF12775272 AAA_7: P-loop containing dynein motor region D3; P 98.84
KOG0990360 consensus Replication factor C, subunit RFC5 [Repl 98.84
PRK05818261 DNA polymerase III subunit delta'; Validated 98.83
PTZ00111915 DNA replication licensing factor MCM4; Provisional 98.82
COG0606490 Predicted ATPase with chaperone activity [Posttran 98.82
PF0286153 Clp_N: Clp amino terminal domain; InterPro: IPR004 98.81
TIGR02031589 BchD-ChlD magnesium chelatase ATPase subunit D. Th 98.79
COG1241682 MCM2 Predicted ATPase involved in replication cont 98.77
PRK13765637 ATP-dependent protease Lon; Provisional 98.76
PRK12377248 putative replication protein; Provisional 98.76
PRK10923469 glnG nitrogen regulation protein NR(I); Provisiona 98.75
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 98.74
KOG0478804 consensus DNA replication licensing factor, MCM4 c 98.74
COG0593408 DnaA ATPase involved in DNA replication initiation 98.72
PRK08699325 DNA polymerase III subunit delta'; Validated 98.72
KOG1942456 consensus DNA helicase, TBP-interacting protein [R 98.71
PRK13406 584 bchD magnesium chelatase subunit D; Provisional 98.71
PF13173128 AAA_14: AAA domain 98.69
smart00382148 AAA ATPases associated with a variety of cellular 98.69
KOG1969 877 consensus DNA replication checkpoint protein CHL12 98.69
PF12775272 AAA_7: P-loop containing dynein motor region D3; P 98.68
PRK08116268 hypothetical protein; Validated 98.68
PRK07132299 DNA polymerase III subunit delta'; Validated 98.68
PRK12377248 putative replication protein; Provisional 98.67
PRK15115444 response regulator GlrR; Provisional 98.67
PF00493331 MCM: MCM2/3/5 family This family extends the MCM d 98.66
PF14532138 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 98.66
TIGR00602 637 rad24 checkpoint protein rad24. This family is bas 98.64
TIGR01818463 ntrC nitrogen regulation protein NR(I). This model 98.62
PRK11361457 acetoacetate metabolism regulatory protein AtoC; P 98.62
PRK08116268 hypothetical protein; Validated 98.62
KOG0480764 consensus DNA replication licensing factor, MCM6 c 98.6
PRK05917290 DNA polymerase III subunit delta'; Validated 98.58
PRK09862506 putative ATP-dependent protease; Provisional 98.57
COG2607287 Predicted ATPase (AAA+ superfamily) [General funct 98.55
PRK06835329 DNA replication protein DnaC; Validated 98.52
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 98.52
KOG2227529 consensus Pre-initiation complex, subunit CDC6, AA 98.52
PRK07952244 DNA replication protein DnaC; Validated 98.5
PRK10365441 transcriptional regulatory protein ZraR; Provision 98.47
PRK07132299 DNA polymerase III subunit delta'; Validated 98.46
smart00382148 AAA ATPases associated with a variety of cellular 98.44
PRK08181269 transposase; Validated 98.44
PRK06526254 transposase; Provisional 98.44
PF03215519 Rad17: Rad17 cell cycle checkpoint protein 98.43
PRK07952244 DNA replication protein DnaC; Validated 98.42
PRK15455 644 PrkA family serine protein kinase; Provisional 98.42
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 98.41
PRK08181269 transposase; Validated 98.39
PRK07276290 DNA polymerase III subunit delta'; Validated 98.39
PRK06835329 DNA replication protein DnaC; Validated 98.37
COG1484254 DnaC DNA replication protein [DNA replication, rec 98.36
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 98.35
PF12774231 AAA_6: Hydrolytic ATP binding site of dynein motor 98.34
COG3283511 TyrR Transcriptional regulator of aromatic amino a 98.33
PF13173128 AAA_14: AAA domain 98.32
PRK06526254 transposase; Provisional 98.32
KOG1808 1856 consensus AAA ATPase containing von Willebrand fac 98.32
COG1484254 DnaC DNA replication protein [DNA replication, rec 98.31
PHA00729226 NTP-binding motif containing protein 98.31
PF05729166 NACHT: NACHT domain 98.29
PRK15455644 PrkA family serine protein kinase; Provisional 98.28
KOG2227529 consensus Pre-initiation complex, subunit CDC6, AA 98.28
PRK06581263 DNA polymerase III subunit delta'; Validated 98.27
PRK13406584 bchD magnesium chelatase subunit D; Provisional 98.27
PRK09183259 transposase/IS protein; Provisional 98.26
PRK05818261 DNA polymerase III subunit delta'; Validated 98.26
PRK06921266 hypothetical protein; Provisional 98.24
KOG0481729 consensus DNA replication licensing factor, MCM5 c 98.24
KOG0482721 consensus DNA replication licensing factor, MCM7 c 98.23
COG3284606 AcoR Transcriptional activator of acetoin/glycerol 98.2
PRK06921266 hypothetical protein; Provisional 98.2
KOG3595 1395 consensus Dyneins, heavy chain [Cytoskeleton] 98.19
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 98.19
KOG1970634 consensus Checkpoint RAD17-RFC complex, RAD17/RAD2 98.19
COG5245 3164 DYN1 Dynein, heavy chain [Cytoskeleton] 98.18
KOG2680454 consensus DNA helicase TIP49, TBP-interacting prot 98.16
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 98.16
COG3854308 SpoIIIAA ncharacterized protein conserved in bacte 98.15
PF12774231 AAA_6: Hydrolytic ATP binding site of dynein motor 98.14
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 98.13
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 98.13
PRK08939306 primosomal protein DnaI; Reviewed 98.12
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 98.1
PF0286153 Clp_N: Clp amino terminal domain; InterPro: IPR004 98.08
PRK08939306 primosomal protein DnaI; Reviewed 98.08
KOG1514767 consensus Origin recognition complex, subunit 1, a 98.07
KOG1514767 consensus Origin recognition complex, subunit 1, a 98.07
KOG0478804 consensus DNA replication licensing factor, MCM4 c 98.07
KOG0477854 consensus DNA replication licensing factor, MCM2 c 98.06
COG1618179 Predicted nucleotide kinase [Nucleotide transport 98.06
PRK09183259 transposase/IS protein; Provisional 98.06
PF00910107 RNA_helicase: RNA helicase; InterPro: IPR000605 He 98.04
PF03215 519 Rad17: Rad17 cell cycle checkpoint protein 98.04
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=2.4e-135  Score=1189.19  Aligned_cols=773  Identities=58%  Similarity=0.940  Sum_probs=718.9

Q ss_pred             cccHHHHHHHHHHHHHHHHcCCCCcCHHHHHHHHhcCCCcHHHHHHHHcCCChHHHHHHHHHhhccCCCCCCCCCCCccC
Q 002012           96 EFTEKAWEGIVGAVDAARVNNQQVVETEHLMKALLEQKDGLARRILTKAGQDNTKVLQATEDFISKQPKVTGATSGPIVG  175 (982)
Q Consensus        96 ~ft~~a~~~l~~A~~~A~~~~~~~v~~eHlLlaLl~~~~~~~~~iL~~~gv~~~~l~~~~~~~~~~~~~~~~~~~~~~~s  175 (982)
                      +||++++++|..|+.+|+.++|++|++||||++|+.++++.  .+|..+|++++.++..+...+++.|...+.   +.++
T Consensus         1 ~~~~~~~~~l~~a~~~a~~~~h~~~~~eHll~~ll~~~~~~--~~l~~~~~~~~~l~~~~~~~~~~~~~~~~~---~~~s   75 (786)
T COG0542           1 KLTERAQKALELAQELARMRRHEYVTPEHLLLALLDQPKGD--ELLNLCGIDLDKLRQELEEFIDKLPKVLGS---PYLS   75 (786)
T ss_pred             CcCHHHHHHHHHHHHHHHHhCCCcccHHHHHHHHHcCCchH--HHHHHcCCCHHHHHHHHHHHHhccCCCCCC---CCCC
Confidence            59999999999999999999999999999999999999887  899999999999999999999999876553   7889


Q ss_pred             hhhHHHHHHHHHHHHHcCCCccCHHHHHHHHh-cCCcccccccccccCCHHHHHHHHHhhhcccccccCCCCchhHHHHH
Q 002012          176 SNFGLLLSNAQRIKKEMEDDFVSVEHLLLAFL-SDDRFGRLLFNDIRLNEKDLKDAVKAVRGHQRVTDQNPEGKYQALEK  254 (982)
Q Consensus       176 ~~~~~vl~~A~~~a~~~g~~~I~~ehLllall-~~~~~a~~lL~~~gi~~~~l~~~i~~~~~~~~~~~~~~~~~~~~l~~  254 (982)
                      +.+.++++.|+.+|..++++||+++|||+|++ +..+.+..+|...+++...+.+.+..+.++....+..++.....|++
T Consensus        76 ~~~~~~~~~a~~~a~~~~~~~v~~~~llla~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~~  155 (786)
T COG0542          76 PRLKRVLERAWLLAQSLGDEYVSTEHLLLALLNEPESVAAYILKKLGVTRKDVEELIEELRGGNEVDSKNAEEDQDALEK  155 (786)
T ss_pred             HHHHHHHHHHHHHHHhccCccccHHHHHHHHhcccchHHHHHHHhccCCHHHHHHHHHHHhcccccCCcccccchhhHHH
Confidence            99999999999999999999999999999999 55678889999999999999998999988876677777777789999


Q ss_pred             hhhhhHHHhhcCCCCCcccchHHHHHHHHHhccCCCCCcEEeCCCCCcHHHHHHHHHHHhhcCCCCCCCCCCeEEEEecc
Q 002012          255 YGNDLTELARSGKLDPVIGRDDEIRRCIQILSRRTKNNPVIIGEPGVGKTAIAEGLAQRIVRGDVPETLQNRKLISLDMA  334 (982)
Q Consensus       255 ~~~~l~~~~~~~~l~~liG~~~~i~~l~~~L~~~~~~~iLL~GppGvGKT~la~~la~~l~~~~~p~~l~~~~v~~l~~~  334 (982)
                      |+.+|++.++.+++||+|||++||++++++|+|++++|++|+|+||||||+++++||+++.+++||+.|.+.+++.+|++
T Consensus       156 y~~dlt~~Ar~gklDPvIGRd~EI~r~iqIL~RR~KNNPvLiGEpGVGKTAIvEGLA~rIv~g~VP~~L~~~~i~sLD~g  235 (786)
T COG0542         156 YTRDLTELAREGKLDPVIGRDEEIRRTIQILSRRTKNNPVLVGEPGVGKTAIVEGLAQRIVNGDVPESLKDKRIYSLDLG  235 (786)
T ss_pred             HhhhhHHHHhcCCCCCCcChHHHHHHHHHHHhccCCCCCeEecCCCCCHHHHHHHHHHHHhcCCCCHHHcCCEEEEecHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cccccccccccHHHHHHHHHHHHHhcCCCeEEEEccchhhhhCCCCCc-hhhHHHHHHhhhcCCCeEEEEecCchhHhhh
Q 002012          335 SLVAGTCYRGDFEKRLKAVLKEVTKSNGQIILFIDELHTIIGAGNQSG-AMDASNMLKPMLGRGELRCIGATTLNEYRNY  413 (982)
Q Consensus       335 ~l~~~~~~~g~~e~~l~~l~~~~~~~~~~~IL~IDEi~~l~~~~~~~~-~~~~~~~L~~~le~g~i~vI~at~~~~~~~~  413 (982)
                      ++.+|++|+|+||++++.+++++...+ ++||||||||++.++|.+.| +.|+.|+|+|+|++|.+.||||||..+|+++
T Consensus       236 ~LvAGakyRGeFEeRlk~vl~ev~~~~-~vILFIDEiHtiVGAG~~~G~a~DAaNiLKPaLARGeL~~IGATT~~EYRk~  314 (786)
T COG0542         236 SLVAGAKYRGEFEERLKAVLKEVEKSK-NVILFIDEIHTIVGAGATEGGAMDAANLLKPALARGELRCIGATTLDEYRKY  314 (786)
T ss_pred             HHhccccccCcHHHHHHHHHHHHhcCC-CeEEEEechhhhcCCCcccccccchhhhhHHHHhcCCeEEEEeccHHHHHHH
Confidence            999999999999999999999999866 89999999999999998866 6999999999999999999999999999999


Q ss_pred             hhcChHHHhccceEEecCCCHHHHHHHHHHHHHHHhhhcCCccChHHHHHHHHHhhhhhccCCCcchhhHHHHHHHHHhh
Q 002012          414 IEKDPALERRFQQVFCDQPSVENTISILRGLRERYELHHGVKISDSALVSAAVLADRYITERFLPDKAIDLVDEAAAKLK  493 (982)
Q Consensus       414 ~~~d~al~rRf~~i~i~~Ps~~e~~~IL~~~~~~~~~~~~v~i~~~~l~~~~~~s~r~i~~~~~p~~a~~lld~a~~~~~  493 (982)
                      ++.|+||.|||+.|.+.+|+.++...||+++.++|+.||+|.|+|+++.+++.+|.|||++|++||+|++|+|+|+++++
T Consensus       315 iEKD~AL~RRFQ~V~V~EPs~e~ti~ILrGlk~~yE~hH~V~i~D~Al~aAv~LS~RYI~dR~LPDKAIDLiDeA~a~~~  394 (786)
T COG0542         315 IEKDAALERRFQKVLVDEPSVEDTIAILRGLKERYEAHHGVRITDEALVAAVTLSDRYIPDRFLPDKAIDLLDEAGARVR  394 (786)
T ss_pred             hhhchHHHhcCceeeCCCCCHHHHHHHHHHHHHHHHHccCceecHHHHHHHHHHHHhhcccCCCCchHHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhccCCccchHHHHHHHHHHHHHHhhccccCchhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 002012          494 MEITSKPIELDEIDRAVLKLEMEKLSLKNDTDKASKERLSKLEHDLNSLKQKQKELNDQWSREKDLMSRIRSIKEEIDRV  573 (982)
Q Consensus       494 ~~~~~~~~~l~~~~~~~~~~~~e~~~l~~~~~~~~~~~l~~~~~e~~~l~~~~~~l~~~~~~e~~~~~~~~~~~~~~~~~  573 (982)
                      ++.. .|..++.+++++.++++|...+..+.+.                            .++..+..+..+++     
T Consensus       395 l~~~-~p~~l~~~~~~~~~l~~e~~~~~~e~~~----------------------------~~k~~~~~~~~~~~-----  440 (786)
T COG0542         395 LEID-KPEELDELERELAQLEIEKEALEREQDE----------------------------KEKKLIDEIIKLKE-----  440 (786)
T ss_pred             hccc-CCcchhHHHHHHHHHHHHHHHHhhhhhH----------------------------HHHHHHHHHHHHhh-----
Confidence            9999 9999999999999999988777766430                            01111111111110     


Q ss_pred             HHHHHHHHhhhcHHHHHHhhhcchHHHHHHHHHHHHhHHHHHhcCCccccccCCHhHHHHHHHHhhCCCCcccchhHHHH
Q 002012          574 NLEMEAAERDYDLNRAAELKYGTMISLQRQLEEAEKNLSEFQKSGHSLLREEVTDLDIAEIVSKWTGIPLSSLQQSEREK  653 (982)
Q Consensus       574 ~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~v~~~~i~~~~~~~~gi~~~~~~~~~~~~  653 (982)
                                           +.++.+++++..                  .|++++|+++++.|||||+.++...+.+.
T Consensus       441 ---------------------~~~~~~~~~~~~------------------~v~~~~Ia~vv~~~TgIPv~~l~~~e~~k  481 (786)
T COG0542         441 ---------------------GRIPELEKELEA------------------EVDEDDIAEVVARWTGIPVAKLLEDEKEK  481 (786)
T ss_pred             ---------------------hhhhhHHHHHhh------------------ccCHHHHHHHHHHHHCCChhhhchhhHHH
Confidence                                 122222232221                  18999999999999999999999999999


Q ss_pred             HHHHHHhhhcccccchHHHHHHHHHHHHHhcCCCCCCCCCceEEeecCCCCchHHHHHHHHHHhcCCCCceEEEeccccc
Q 002012          654 LVMLEEVLHKRVIGQDIAVKSVADAIRRSRAGLSDPARPIASFMFMGPTGVGKTELGKALADFLFNTENALVRIDMSEYM  733 (982)
Q Consensus       654 l~~l~~~l~~~iiGq~~a~~~l~~~i~~~~~g~~~~~~p~~~lLf~Gp~GtGKT~lA~~la~~l~~~~~~~v~i~~s~~~  733 (982)
                      +..+++.|.++|+||++|+..|.++|+++++|+.+|++|++++||.||+|||||++|++||..||+++..++++|||+|+
T Consensus       482 ll~le~~L~~rViGQd~AV~avs~aIrraRaGL~dp~rPigsFlF~GPTGVGKTELAkaLA~~Lfg~e~aliR~DMSEy~  561 (786)
T COG0542         482 LLNLERRLKKRVIGQDEAVEAVSDAIRRARAGLGDPNRPIGSFLFLGPTGVGKTELAKALAEALFGDEQALIRIDMSEYM  561 (786)
T ss_pred             HHHHHHHHhcceeChHHHHHHHHHHHHHHhcCCCCCCCCceEEEeeCCCcccHHHHHHHHHHHhcCCCccceeechHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cccccccccCCCCCccccccCCchhHHHhhCCCeEEEEccccccCHHHHHHHHHhhhcCceecCCCcEEecccEEEEEec
Q 002012          734 EKHSVSRLVGAPPGYVGYEEGGQLTEVVRRRPYSVVLFDEIEKAHQDVFNILLQLLDDGRITDSQGRTVSFTNCVVIMTS  813 (982)
Q Consensus       734 ~~~~~~~l~g~~~g~vg~~~~~~l~~~l~~~~~~Vl~lDEidkl~~~~~~~Ll~~le~g~~~d~~g~~~~~~~~iiI~ts  813 (982)
                      ++|++++|+|+|||||||++++.|++++++.|++||+||||||+||+++|.|||+||+|+++|+.|++++|+|++|||||
T Consensus       562 EkHsVSrLIGaPPGYVGyeeGG~LTEaVRr~PySViLlDEIEKAHpdV~nilLQVlDdGrLTD~~Gr~VdFrNtiIImTS  641 (786)
T COG0542         562 EKHSVSRLIGAPPGYVGYEEGGQLTEAVRRKPYSVILLDEIEKAHPDVFNLLLQVLDDGRLTDGQGRTVDFRNTIIIMTS  641 (786)
T ss_pred             HHHHHHHHhCCCCCCceeccccchhHhhhcCCCeEEEechhhhcCHHHHHHHHHHhcCCeeecCCCCEEecceeEEEEec
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCChHHHHHhhhhcccchHHHHHHHHHHHHHHHHhhcChHHHhccccccccCCCChhHHHHHHHHHHHHHHHHHHhCCCC
Q 002012          814 NIGSHYILETLQSVQDSKEAVYEVMKKQVVELARQTFRPEFLNRIDEYIVFQPLDSKEISKIVEIQMNRVKDRLKQKKID  893 (982)
Q Consensus       814 n~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~f~p~ll~Rid~ii~F~pl~~~~l~~il~~~l~~~~~~~~~~~~~  893 (982)
                      |.|+..+.+....   .....++.+++.+++.++++|+|+|++|+|.+|+|.||+++++.+|+..++..+..++.+++++
T Consensus       642 N~Gs~~i~~~~~~---~~~~~~~~~~~~v~~~l~~~F~PEFLNRid~II~F~~L~~~~l~~Iv~~~L~~l~~~L~~~~i~  718 (786)
T COG0542         642 NAGSEEILRDADG---DDFADKEALKEAVMEELKKHFRPEFLNRIDEIIPFNPLSKEVLERIVDLQLNRLAKRLAERGIT  718 (786)
T ss_pred             ccchHHHHhhccc---cccchhhhHHHHHHHHHHhhCCHHHHhhcccEEeccCCCHHHHHHHHHHHHHHHHHHHHhCCce
Confidence            9999887764211   2233467788899999999999999999999999999999999999999999999999988999


Q ss_pred             ccCCHHHHHHHHhcCCCCCCCchHHHHHHHHHHHHHHHHHHHcCCCCCCCEEEEEee
Q 002012          894 LHYTKEAVTLLGILGFDPNFGARPVKRVIQQLVENEIAVAILKGDIKEEDSVIIDVD  950 (982)
Q Consensus       894 l~i~~~a~~~L~~~~~~~~~gaR~L~~~i~~~l~~~la~~~l~~~~~~~~~i~v~~~  950 (982)
                      +++++++.++|++.+|++.||||+|+|+|++.|.++||+.+|.+.+.+|.+|.|+++
T Consensus       719 l~~s~~a~~~l~~~gyd~~~GARpL~R~Iq~~i~~~La~~iL~g~~~~~~~v~v~~~  775 (786)
T COG0542         719 LELSDEAKDFLAEKGYDPEYGARPLRRAIQQEIEDPLADEILFGKIEDGGTVKVDVD  775 (786)
T ss_pred             EEECHHHHHHHHHhccCCCcCchHHHHHHHHHHHHHHHHHHHhcccCCCcEEEEEec
Confidence            999999999999999999999999999999999999999999999999999999998

>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>KOG1051 consensus Chaperone HSP104 and related ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional Back     alignment and domain information
>COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>COG3829 RocR Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3604 FhlA Transcriptional regulator containing GAF, AAA-type ATPase, and DNA binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>KOG0745 consensus Putative ATP-dependent Clp-type protease (AAA+ ATPase superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR01817 nifA Nif-specific regulatory protein Back     alignment and domain information
>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional Back     alignment and domain information
>PRK15424 propionate catabolism operon regulatory protein PrpR; Provisional Back     alignment and domain information
>COG1221 PspF Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK11388 DNA-binding transcriptional regulator DhaR; Provisional Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>KOG2170 consensus ATPase of the AAA+ superfamily [General function prediction only] Back     alignment and domain information
>KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>COG3283 TyrR Transcriptional regulator of aromatic amino acids metabolism [Transcription / Amino acid transport and metabolism] Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PRK10923 glnG nitrogen regulation protein NR(I); Provisional Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02902 spore_lonB ATP-dependent protease LonB Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>COG1220 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] Back     alignment and domain information
>KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02902 spore_lonB ATP-dependent protease LonB Back     alignment and domain information
>KOG0728 consensus 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0740 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0737 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] Back     alignment and domain information
>TIGR01818 ntrC nitrogen regulation protein NR(I) Back     alignment and domain information
>PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15115 response regulator GlrR; Provisional Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>KOG0726 consensus 26S proteasome regulatory complex, ATPase RPT2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0652 consensus 26S proteasome regulatory complex, ATPase RPT5 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>CHL00206 ycf2 Ycf2; Provisional Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10365 transcriptional regulatory protein ZraR; Provisional Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG3284 AcoR Transcriptional activator of acetoin/glycerol metabolism [Secondary metabolites biosynthesis, transport, and catabolism / Transcription] Back     alignment and domain information
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>PRK04132 replication factor C small subunit; Provisional Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG0732 consensus AAA+-type ATPase containing the bromodomain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>CHL00081 chlI Mg-protoporyphyrin IX chelatase Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG2035 consensus Replication factor C, subunit RFC3 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK13407 bchI magnesium chelatase subunit I; Provisional Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00368 Mg chelatase-related protein Back     alignment and domain information
>TIGR02442 Cob-chelat-sub cobaltochelatase subunit Back     alignment and domain information
>KOG0728 consensus 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>CHL00206 ycf2 Ycf2; Provisional Back     alignment and domain information
>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>KOG0990 consensus Replication factor C, subunit RFC5 [Replication, recombination and repair] Back     alignment and domain information
>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0714 MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>PRK13407 bchI magnesium chelatase subunit I; Provisional Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>KOG0652 consensus 26S proteasome regulatory complex, ATPase RPT5 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG3829 RocR Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>KOG0726 consensus 26S proteasome regulatory complex, ATPase RPT2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>CHL00081 chlI Mg-protoporyphyrin IX chelatase Back     alignment and domain information
>KOG0737 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>COG0714 MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>PRK04132 replication factor C small subunit; Provisional Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I Back     alignment and domain information
>COG3604 FhlA Transcriptional regulator containing GAF, AAA-type ATPase, and DNA binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PTZ00111 DNA replication licensing factor MCM4; Provisional Back     alignment and domain information
>smart00350 MCM minichromosome maintenance proteins Back     alignment and domain information
>KOG2035 consensus Replication factor C, subunit RFC3 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>COG1221 PspF Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF Back     alignment and domain information
>COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] Back     alignment and domain information
>TIGR02031 BchD-ChlD magnesium chelatase ATPase subunit D Back     alignment and domain information
>PRK09862 putative ATP-dependent protease; Provisional Back     alignment and domain information
>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model Back     alignment and domain information
>COG1220 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>TIGR01817 nifA Nif-specific regulatory protein Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG1942 consensus DNA helicase, TBP-interacting protein [Replication, recombination and repair] Back     alignment and domain information
>TIGR00764 lon_rel lon-related putative ATP-dependent protease Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>COG4650 RtcR Sigma54-dependent transcription regulator containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>KOG0745 consensus Putative ATP-dependent Clp-type protease (AAA+ ATPase superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PRK13765 ATP-dependent protease Lon; Provisional Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX Back     alignment and domain information
>KOG0740 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional Back     alignment and domain information
>PRK15424 propionate catabolism operon regulatory protein PrpR; Provisional Back     alignment and domain information
>PF10431 ClpB_D2-small: C-terminal, D2-small domain, of ClpB protein ; InterPro: IPR019489 Most Clp ATPases form complexes with peptidase subunits and are involved in protein degradation, though some, such as ClpB, do not associate with peptidases and are involved in protein disaggregation [] Back     alignment and domain information
>KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>TIGR02442 Cob-chelat-sub cobaltochelatase subunit Back     alignment and domain information
>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional Back     alignment and domain information
>PRK11388 DNA-binding transcriptional regulator DhaR; Provisional Back     alignment and domain information
>KOG0732 consensus AAA+-type ATPase containing the bromodomain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins Back     alignment and domain information
>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>COG1239 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolism] Back     alignment and domain information
>PRK05917 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK07276 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model Back     alignment and domain information
>KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00764 lon_rel lon-related putative ATP-dependent protease Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>smart00350 MCM minichromosome maintenance proteins Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins Back     alignment and domain information
>KOG2680 consensus DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>KOG1051 consensus Chaperone HSP104 and related ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG1239 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolism] Back     alignment and domain information
>TIGR00368 Mg chelatase-related protein Back     alignment and domain information
>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A Back     alignment and domain information
>KOG0990 consensus Replication factor C, subunit RFC5 [Replication, recombination and repair] Back     alignment and domain information
>PRK05818 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PTZ00111 DNA replication licensing factor MCM4; Provisional Back     alignment and domain information
>COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF02861 Clp_N: Clp amino terminal domain; InterPro: IPR004176 This short domain is found in one or two copies at the amino terminus of ClpA and ClpB proteins from bacteria and eukaryotes Back     alignment and domain information
>TIGR02031 BchD-ChlD magnesium chelatase ATPase subunit D Back     alignment and domain information
>COG1241 MCM2 Predicted ATPase involved in replication control, Cdc46/Mcm family [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13765 ATP-dependent protease Lon; Provisional Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>PRK10923 glnG nitrogen regulation protein NR(I); Provisional Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>KOG0478 consensus DNA replication licensing factor, MCM4 component [Replication, recombination and repair] Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG1942 consensus DNA helicase, TBP-interacting protein [Replication, recombination and repair] Back     alignment and domain information
>PRK13406 bchD magnesium chelatase subunit D; Provisional Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PRK07132 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>PRK15115 response regulator GlrR; Provisional Back     alignment and domain information
>PF00493 MCM: MCM2/3/5 family This family extends the MCM domain of Prosite Back     alignment and domain information
>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>TIGR01818 ntrC nitrogen regulation protein NR(I) Back     alignment and domain information
>PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>KOG0480 consensus DNA replication licensing factor, MCM6 component [Replication, recombination and repair] Back     alignment and domain information
>PRK05917 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK09862 putative ATP-dependent protease; Provisional Back     alignment and domain information
>COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>KOG2227 consensus Pre-initiation complex, subunit CDC6, AAA+ superfamily ATPase [Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK10365 transcriptional regulatory protein ZraR; Provisional Back     alignment and domain information
>PRK07132 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PF03215 Rad17: Rad17 cell cycle checkpoint protein Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK15455 PrkA family serine protein kinase; Provisional Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PRK07276 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PF12774 AAA_6: Hydrolytic ATP binding site of dynein motor region D1; PDB: 3VKH_A 3VKG_A 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A Back     alignment and domain information
>COG3283 TyrR Transcriptional regulator of aromatic amino acids metabolism [Transcription / Amino acid transport and metabolism] Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>KOG1808 consensus AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>PRK15455 PrkA family serine protein kinase; Provisional Back     alignment and domain information
>KOG2227 consensus Pre-initiation complex, subunit CDC6, AAA+ superfamily ATPase [Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK06581 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK13406 bchD magnesium chelatase subunit D; Provisional Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PRK05818 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>KOG0481 consensus DNA replication licensing factor, MCM5 component [Replication, recombination and repair] Back     alignment and domain information
>KOG0482 consensus DNA replication licensing factor, MCM7 component [Replication, recombination and repair] Back     alignment and domain information
>COG3284 AcoR Transcriptional activator of acetoin/glycerol metabolism [Secondary metabolites biosynthesis, transport, and catabolism / Transcription] Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>KOG3595 consensus Dyneins, heavy chain [Cytoskeleton] Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>KOG1970 consensus Checkpoint RAD17-RFC complex, RAD17/RAD24 component [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>COG5245 DYN1 Dynein, heavy chain [Cytoskeleton] Back     alignment and domain information
>KOG2680 consensus DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF12774 AAA_6: Hydrolytic ATP binding site of dynein motor region D1; PDB: 3VKH_A 3VKG_A 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>PF02861 Clp_N: Clp amino terminal domain; InterPro: IPR004176 This short domain is found in one or two copies at the amino terminus of ClpA and ClpB proteins from bacteria and eukaryotes Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>KOG1514 consensus Origin recognition complex, subunit 1, and related proteins [Replication, recombination and repair] Back     alignment and domain information
>KOG1514 consensus Origin recognition complex, subunit 1, and related proteins [Replication, recombination and repair] Back     alignment and domain information
>KOG0478 consensus DNA replication licensing factor, MCM4 component [Replication, recombination and repair] Back     alignment and domain information
>KOG0477 consensus DNA replication licensing factor, MCM2 component [Replication, recombination and repair] Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) Back     alignment and domain information
>PF03215 Rad17: Rad17 cell cycle checkpoint protein Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query982
1qvr_A854 Crystal Structure Analysis Of Clpb Length = 854 0.0
3pxi_A758 Structure Of Meca108:clpc Length = 758 1e-160
4hse_A397 Crystal Structure Of Clpb Nbd1 In Complex With Guan 1e-133
4fct_A308 Crystal Structure Of The C-Terminal Domain Of Clpb 1e-102
4fcv_A311 Crystal Structure Of The C-Terminal Domain Of Clpb 2e-99
3pxg_A468 Structure Of Meca121 And Clpc1-485 Complex Length = 1e-83
1jbk_A195 Crystal Structure Of The First Nucelotide Binding D 2e-79
2p65_A187 Crystal Structure Of The First Nucleotide Binding D 3e-78
1ksf_X758 Crystal Structure Of Clpa, An Hsp100 Chaperone And 7e-74
1ksf_X758 Crystal Structure Of Clpa, An Hsp100 Chaperone And 8e-65
1g4a_E 443 Crystal Structures Of The Hslvu Peptidase-Atpase Co 7e-04
1do2_A 442 Trigonal Crystal Form Of Heat Shock Locus U (Hslu) 7e-04
1e94_E 449 Hslv-Hslu From E.Coli Length = 449 7e-04
>pdb|1QVR|A Chain A, Crystal Structure Analysis Of Clpb Length = 854 Back     alignment and structure 
Iteration: 1

 Score =  902 bits (2330), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 468/844 (55%), Positives = 616/844 (72%), Gaps = 19/844 (2%)
Query: 97  FTEKAWEGIVGAVDAARVNNQQVVETEHLMKALLEQKDGLARRILTKAGQDNTKVLQATE 156
           +T+ A E +  A   A+    Q ++  HL   LL+ +  LA R+L KAG D   + +  E
Sbjct: 6   WTQAAREALAQAQVLAQRMKHQAIDLPHLWAVLLKDERSLAWRLLEKAGADPKALKELQE 65
Query: 157 DFISKQPKVTGATSGPIVGSNFGLLLSNAQRIKKEMEDDFVSVEHLLLAFLSDDRFGRLL 216
             +++ PKV GA  G  + S     L+ A+ + +E++D +V+V+ L+LA L++   G   
Sbjct: 66  RELARLPKVEGAEVGQYLTSRLSGALNRAEGLMEELKDRYVAVDTLVLA-LAEATPGLPG 124
Query: 217 FNDIRLNEKDLKDAVKAVRGHQRVTDQNPEGKYQALEKYGNDLTELARSGKLDPVIGRDD 276
                   + LK A+K +RG + V  ++ E  Y ALE+YG DLT LA  GKLDPVIGRD+
Sbjct: 125 L-------EALKGALKELRGGRTVQTEHAESTYNALEQYGIDLTRLAAEGKLDPVIGRDE 177
Query: 277 EIRRCIQILSRRTKNNPVIIGEPGVGKTAIAEGLAQRIVRGDVPETLQNRKLISLDMASL 336
           EIRR IQIL RRTKNNPV+IGEPGVGKTAI EGLAQRIV+GDVPE L+ ++++SL M SL
Sbjct: 178 EIRRVIQILLRRTKNNPVLIGEPGVGKTAIVEGLAQRIVKGDVPEGLKGKRIVSLQMGSL 237
Query: 337 VAGTCYRGDFEKRLKAVLKEVTKSNGQIILFIDELHTIIGAGNQSGAMDASNMLKPMLGR 396
           +AG  YRG+FE+RLKAV++EV +S G++ILFIDELHT++GAG   GA+DA NMLKP L R
Sbjct: 238 LAGAKYRGEFEERLKAVIQEVVQSQGEVILFIDELHTVVGAGKAEGAVDAGNMLKPALAR 297
Query: 397 GELRCIGATTLNEYRNYIEKDPALERRFQQVFCDQPSVENTISILRGLRERYELHHGVKI 456
           GELR IGATTL+EYR  IEKDPALERRFQ V+ D+P+VE TISILRGL+E+YE+HHGV+I
Sbjct: 298 GELRLIGATTLDEYRE-IEKDPALERRFQPVYVDEPTVEETISILRGLKEKYEVHHGVRI 356
Query: 457 XXXXXXXXXXXXXRYITERFLPDKAIDLVDEAAAKLKMEITSKPIELDEIDRAVLKLEME 516
                        RYITER LPDKAIDL+DEAAA+L+M + S P E+D ++R  L+LE+E
Sbjct: 357 SDSAIIAAATLSHRYITERRLPDKAIDLIDEAAARLRMALESAPEEIDALERKKLQLEIE 416
Query: 517 KLSLKNDTDKASKERLSKLEHDLNSLKQKQKELNDQWSREKDLMSRIRSIKEEIDRVNLE 576
           + +LK + D  S+ERL  +E ++  L ++  +L  +W RE++++ ++R  +  +D V  E
Sbjct: 417 REALKKEKDPDSQERLKAIEAEIAKLTEEIAKLRAEWEREREILRKLREAQHRLDEVRRE 476
Query: 577 MEAAERDYDLNRAAELKYGTMISLQRQLEEAEKNLSEFQKSGHSLLREEVTDLDIAEIVS 636
           +E AER YDLNRAAEL+YG +  L+ ++E   + L      G   +R EVT+ DIAEIVS
Sbjct: 477 IELAERQYDLNRAAELRYGELPKLEAEVEALSEKLR-----GARFVRLEVTEEDIAEIVS 531
Query: 637 KWTGIPLSSLQQSEREKLVMLEEVLHKRVIGQDIAVKSVADAIRRSRAGLSDPARPIASF 696
           +WTGIP+S L + EREKL+ LEE LHKRV+GQD A+++VADAIRR+RAGL DP RPI SF
Sbjct: 532 RWTGIPVSKLLEGEREKLLRLEEELHKRVVGQDEAIRAVADAIRRARAGLKDPNRPIGSF 591
Query: 697 MFMGPTGVGKTELGKALADFLFNTENALVRIDMSEYMEKHSVSRLVGAPPGYVGYEEGGQ 756
           +F+GPTGVGKTEL K LA  LF+TE A++RIDM+EYMEKH+VSRL+GAPPGYVGYEEGGQ
Sbjct: 592 LFLGPTGVGKTELAKTLAATLFDTEEAMIRIDMTEYMEKHAVSRLIGAPPGYVGYEEGGQ 651
Query: 757 LTEVVRRRPYSVVLFDEIEKAHQDVFNILLQLLDDGRITDSQGRTVSFTNCVVIMTSNIG 816
           LTE VRRRPYSV+LFDEIEKAH DVFNILLQ+LDDGR+TDS GRTV F N V+I+TSN+G
Sbjct: 652 LTEAVRRRPYSVILFDEIEKAHPDVFNILLQILDDGRLTDSHGRTVDFRNTVIILTSNLG 711
Query: 817 SHYILETLQSVQDSKEAVYEVMKKQVVELARQTFRPEFLNRIDEYIVFQPLDSKEISKIV 876
           S  ILE LQ     K   YE ++ +V ++ +Q FRPEFLNR+DE +VF+PL  ++I +IV
Sbjct: 712 SPLILEGLQ-----KGWPYERIRDEVFKVLQQHFRPEFLNRLDEIVVFRPLTKEQIRQIV 766
Query: 877 EIQMNRVKDRLKQKKIDLHYTKEAVTLLGILGFDPNFGARPVKRVIQQLVENEIAVAILK 936
           EIQ++ ++ RL +K+I L  T+ A   L   G+DP FGARP++RVIQ+ +E  +A  IL 
Sbjct: 767 EIQLSYLRARLAEKRISLELTEAAKDFLAERGYDPVFGARPLRRVIQRELETPLAQKILA 826
Query: 937 GDIK 940
           G++K
Sbjct: 827 GEVK 830
>pdb|3PXI|A Chain A, Structure Of Meca108:clpc Length = 758 Back     alignment and structure
>pdb|4HSE|A Chain A, Crystal Structure Of Clpb Nbd1 In Complex With Guanidinium Chloride And Adp Length = 397 Back     alignment and structure
>pdb|4FCT|A Chain A, Crystal Structure Of The C-Terminal Domain Of Clpb Length = 308 Back     alignment and structure
>pdb|4FCV|A Chain A, Crystal Structure Of The C-Terminal Domain Of Clpb Length = 311 Back     alignment and structure
>pdb|3PXG|A Chain A, Structure Of Meca121 And Clpc1-485 Complex Length = 468 Back     alignment and structure
>pdb|1JBK|A Chain A, Crystal Structure Of The First Nucelotide Binding Domain Of Clpb Length = 195 Back     alignment and structure
>pdb|2P65|A Chain A, Crystal Structure Of The First Nucleotide Binding Domain Of Chaperone Clpb1, Putative, (Pv089580) From Plasmodium Vivax Length = 187 Back     alignment and structure
>pdb|1KSF|X Chain X, Crystal Structure Of Clpa, An Hsp100 Chaperone And Regulator Of Clpap Protease: Structural Basis Of Differences In Function Of The Two Aaa+ Atpase Domains Length = 758 Back     alignment and structure
>pdb|1KSF|X Chain X, Crystal Structure Of Clpa, An Hsp100 Chaperone And Regulator Of Clpap Protease: Structural Basis Of Differences In Function Of The Two Aaa+ Atpase Domains Length = 758 Back     alignment and structure
>pdb|1G4A|E Chain E, Crystal Structures Of The Hslvu Peptidase-Atpase Complex Reveal An Atp-Dependent Proteolysis Mechanism Length = 443 Back     alignment and structure
>pdb|1DO2|A Chain A, Trigonal Crystal Form Of Heat Shock Locus U (Hslu) From Escherichia Coli Length = 442 Back     alignment and structure
>pdb|1E94|E Chain E, Hslv-Hslu From E.Coli Length = 449 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query982
1qvr_A854 CLPB protein; coiled coil, AAA ATPase, chaperone; 0.0
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 0.0
3pxg_A468 Negative regulator of genetic competence CLPC/MEC; 0.0
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 0.0
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 1e-172
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 1e-164
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 5e-04
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 1e-131
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 1e-123
2ga8_A359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 9e-72
1khy_A148 CLPB protein; alpha helix, chaperone; 1.95A {Esche 2e-39
3fes_A145 ATP-dependent CLP endopeptidase; alpha-helical bun 2e-23
2y1q_A150 CLPC N-domain, negative regulator of genetic compe 2e-21
3zri_A171 CLPB protein, CLPV; chaperone, HSP100 proteins, AA 3e-16
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-16
3fh2_A146 Probable ATP-dependent protease (heat shock prote; 1e-14
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 4e-10
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 2e-07
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 4e-07
1k6k_A143 ATP-dependent CLP protease ATP-binding subunit CLP 5e-06
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 8e-06
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 2e-05
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 5e-05
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 6e-05
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 6e-05
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 8e-05
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 1e-04
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 2e-04
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 7e-04
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 2e-04
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 3e-04
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 4e-04
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 5e-04
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 6e-04
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 8e-04
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Length = 854 Back     alignment and structure
 Score = 1477 bits (3826), Expect = 0.0
 Identities = 477/855 (55%), Positives = 628/855 (73%), Gaps = 19/855 (2%)

Query: 97  FTEKAWEGIVGAVDAARVNNQQVVETEHLMKALLEQKDGLARRILTKAGQDNTKVLQATE 156
           +T+ A E +  A   A+    Q ++  HL   LL+ +  LA R+L KAG D   + +  E
Sbjct: 6   WTQAAREALAQAQVLAQRMKHQAIDLPHLWAVLLKDERSLAWRLLEKAGADPKALKELQE 65

Query: 157 DFISKQPKVTGATSGPIVGSNFGLLLSNAQRIKKEMEDDFVSVEHLLLAFLSDDRFGRLL 216
             +++ PKV GA  G  + S     L+ A+ + +E++D +V+V+ L+LA           
Sbjct: 66  RELARLPKVEGAEVGQYLTSRLSGALNRAEGLMEELKDRYVAVDTLVLALAEATPGLP-- 123

Query: 217 FNDIRLNEKDLKDAVKAVRGHQRVTDQNPEGKYQALEKYGNDLTELARSGKLDPVIGRDD 276
                   + LK A+K +RG + V  ++ E  Y ALE+YG DLT LA  GKLDPVIGRD+
Sbjct: 124 ------GLEALKGALKELRGGRTVQTEHAESTYNALEQYGIDLTRLAAEGKLDPVIGRDE 177

Query: 277 EIRRCIQILSRRTKNNPVIIGEPGVGKTAIAEGLAQRIVRGDVPETLQNRKLISLDMASL 336
           EIRR IQIL RRTKNNPV+IGEPGVGKTAI EGLAQRIV+GDVPE L+ ++++SL M SL
Sbjct: 178 EIRRVIQILLRRTKNNPVLIGEPGVGKTAIVEGLAQRIVKGDVPEGLKGKRIVSLQMGSL 237

Query: 337 VAGTCYRGDFEKRLKAVLKEVTKSNGQIILFIDELHTIIGAGNQSGAMDASNMLKPMLGR 396
           +AG  YRG+FE+RLKAV++EV +S G++ILFIDELHT++GAG   GA+DA NMLKP L R
Sbjct: 238 LAGAKYRGEFEERLKAVIQEVVQSQGEVILFIDELHTVVGAGKAEGAVDAGNMLKPALAR 297

Query: 397 GELRCIGATTLNEYRNYIEKDPALERRFQQVFCDQPSVENTISILRGLRERYELHHGVKI 456
           GELR IGATTL+EYR  IEKDPALERRFQ V+ D+P+VE TISILRGL+E+YE+HHGV+I
Sbjct: 298 GELRLIGATTLDEYRE-IEKDPALERRFQPVYVDEPTVEETISILRGLKEKYEVHHGVRI 356

Query: 457 SDSALVSAAVLADRYITERFLPDKAIDLVDEAAAKLKMEITSKPIELDEIDRAVLKLEME 516
           SDSA+++AA L+ RYITER LPDKAIDL+DEAAA+L+M + S P E+D ++R  L+LE+E
Sbjct: 357 SDSAIIAAATLSHRYITERRLPDKAIDLIDEAAARLRMALESAPEEIDALERKKLQLEIE 416

Query: 517 KLSLKNDTDKASKERLSKLEHDLNSLKQKQKELNDQWSREKDLMSRIRSIKEEIDRVNLE 576
           + +LK + D  S+ERL  +E ++  L ++  +L  +W RE++++ ++R  +  +D V  E
Sbjct: 417 REALKKEKDPDSQERLKAIEAEIAKLTEEIAKLRAEWEREREILRKLREAQHRLDEVRRE 476

Query: 577 MEAAERDYDLNRAAELKYGTMISLQRQLEEAEKNLSEFQKSGHSLLREEVTDLDIAEIVS 636
           +E AER YDLNRAAEL+YG +  L+ ++E   + L      G   +R EVT+ DIAEIVS
Sbjct: 477 IELAERQYDLNRAAELRYGELPKLEAEVEALSEKLR-----GARFVRLEVTEEDIAEIVS 531

Query: 637 KWTGIPLSSLQQSEREKLVMLEEVLHKRVIGQDIAVKSVADAIRRSRAGLSDPARPIASF 696
           +WTGIP+S L + EREKL+ LEE LHKRV+GQD A+++VADAIRR+RAGL DP RPI SF
Sbjct: 532 RWTGIPVSKLLEGEREKLLRLEEELHKRVVGQDEAIRAVADAIRRARAGLKDPNRPIGSF 591

Query: 697 MFMGPTGVGKTELGKALADFLFNTENALVRIDMSEYMEKHSVSRLVGAPPGYVGYEEGGQ 756
           +F+GPTGVGKTEL K LA  LF+TE A++RIDM+EYMEKH+VSRL+GAPPGYVGYEEGGQ
Sbjct: 592 LFLGPTGVGKTELAKTLAATLFDTEEAMIRIDMTEYMEKHAVSRLIGAPPGYVGYEEGGQ 651

Query: 757 LTEVVRRRPYSVVLFDEIEKAHQDVFNILLQLLDDGRITDSQGRTVSFTNCVVIMTSNIG 816
           LTE VRRRPYSV+LFDEIEKAH DVFNILLQ+LDDGR+TDS GRTV F N V+I+TSN+G
Sbjct: 652 LTEAVRRRPYSVILFDEIEKAHPDVFNILLQILDDGRLTDSHGRTVDFRNTVIILTSNLG 711

Query: 817 SHYILETLQSVQDSKEAVYEVMKKQVVELARQTFRPEFLNRIDEYIVFQPLDSKEISKIV 876
           S  ILE LQ         YE ++ +V ++ +Q FRPEFLNR+DE +VF+PL  ++I +IV
Sbjct: 712 SPLILEGLQKGWP-----YERIRDEVFKVLQQHFRPEFLNRLDEIVVFRPLTKEQIRQIV 766

Query: 877 EIQMNRVKDRLKQKKIDLHYTKEAVTLLGILGFDPNFGARPVKRVIQQLVENEIAVAILK 936
           EIQ++ ++ RL +K+I L  T+ A   L   G+DP FGARP++RVIQ+ +E  +A  IL 
Sbjct: 767 EIQLSYLRARLAEKRISLELTEAAKDFLAERGYDPVFGARPLRRVIQRELETPLAQKILA 826

Query: 937 GDIKEEDSVIIDVDD 951
           G++KE D V +DV  
Sbjct: 827 GEVKEGDRVQVDVGP 841
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Length = 758 Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Length = 468 Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Length = 311 Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Length = 758 Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Length = 758 Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Length = 758 Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Length = 195 Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Length = 187 Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Length = 359 Back     alignment and structure
>1khy_A CLPB protein; alpha helix, chaperone; 1.95A {Escherichia coli} SCOP: a.174.1.1 Length = 148 Back     alignment and structure
>3fes_A ATP-dependent CLP endopeptidase; alpha-helical bundles, structural genomics, PSI-2, protein S initiative; HET: PG4 EPE; 1.82A {Clostridium difficile} Length = 145 Back     alignment and structure
>2y1q_A CLPC N-domain, negative regulator of genetic competence CLPC/MEC; transcription, proteolysis; 1.50A {Bacillus subtilis} PDB: 2y1r_A* 2k77_A Length = 150 Back     alignment and structure
>3zri_A CLPB protein, CLPV; chaperone, HSP100 proteins, AAA+ proteins, T6SS, secretion,; 1.80A {Vibrio cholerae} PDB: 3zrj_A Length = 171 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3fh2_A Probable ATP-dependent protease (heat shock prote; struct genomics, PSI2, MCSG, protein structure initiative; 1.60A {Corynebacterium glutamicum} Length = 146 Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Length = 412 Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Length = 309 Back     alignment and structure
>1k6k_A ATP-dependent CLP protease ATP-binding subunit CLPA; chaperone, ATPase, adaptor binding, X-RAY, structure, N-domain, hydrolase; 1.80A {Escherichia coli} SCOP: a.174.1.1 PDB: 1r6c_X 1r6o_A* 1r6q_A* 1mg9_B* 1lzw_B* 1mbx_A* 1mbv_A 1mbu_A* Length = 143 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* 2pjh_B Length = 489 Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Length = 310 Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Length = 389 Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Length = 444 Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Length = 322 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Length = 355 Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Length = 322 Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Length = 384 Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Length = 272 Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Length = 386 Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Length = 357 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query982
1qvr_A854 CLPB protein; coiled coil, AAA ATPase, chaperone; 100.0
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 100.0
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 100.0
3pxg_A468 Negative regulator of genetic competence CLPC/MEC; 100.0
3cf2_A806 TER ATPase, transitional endoplasmic reticulum ATP 100.0
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 100.0
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 99.96
3hws_A363 ATP-dependent CLP protease ATP-binding subunit CL; 99.93
3fh2_A146 Probable ATP-dependent protease (heat shock prote; 99.91
1khy_A148 CLPB protein; alpha helix, chaperone; 1.95A {Esche 99.91
1um8_A376 ATP-dependent CLP protease ATP-binding subunit CL; 99.9
3fes_A145 ATP-dependent CLP endopeptidase; alpha-helical bun 99.9
2y1q_A150 CLPC N-domain, negative regulator of genetic compe 99.9
1g41_A444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 99.9
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 99.89
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 99.88
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 99.87
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 99.87
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 99.87
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 99.87
1ojl_A304 Transcriptional regulatory protein ZRAR; response 99.87
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 99.86
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 99.86
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 99.86
3zri_A171 CLPB protein, CLPV; chaperone, HSP100 proteins, AA 99.85
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 99.85
3m6a_A 543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 99.84
1ny5_A387 Transcriptional regulator (NTRC family); AAA+ ATPa 99.84
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 99.83
1k6k_A143 ATP-dependent CLP protease ATP-binding subunit CLP 99.83
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 99.83
3dzd_A368 Transcriptional regulator (NTRC family); sigma43 a 99.82
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 99.82
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 99.82
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 99.81
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 99.81
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 99.81
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 99.8
3pvs_A447 Replication-associated recombination protein A; ma 99.79
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 99.78
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 99.77
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 99.77
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 99.77
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 99.76
3cf2_A806 TER ATPase, transitional endoplasmic reticulum ATP 99.75
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 99.75
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 99.75
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 99.75
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 99.74
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 99.74
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 99.74
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 99.73
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 99.73
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 99.72
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 99.72
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 99.72
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 99.72
2chg_A226 Replication factor C small subunit; DNA-binding pr 99.72
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 99.71
2ce7_A476 Cell division protein FTSH; metalloprotease; HET: 99.71
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 99.71
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 99.7
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 99.7
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 99.69
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 99.69
2chq_A319 Replication factor C small subunit; DNA-binding pr 99.68
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 99.68
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 99.67
3pxg_A468 Negative regulator of genetic competence CLPC/MEC; 99.67
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 99.66
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 99.66
2r44_A331 Uncharacterized protein; putative ATPase, structur 99.65
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 99.65
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 99.65
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 99.64
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 99.64
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 99.64
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 99.64
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 99.64
2r62_A268 Cell division protease FTSH homolog; ATPase domain 99.63
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 99.63
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 99.63
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 99.63
1sxj_A516 Activator 1 95 kDa subunit; clamp loader, processi 99.63
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 99.62
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 99.62
3pvs_A 447 Replication-associated recombination protein A; ma 99.62
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 99.61
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 99.61
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 99.61
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 99.6
1g8p_A350 Magnesium-chelatase 38 kDa subunit; parallel beta 99.6
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 99.6
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 99.59
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 99.59
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 99.58
2dhr_A499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 99.58
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 99.58
3nbx_X 500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 99.57
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 99.57
2c9o_A456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 99.57
2r44_A331 Uncharacterized protein; putative ATPase, structur 99.57
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 99.57
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 99.56
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 99.56
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 99.56
2v1u_A387 Cell division control protein 6 homolog; DNA repli 99.55
3hws_A363 ATP-dependent CLP protease ATP-binding subunit CL; 99.55
2chg_A226 Replication factor C small subunit; DNA-binding pr 99.55
1um8_A376 ATP-dependent CLP protease ATP-binding subunit CL; 99.55
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 99.55
1ojl_A304 Transcriptional regulatory protein ZRAR; response 99.55
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 99.54
3bos_A242 Putative DNA replication factor; P-loop containing 99.54
2chq_A319 Replication factor C small subunit; DNA-binding pr 99.54
3m6a_A543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 99.54
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 99.52
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 99.52
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 99.52
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 99.51
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 99.51
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 99.51
3co5_A143 Putative two-component system transcriptional RES 99.51
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 99.51
2r62_A268 Cell division protease FTSH homolog; ATPase domain 99.5
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 99.5
3k1j_A 604 LON protease, ATP-dependent protease LON; ATP-bind 99.49
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 99.49
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 99.49
1g8p_A350 Magnesium-chelatase 38 kDa subunit; parallel beta 99.49
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 99.48
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 99.48
3f9v_A595 Minichromosome maintenance protein MCM; replicativ 99.46
2c9o_A456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 99.45
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 99.44
1qvr_A854 CLPB protein; coiled coil, AAA ATPase, chaperone; 99.44
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 99.44
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 99.44
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 99.44
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 99.44
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 99.43
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 99.42
3bos_A242 Putative DNA replication factor; P-loop containing 99.42
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 99.42
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 99.41
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 99.41
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 99.39
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 99.39
2gno_A305 DNA polymerase III, gamma subunit-related protein; 99.37
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 99.37
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 99.37
2v1u_A387 Cell division control protein 6 homolog; DNA repli 99.36
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 99.35
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 99.34
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 99.33
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 99.32
1sxj_A 516 Activator 1 95 kDa subunit; clamp loader, processi 99.32
3co5_A143 Putative two-component system transcriptional RES 99.31
3nbx_X500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 99.31
3k1j_A604 LON protease, ATP-dependent protease LON; ATP-bind 99.3
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 99.28
2gno_A305 DNA polymerase III, gamma subunit-related protein; 99.21
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 99.2
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 99.2
3f8t_A506 Predicted ATPase involved in replication control, 99.19
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 99.17
3f9v_A595 Minichromosome maintenance protein MCM; replicativ 99.16
1ny5_A387 Transcriptional regulator (NTRC family); AAA+ ATPa 99.07
3dzd_A368 Transcriptional regulator (NTRC family); sigma43 a 99.06
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 98.97
2fna_A357 Conserved hypothetical protein; structural genomic 98.92
1g41_A 444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 98.85
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 98.84
3f8t_A506 Predicted ATPase involved in replication control, 98.73
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 98.7
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 98.69
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 98.68
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 98.62
3fh2_A146 Probable ATP-dependent protease (heat shock prote; 98.61
3fes_A145 ATP-dependent CLP endopeptidase; alpha-helical bun 98.6
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 98.56
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 98.55
2kjq_A149 DNAA-related protein; solution structure, NESG, st 98.54
2qgz_A308 Helicase loader, putative primosome component; str 98.47
2kjq_A149 DNAA-related protein; solution structure, NESG, st 98.46
2y1q_A150 CLPC N-domain, negative regulator of genetic compe 98.45
1jr3_D343 DNA polymerase III, delta subunit; processivity, p 98.45
1jr3_D343 DNA polymerase III, delta subunit; processivity, p 98.44
2qgz_A308 Helicase loader, putative primosome component; str 98.32
1k6k_A143 ATP-dependent CLP protease ATP-binding subunit CLP 98.3
1tue_A212 Replication protein E1; helicase, replication, E1E 98.28
3zri_A171 CLPB protein, CLPV; chaperone, HSP100 proteins, AA 98.23
2r2a_A199 Uncharacterized protein; zonular occludens toxin, 98.19
1khy_A148 CLPB protein; alpha helix, chaperone; 1.95A {Esche 98.17
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 98.15
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 98.12
1u0j_A267 DNA replication protein; AAA+ protein, P-loop atpa 98.09
2vhj_A331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 98.06
1tue_A212 Replication protein E1; helicase, replication, E1E 98.05
1u0j_A267 DNA replication protein; AAA+ protein, P-loop atpa 98.04
2fna_A357 Conserved hypothetical protein; structural genomic 98.0
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 97.92
3upu_A459 ATP-dependent DNA helicase DDA; RECA-like domain, 97.87
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 97.77
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 97.58
2r2a_A199 Uncharacterized protein; zonular occludens toxin, 97.54
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 97.44
3e1s_A574 Exodeoxyribonuclease V, subunit RECD; alpha and be 97.36
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 97.34
2r8r_A228 Sensor protein; KDPD, PFAM02702, MCSG, structural 97.33
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 97.33
2vhj_A331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 97.32
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 97.31
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 97.29
2r8r_A228 Sensor protein; KDPD, PFAM02702, MCSG, structural 97.21
3upu_A 459 ATP-dependent DNA helicase DDA; RECA-like domain, 97.2
3cmw_A1706 Protein RECA, recombinase A; homologous recombinat 97.17
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 96.95
3cmu_A2050 Protein RECA, recombinase A; homologous recombinat 96.95
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 96.95
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 96.79
2cvh_A220 DNA repair and recombination protein RADB; filamen 96.78
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 96.73
2j9r_A214 Thymidine kinase; TK1, DNK, lasso, transferase, AT 96.67
2iut_A574 DNA translocase FTSK; nucleotide-binding, chromoso 96.67
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 96.63
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 96.62
1xp8_A366 RECA protein, recombinase A; recombination, radior 96.58
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 96.55
3crm_A323 TRNA delta(2)-isopentenylpyrophosphate transferase 96.55
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 96.51
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 96.51
3e1s_A574 Exodeoxyribonuclease V, subunit RECD; alpha and be 96.5
4a74_A231 DNA repair and recombination protein RADA; hydrola 96.47
3vaa_A199 Shikimate kinase, SK; structural genomics, center 96.37
1u94_A356 RECA protein, recombinase A; homologous recombinat 96.32
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 96.3
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 96.26
1via_A175 Shikimate kinase; structural genomics, transferase 96.23
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 96.23
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 96.23
3exa_A322 TRNA delta(2)-isopentenylpyrophosphate transferase 96.23
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 96.21
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 96.19
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 96.18
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 96.18
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 96.17
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 96.15
1g5t_A196 COB(I)alamin adenosyltransferase; P-loop protein, 96.14
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 96.14
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 96.13
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 96.12
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 96.11
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 96.1
1g5t_A196 COB(I)alamin adenosyltransferase; P-loop protein, 96.08
3foz_A316 TRNA delta(2)-isopentenylpyrophosphate transferas; 96.06
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 96.05
2eyu_A261 Twitching motility protein PILT; pilus retraction 96.05
1z6t_A 591 APAF-1, apoptotic protease activating factor 1; ca 96.04
2z43_A324 DNA repair and recombination protein RADA; archaea 96.02
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 95.98
1kag_A173 SKI, shikimate kinase I; transferase, structural g 95.96
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 95.95
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 95.95
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 95.93
3a8t_A339 Adenylate isopentenyltransferase; rossmann fold pr 95.92
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 95.91
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 95.89
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 95.88
1w4r_A195 Thymidine kinase; type II, human, cytosolic, phosp 95.87
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 95.86
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 95.86
2cvh_A220 DNA repair and recombination protein RADB; filamen 95.86
1w36_D 608 RECD, exodeoxyribonuclease V alpha chain; recombin 95.85
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 95.84
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 95.83
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 95.81
2ius_A512 DNA translocase FTSK; nucleotide-binding, chromoso 95.81
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 95.81
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 95.78
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 95.77
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 95.77
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 95.75
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 95.74
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 95.74
2a5y_B 549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 95.74
2ewv_A372 Twitching motility protein PILT; pilus retraction 95.73
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 95.71
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 95.69
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 95.69
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 95.67
1xp8_A366 RECA protein, recombinase A; recombination, radior 95.67
1w4r_A195 Thymidine kinase; type II, human, cytosolic, phosp 95.66
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 95.65
1u94_A356 RECA protein, recombinase A; homologous recombinat 95.64
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 95.6
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 95.58
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 95.58
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 95.57
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 95.56
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 95.56
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 95.56
3vaa_A199 Shikimate kinase, SK; structural genomics, center 95.55
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 95.55
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 95.53
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 95.51
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 95.49
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 95.49
3ice_A422 Transcription termination factor RHO; transcriptio 95.48
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 95.47
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 95.46
3io5_A333 Recombination and repair protein; storage dimer, i 95.39
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 95.37
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 95.36
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 95.35
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 95.35
3tlx_A243 Adenylate kinase 2; structural genomics, structura 95.33
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 95.32
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 95.32
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 95.32
2orv_A234 Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 95.32
4a74_A231 DNA repair and recombination protein RADA; hydrola 95.31
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 95.31
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 95.29
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 95.28
1sky_E473 F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp 95.28
2r6a_A454 DNAB helicase, replicative helicase; replication, 95.27
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 95.27
1via_A175 Shikimate kinase; structural genomics, transferase 95.24
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 95.24
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 95.23
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 95.2
3lxw_A247 GTPase IMAP family member 1; immunity, structural 95.18
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 95.18
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 95.14
2vli_A183 Antibiotic resistance protein; transferase, tunica 95.1
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 95.08
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 95.07
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 95.06
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 95.04
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 95.02
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 95.01
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 94.98
1w36_D608 RECD, exodeoxyribonuclease V alpha chain; recombin 94.98
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 94.97
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 94.95
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 94.95
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 94.94
2ga8_A359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 94.88
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 94.87
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 94.85
2xxa_A433 Signal recognition particle protein; protein trans 94.85
3eph_A409 TRNA isopentenyltransferase; transferase, alternat 94.84
2q6t_A444 DNAB replication FORK helicase; hydrolase; 2.90A { 94.83
1kag_A173 SKI, shikimate kinase I; transferase, structural g 94.8
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 94.79
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 94.79
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 94.78
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 94.78
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 94.78
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 94.77
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 94.77
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 94.76
2vli_A183 Antibiotic resistance protein; transferase, tunica 94.75
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 94.75
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 94.74
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 94.73
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 94.71
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 94.68
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 94.64
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 94.63
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 94.62
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 94.61
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 94.61
3fdi_A201 Uncharacterized protein; cytidylate kinase like pr 94.59
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics 94.59
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 94.57
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 94.56
2j9r_A214 Thymidine kinase; TK1, DNK, lasso, transferase, AT 94.56
1vma_A306 Cell division protein FTSY; TM0570, structural gen 94.54
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 94.5
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 94.49
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 94.49
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 94.49
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 94.48
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 94.47
3e2i_A219 Thymidine kinase; Zn-binding, ATP-binding, DNA syn 94.46
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 94.45
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 94.43
2iut_A574 DNA translocase FTSK; nucleotide-binding, chromoso 94.41
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 94.41
3lxx_A239 GTPase IMAP family member 4; structural genomics c 94.38
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 94.37
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 94.36
3io5_A333 Recombination and repair protein; storage dimer, i 94.36
3tlx_A243 Adenylate kinase 2; structural genomics, structura 94.32
2i1q_A322 DNA repair and recombination protein RADA; ATPase, 94.28
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 94.28
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 94.27
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 94.27
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 94.26
3r20_A233 Cytidylate kinase; structural genomics, seattle st 94.26
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 94.25
2grj_A192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 94.24
1vma_A306 Cell division protein FTSY; TM0570, structural gen 94.22
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 94.22
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 94.19
3d3q_A340 TRNA delta(2)-isopentenylpyrophosphate transferase 94.18
2ewv_A372 Twitching motility protein PILT; pilus retraction 94.15
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 94.15
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 94.14
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 94.13
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 94.12
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 94.12
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 94.11
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 94.11
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 94.09
2orv_A234 Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 94.08
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 94.07
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 94.04
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 94.04
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 94.02
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 94.0
1nrj_B218 SR-beta, signal recognition particle receptor beta 93.98
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 93.97
3h1t_A 590 Type I site-specific restriction-modification syst 93.95
3ake_A208 Cytidylate kinase; CMP kinase, CMP complex, open c 93.94
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 93.93
3crm_A323 TRNA delta(2)-isopentenylpyrophosphate transferase 93.91
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 93.9
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 93.9
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 93.9
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 93.87
3zvl_A416 Bifunctional polynucleotide phosphatase/kinase; hy 93.82
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 93.76
4a1f_A338 DNAB helicase, replicative DNA helicase; hydrolase 93.75
2zts_A251 Putative uncharacterized protein PH0186; KAIC like 93.72
2og2_A359 Putative signal recognition particle receptor; nuc 93.71
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 93.69
1c9k_A180 COBU, adenosylcobinamide kinase; alpha/beta struct 93.69
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 93.67
3bgw_A444 DNAB-like replicative helicase; ATPase, replicatio 93.66
3foz_A316 TRNA delta(2)-isopentenylpyrophosphate transferas; 93.66
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 93.65
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 93.63
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 93.61
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 93.61
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 93.61
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 93.59
2ga8_A359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 93.58
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 93.56
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 93.54
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 93.54
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 93.53
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 93.5
2h92_A219 Cytidylate kinase; rossmann fold, transferase; HET 93.48
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 93.47
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 93.47
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 93.39
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 93.37
1wb9_A800 DNA mismatch repair protein MUTS; DNA-binding, ATP 93.36
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 93.34
2v3c_C432 SRP54, signal recognition 54 kDa protein; nucleoti 93.34
3a8t_A339 Adenylate isopentenyltransferase; rossmann fold pr 93.32
3vkw_A446 Replicase large subunit; alpha/beta domain, helica 93.31
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 93.24
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 93.2
3thx_B918 DNA mismatch repair protein MSH3; ABC family ATPas 93.2
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 93.19
2j37_W504 Signal recognition particle 54 kDa protein (SRP54) 93.19
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 93.18
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 93.17
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 93.13
1q3t_A236 Cytidylate kinase; nucleotide monophosphate kinase 93.1
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 93.05
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 93.0
2qmh_A205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 92.97
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 92.96
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 92.92
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 92.92
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 92.9
3r20_A233 Cytidylate kinase; structural genomics, seattle st 92.87
2r6a_A454 DNAB helicase, replicative helicase; replication, 92.87
1odf_A290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 92.86
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 92.86
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 92.81
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 92.8
1g8f_A511 Sulfate adenylyltransferase; alpha-beta protein, b 92.79
4b3f_X 646 DNA-binding protein smubp-2; hydrolase, helicase; 92.72
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 92.71
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 92.7
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 92.68
1q57_A503 DNA primase/helicase; dntpase, DNA replication, tr 92.67
2f6r_A281 COA synthase, bifunctional coenzyme A synthase; 18 92.65
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 92.63
3b6e_A216 Interferon-induced helicase C domain-containing P; 92.62
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 92.58
2xxa_A433 Signal recognition particle protein; protein trans 92.55
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 92.53
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 92.53
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
Probab=100.00  E-value=6.4e-104  Score=993.58  Aligned_cols=850  Identities=56%  Similarity=0.896  Sum_probs=740.0

Q ss_pred             CCcccccHHHHHHHHHHHHHHHHcCCCCcCHHHHHHHHhcCCCcHHHHHHHHcCCChHHHHHHHHHhhccCCCCCCCCCC
Q 002012           92 ITPTEFTEKAWEGIVGAVDAARVNNQQVVETEHLMKALLEQKDGLARRILTKAGQDNTKVLQATEDFISKQPKVTGATSG  171 (982)
Q Consensus        92 ~~~~~ft~~a~~~l~~A~~~A~~~~~~~v~~eHlLlaLl~~~~~~~~~iL~~~gv~~~~l~~~~~~~~~~~~~~~~~~~~  171 (982)
                      |||++||++++++|..|+++|+++||++|+|||||+|||+++++.+.++|.++|+|++.++.++...+++.|...+....
T Consensus         1 ~~~~~~t~~a~~al~~A~~~A~~~~h~~i~~eHLLlaLl~~~~~~~~~iL~~~gvd~~~l~~~l~~~l~~~p~~~~~~~~   80 (854)
T 1qvr_A            1 MNLERWTQAAREALAQAQVLAQRMKHQAIDLPHLWAVLLKDERSLAWRLLEKAGADPKALKELQERELARLPKVEGAEVG   80 (854)
T ss_dssp             ---CCSCHHHHHHHHHHHHHHHHTTCSEECHHHHHHHHCCSSSSHHHHHHHTTSSCHHHHHHHHHHHHHTSCCCCGGGTT
T ss_pred             CChhhhCHHHHHHHHHHHHHHHHcCCCCccHHHHHHHHHhCCCcHHHHHHHHcCCCHHHHHHHHHHHHhhCCCCCCCCCC
Confidence            78999999999999999999999999999999999999999999999999999999999999999999998876543346


Q ss_pred             CccChhhHHHHHHHHHHHHHcCCCccCHHHHHHHHhcCCcccccccccccCCHHHHHHHHHhhhcccccccCCCCchhHH
Q 002012          172 PIVGSNFGLLLSNAQRIKKEMEDDFVSVEHLLLAFLSDDRFGRLLFNDIRLNEKDLKDAVKAVRGHQRVTDQNPEGKYQA  251 (982)
Q Consensus       172 ~~~s~~~~~vl~~A~~~a~~~g~~~I~~ehLllall~~~~~a~~lL~~~gi~~~~l~~~i~~~~~~~~~~~~~~~~~~~~  251 (982)
                      +++|+.++++|+.|+.+|..+|++||+++|||+||+++.+.+        ++...++..+....+...+.+..++..++.
T Consensus        81 ~~~S~~~~~vL~~A~~~a~~~g~~~I~~ehlLlall~~~~~~--------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  152 (854)
T 1qvr_A           81 QYLTSRLSGALNRAEGLMEELKDRYVAVDTLVLALAEATPGL--------PGLEALKGALKELRGGRTVQTEHAESTYNA  152 (854)
T ss_dssp             CEECHHHHHHHHHHHHHHHTTTCSSCCHHHHHHHHHHHSTTS--------CCHHHHHHHHTSSCSCCSSCSSCCCCCCSH
T ss_pred             CCCCHHHHHHHHHHHHHHHHcCCcEeeHHHHHHHHHhccccc--------CCHHHHHHHHHHhccccccccccccccchh
Confidence            899999999999999999999999999999999999544322        889999999988776555544555556788


Q ss_pred             HHHhhhhhHHHhhcCCCCCcccchHHHHHHHHHhccCCCCCcEEeCCCCCcHHHHHHHHHHHhhcCCCCCCCCCCeEEEE
Q 002012          252 LEKYGNDLTELARSGKLDPVIGRDDEIRRCIQILSRRTKNNPVIIGEPGVGKTAIAEGLAQRIVRGDVPETLQNRKLISL  331 (982)
Q Consensus       252 l~~~~~~l~~~~~~~~l~~liG~~~~i~~l~~~L~~~~~~~iLL~GppGvGKT~la~~la~~l~~~~~p~~l~~~~v~~l  331 (982)
                      |++|+.+|++++++++++++||+++++++++++|.++.++|++|+||||||||++|+++|+.+..+.+|..+.+.+++.+
T Consensus       153 l~~~~~~l~~~~r~~~ld~viGr~~~i~~l~~~l~~~~~~~vlL~G~pG~GKT~la~~la~~l~~~~~p~~l~~~~~~~l  232 (854)
T 1qvr_A          153 LEQYGIDLTRLAAEGKLDPVIGRDEEIRRVIQILLRRTKNNPVLIGEPGVGKTAIVEGLAQRIVKGDVPEGLKGKRIVSL  232 (854)
T ss_dssp             HHHHEEEHHHHHHTTCSCCCCSCHHHHHHHHHHHHCSSCCCCEEEECTTSCHHHHHHHHHHHHHHTCSCTTSTTCEEEEE
T ss_pred             HHHHHHhHHHHHhcCCCcccCCcHHHHHHHHHHHhcCCCCceEEEcCCCCCHHHHHHHHHHHHhcCCCchhhcCCeEEEe
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ecccccccccccccHHHHHHHHHHHHHhcCCCeEEEEccchhhhhCCCCCchhhHHHHHHhhhcCCCeEEEEecCchhHh
Q 002012          332 DMASLVAGTCYRGDFEKRLKAVLKEVTKSNGQIILFIDELHTIIGAGNQSGAMDASNMLKPMLGRGELRCIGATTLNEYR  411 (982)
Q Consensus       332 ~~~~l~~~~~~~g~~e~~l~~l~~~~~~~~~~~IL~IDEi~~l~~~~~~~~~~~~~~~L~~~le~g~i~vI~at~~~~~~  411 (982)
                      +++.+.+|..+.|+++.+++.++..+...++++||||||+|.+.+.+...+..++.+.|+++++++.+.+|++||.++|.
T Consensus       233 ~~~~l~~g~~~~g~~~~~l~~~~~~~~~~~~~~iL~IDEi~~l~~~~~~~g~~~~~~~L~~~l~~~~i~~I~at~~~~~~  312 (854)
T 1qvr_A          233 QMGSLLAGAKYRGEFEERLKAVIQEVVQSQGEVILFIDELHTVVGAGKAEGAVDAGNMLKPALARGELRLIGATTLDEYR  312 (854)
T ss_dssp             CC-----------CHHHHHHHHHHHHHTTCSSEEEEECCC-------------------HHHHHTTCCCEEEEECHHHHH
T ss_pred             ehHHhhccCccchHHHHHHHHHHHHHHhcCCCeEEEEecHHHHhccCCccchHHHHHHHHHHHhCCCeEEEEecCchHHh
Confidence            99999998899999999999999999876678999999999999877766778889999999999999999999999998


Q ss_pred             hhhhcChHHHhccceEEecCCCHHHHHHHHHHHHHHHhhhcCCccChHHHHHHHHHhhhhhccCCCcchhhHHHHHHHHH
Q 002012          412 NYIEKDPALERRFQQVFCDQPSVENTISILRGLRERYELHHGVKISDSALVSAAVLADRYITERFLPDKAIDLVDEAAAK  491 (982)
Q Consensus       412 ~~~~~d~al~rRf~~i~i~~Ps~~e~~~IL~~~~~~~~~~~~v~i~~~~l~~~~~~s~r~i~~~~~p~~a~~lld~a~~~  491 (982)
                      + +.++++|.|||+.|.+++|+.+++..||+.+..+|+.+|++.++++++..++.++.+|+.++++|+++++++|+|++.
T Consensus       313 ~-~~~d~aL~rRf~~i~l~~p~~~e~~~iL~~~~~~~~~~~~~~i~~~al~~~~~ls~r~i~~~~lp~kai~lldea~a~  391 (854)
T 1qvr_A          313 E-IEKDPALERRFQPVYVDEPTVEETISILRGLKEKYEVHHGVRISDSAIIAAATLSHRYITERRLPDKAIDLIDEAAAR  391 (854)
T ss_dssp             H-HTTCTTTCSCCCCEEECCCCHHHHHHHHHHHHHHHHHHTTCEECHHHHHHHHHHHHHHCCSSCTHHHHHHHHHHHHHH
T ss_pred             h-hccCHHHHhCCceEEeCCCCHHHHHHHHHhhhhhhhhhcCCCCCHHHHHHHHHHHhhhcccccChHHHHHHHHHHHHH
Confidence            8 789999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhhhccCCccchHHHHHHHHHHHHHHhhccccCchhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 002012          492 LKMEITSKPIELDEIDRAVLKLEMEKLSLKNDTDKASKERLSKLEHDLNSLKQKQKELNDQWSREKDLMSRIRSIKEEID  571 (982)
Q Consensus       492 ~~~~~~~~~~~l~~~~~~~~~~~~e~~~l~~~~~~~~~~~l~~~~~e~~~l~~~~~~l~~~~~~e~~~~~~~~~~~~~~~  571 (982)
                      +++...+.|..++.+++++.+++.+...+..+.+..+.+++..++.|+..++++++.+..+|.+++..++.++.++++++
T Consensus       392 ~~~~~~~~p~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  471 (854)
T 1qvr_A          392 LRMALESAPEEIDALERKKLQLEIEREALKKEKDPDSQERLKAIEAEIAKLTEEIAKLRAEWEREREILRKLREAQHRLD  471 (854)
T ss_dssp             HHHTTTTHHHHHHHHHHHHHHHHHHHHHHSSCSSHHHHSCTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHhhccCCchhHHHHHHHHHHHHHHHHHHHhccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            99999999999999999999999999999999888899999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHhhhcHHHHHHhhhcchHHHHHHHHHHHHhHHHHHhcCCccccccCCHhHHHHHHHHhhCCCCcccchhHH
Q 002012          572 RVNLEMEAAERDYDLNRAAELKYGTMISLQRQLEEAEKNLSEFQKSGHSLLREEVTDLDIAEIVSKWTGIPLSSLQQSER  651 (982)
Q Consensus       572 ~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~v~~~~i~~~~~~~~gi~~~~~~~~~~  651 (982)
                      .++..++.+++.+++.+++++.|+.++.+++++...+..     ......+...++.+++..+++.|+|+|..++...+.
T Consensus       472 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-----~~~~~~~~~~v~~~~l~~~v~~~~~ip~~~~~~~~~  546 (854)
T 1qvr_A          472 EVRREIELAERQYDLNRAAELRYGELPKLEAEVEALSEK-----LRGARFVRLEVTEEDIAEIVSRWTGIPVSKLLEGER  546 (854)
T ss_dssp             HHHHHHHHHTTTTCHHHHHHHHTTHHHHHHHHHHHHHHH-----SSSCSSCCSEECHHHHHHHHHTTSSCHHHHTTCCHH
T ss_pred             HHhhhHHHHHhcccHHHHHHHhhhhhHHHHHHHHHHHhh-----hcccccccCCcCHHHHHHHHHHHhCCChHhhcHHHH
Confidence            999999999999999999999999999999988766542     223345667899999999999999999988877777


Q ss_pred             HHHHHHHHhhhcccccchHHHHHHHHHHHHHhcCCCCCCCCCceEEeecCCCCchHHHHHHHHHHhcCCCCceEEEeccc
Q 002012          652 EKLVMLEEVLHKRVIGQDIAVKSVADAIRRSRAGLSDPARPIASFMFMGPTGVGKTELGKALADFLFNTENALVRIDMSE  731 (982)
Q Consensus       652 ~~l~~l~~~l~~~iiGq~~a~~~l~~~i~~~~~g~~~~~~p~~~lLf~Gp~GtGKT~lA~~la~~l~~~~~~~v~i~~s~  731 (982)
                      ..+..+++.++..|+||+.+++.+..++.+.+.|+.+|.+|.+++||+||||||||++|++||+.+++.+.+++.+||++
T Consensus       547 ~~l~~l~~~l~~~viG~~~a~~~l~~~i~~~~~g~~~~~~p~~~vLl~Gp~GtGKT~lA~~la~~~~~~~~~~i~i~~~~  626 (854)
T 1qvr_A          547 EKLLRLEEELHKRVVGQDEAIRAVADAIRRARAGLKDPNRPIGSFLFLGPTGVGKTELAKTLAATLFDTEEAMIRIDMTE  626 (854)
T ss_dssp             HHHHSHHHHHHHHSCSCHHHHHHHHHHHHHHGGGCSCSSSCSEEEEEBSCSSSSHHHHHHHHHHHHHSSGGGEEEECTTT
T ss_pred             HHHHHHHHHHhcccCCcHHHHHHHHHHHHHHhcccCCCCCCceEEEEECCCCCCHHHHHHHHHHHhcCCCCcEEEEechh
Confidence            77888888999999999999999999999999999999999989999999999999999999999998889999999999


Q ss_pred             cccccccccccCCCCCccccccCCchhHHHhhCCCeEEEEccccccCHHHHHHHHHhhhcCceecCCCcEEecccEEEEE
Q 002012          732 YMEKHSVSRLVGAPPGYVGYEEGGQLTEVVRRRPYSVVLFDEIEKAHQDVFNILLQLLDDGRITDSQGRTVSFTNCVVIM  811 (982)
Q Consensus       732 ~~~~~~~~~l~g~~~g~vg~~~~~~l~~~l~~~~~~Vl~lDEidkl~~~~~~~Ll~~le~g~~~d~~g~~~~~~~~iiI~  811 (982)
                      +.+.+..+.++|.+++|+|+..++.+++.++..+++|||||||+++++++++.|+++|++|.+++..|+.++|.+++||+
T Consensus       627 ~~~~~~~s~l~g~~~~~~G~~~~g~l~~~~~~~~~~vl~lDEi~~l~~~~~~~Ll~~l~~~~~~~~~g~~vd~~~~iiI~  706 (854)
T 1qvr_A          627 YMEKHAVSRLIGAPPGYVGYEEGGQLTEAVRRRPYSVILFDEIEKAHPDVFNILLQILDDGRLTDSHGRTVDFRNTVIIL  706 (854)
T ss_dssp             CCSSGGGGGC--------------CHHHHHHHCSSEEEEESSGGGSCHHHHHHHHHHHTTTEECCSSSCCEECTTEEEEE
T ss_pred             ccchhHHHHHcCCCCCCcCccccchHHHHHHhCCCeEEEEecccccCHHHHHHHHHHhccCceECCCCCEeccCCeEEEE
Confidence            99988889999999999999998889999999999999999999999999999999999999999999999999999999


Q ss_pred             ecCCChHHHHHhhhhcccchHHHHHHHHHHHHHHHHhhcChHHHhccccccccCCCChhHHHHHHHHHHHHHHHHHHhCC
Q 002012          812 TSNIGSHYILETLQSVQDSKEAVYEVMKKQVVELARQTFRPEFLNRIDEYIVFQPLDSKEISKIVEIQMNRVKDRLKQKK  891 (982)
Q Consensus       812 tsn~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~f~p~ll~Rid~ii~F~pl~~~~l~~il~~~l~~~~~~~~~~~  891 (982)
                      |||.+...+.+... .+.    .+..+...+.+.+++.|+|+|++|||.++.|.|++.+++..|+..++.++..++...+
T Consensus       707 tsn~~~~~~~~~~~-~~~----~~~~l~~~v~~~~~~~f~~~l~~Rl~~~i~~~pl~~edi~~i~~~~l~~~~~~~~~~~  781 (854)
T 1qvr_A          707 TSNLGSPLILEGLQ-KGW----PYERIRDEVFKVLQQHFRPEFLNRLDEIVVFRPLTKEQIRQIVEIQLSYLRARLAEKR  781 (854)
T ss_dssp             ECCTTHHHHHHHHH-TTC----CHHHHHHHHHHHHHTTSCHHHHHTCSBCCBCCCCCHHHHHHHHHHHHHHHHHHHHTTT
T ss_pred             ecCcChHHHhhhcc-ccc----chHHHHHHHHHHHHhhCCHHHHHhcCeEEeCCCCCHHHHHHHHHHHHHHHHHHHHhCC
Confidence            99998876654211 110    1345667777778999999999999999999999999999999999999999888777


Q ss_pred             CCccCCHHHHHHHHhcCCCCCCCchHHHHHHHHHHHHHHHHHHHcCCCCCCCEEEEEeecCCCCCCCCCCCceEEEecc
Q 002012          892 IDLHYTKEAVTLLGILGFDPNFGARPVKRVIQQLVENEIAVAILKGDIKEEDSVIIDVDDSPSAKDLPPRNKLCIKKLE  970 (982)
Q Consensus       892 ~~l~i~~~a~~~L~~~~~~~~~gaR~L~~~i~~~l~~~la~~~l~~~~~~~~~i~v~~~~~~~~~~~~~~~~l~~~~~~  970 (982)
                      +.+.++++++++|+.++|++.+|+|+|+++|++.+..++++.++.+++++|++|.|+++          ++.++|...+
T Consensus       782 ~~~~~~~~a~~~L~~~~~~~~gn~R~L~~~i~~~~~~~~~~~i~~~~~~~~~~~~~~~~----------~~~~~~~~~~  850 (854)
T 1qvr_A          782 ISLELTEAAKDFLAERGYDPVFGARPLRRVIQRELETPLAQKILAGEVKEGDRVQVDVG----------PAGLVFAVPA  850 (854)
T ss_dssp             CEEEECHHHHHHHHHHHCBTTTBTSTHHHHHHHHTHHHHHHHHHHTSSCSSCEEEEECC----------TTSCEEESCC
T ss_pred             ceEEECHHHHHHHHHcCCCCCCChHHHHHHHHHHHHHHHHHHHHhCcCCCCCEEEEEEE----------CCEEEEEecC
Confidence            77899999999999999998899999999999999999999999999999999999886          4567776544
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>3fh2_A Probable ATP-dependent protease (heat shock prote; struct genomics, PSI2, MCSG, protein structure initiative; 1.60A {Corynebacterium glutamicum} Back     alignment and structure
>1khy_A CLPB protein; alpha helix, chaperone; 1.95A {Escherichia coli} SCOP: a.174.1.1 Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>3fes_A ATP-dependent CLP endopeptidase; alpha-helical bundles, structural genomics, PSI-2, protein S initiative; HET: PG4 EPE; 1.82A {Clostridium difficile} Back     alignment and structure
>2y1q_A CLPC N-domain, negative regulator of genetic competence CLPC/MEC; transcription, proteolysis; 1.50A {Bacillus subtilis} PDB: 2y1r_A* 2k77_A Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3zri_A CLPB protein, CLPV; chaperone, HSP100 proteins, AAA+ proteins, T6SS, secretion,; 1.80A {Vibrio cholerae} PDB: 3zrj_A Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A* Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>1k6k_A ATP-dependent CLP protease ATP-binding subunit CLPA; chaperone, ATPase, adaptor binding, X-RAY, structure, N-domain, hydrolase; 1.80A {Escherichia coli} SCOP: a.174.1.1 PDB: 1r6c_X 1r6o_A* 1r6q_A* 1mg9_B* 1lzw_B* 1mbx_A* 1mbv_A 1mbu_A* Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>3f8t_A Predicted ATPase involved in replication control, CDC46/MCM family; helicase, MCM homolog, DNA replication, ATP-binding, DNA-binding; 1.90A {Methanopyrus kandleri AV19} Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} Back     alignment and structure
>1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A* Back     alignment and structure
>3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>3f8t_A Predicted ATPase involved in replication control, CDC46/MCM family; helicase, MCM homolog, DNA replication, ATP-binding, DNA-binding; 1.90A {Methanopyrus kandleri AV19} Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>3fh2_A Probable ATP-dependent protease (heat shock prote; struct genomics, PSI2, MCSG, protein structure initiative; 1.60A {Corynebacterium glutamicum} Back     alignment and structure
>3fes_A ATP-dependent CLP endopeptidase; alpha-helical bundles, structural genomics, PSI-2, protein S initiative; HET: PG4 EPE; 1.82A {Clostridium difficile} Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>2y1q_A CLPC N-domain, negative regulator of genetic competence CLPC/MEC; transcription, proteolysis; 1.50A {Bacillus subtilis} PDB: 2y1r_A* 2k77_A Back     alignment and structure
>1jr3_D DNA polymerase III, delta subunit; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1jqj_C* 1xxh_A* 1xxi_A* 3glf_A* 3glg_A* 3glh_A* 3gli_A* Back     alignment and structure
>1jr3_D DNA polymerase III, delta subunit; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1jqj_C* 1xxh_A* 1xxi_A* 3glf_A* 3glg_A* 3glh_A* 3gli_A* Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>1k6k_A ATP-dependent CLP protease ATP-binding subunit CLPA; chaperone, ATPase, adaptor binding, X-RAY, structure, N-domain, hydrolase; 1.80A {Escherichia coli} SCOP: a.174.1.1 PDB: 1r6c_X 1r6o_A* 1r6q_A* 1mg9_B* 1lzw_B* 1mbx_A* 1mbv_A 1mbu_A* Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>3zri_A CLPB protein, CLPV; chaperone, HSP100 proteins, AAA+ proteins, T6SS, secretion,; 1.80A {Vibrio cholerae} PDB: 3zrj_A Back     alignment and structure
>2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} Back     alignment and structure
>1khy_A CLPB protein; alpha helix, chaperone; 1.95A {Escherichia coli} SCOP: a.174.1.1 Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* Back     alignment and structure
>2iut_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- cell division, DNA translocation, KOPS, membrane; HET: DNA SAP; 2.25A {Pseudomonas aeruginosa} PDB: 2iuu_A* Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>2ius_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A* Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>3fdi_A Uncharacterized protein; cytidylate kinase like protein, PSI, MCSG, PRK04182 class ME structural genomics, protein structure initiative; 2.20A {Eubacterium ventriosum} Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>2iut_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- cell division, DNA translocation, KOPS, membrane; HET: DNA SAP; 2.25A {Pseudomonas aeruginosa} PDB: 2iuu_A* Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>1c9k_A COBU, adenosylcobinamide kinase; alpha/beta structure rossmann fold P-loop, transferase; HET: 5GP; 2.20A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1cbu_A Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>1wb9_A DNA mismatch repair protein MUTS; DNA-binding, ATP-binding, DNA binding, DNA repair, mismatch recognition; HET: DNA ADP; 2.10A {Escherichia coli} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1wbb_A* 1e3m_A* 1oh5_A* 1oh6_A* 1oh7_A* 1oh8_A* 1w7a_A* 2wtu_A* 1wbd_A* 1ng9_A* 3k0s_A* Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B* Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 982
d1qvra2387 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus 1e-153
d1qvra3315 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus 1e-109
d1r6bx2268 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, A 1e-101
d1r6bx3315 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, A 1e-89
d1jbka_195 c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia col 2e-86
d1um8a_364 c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 2 5e-49
d1w44a_321 c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [Ta 4e-45
d1ofha_309 c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId 4e-37
d1w5sa2287 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-t 4e-36
d1w5sa2287 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-t 3e-04
d1qvra1145 a.174.1.1 (A:4-148) N-terminal domain of ClpB (hea 4e-31
d1khya_139 a.174.1.1 (A:) N-terminal domain of ClpB (heat sho 6e-24
d1fnna2276 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrob 2e-23
d1fnna2276 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrob 6e-05
d1gvnb_273 c.37.1.21 (B:) Plasmid maintenance system epsilon/ 9e-15
d1k6ka_142 a.174.1.1 (A:) N-terminal, ClpS-binding domain of 2e-12
d1ixza_247 c.37.1.20 (A:) AAA domain of cell division protein 4e-11
d1ixza_247 c.37.1.20 (A:) AAA domain of cell division protein 2e-05
d1g41a_ 443 c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId 4e-11
d1lv7a_256 c.37.1.20 (A:) AAA domain of cell division protein 2e-10
d1lv7a_256 c.37.1.20 (A:) AAA domain of cell division protein 5e-05
d1sxjd2237 c.37.1.20 (D:26-262) Replication factor C2 {Baker' 1e-09
d1sxjd2237 c.37.1.20 (D:26-262) Replication factor C2 {Baker' 1e-05
d1ny5a2247 c.37.1.20 (A:138-384) Transcriptional activator si 6e-09
d1ny5a2247 c.37.1.20 (A:138-384) Transcriptional activator si 0.002
d1svma_362 c.37.1.20 (A:) Papillomavirus large T antigen heli 5e-08
d1svma_362 c.37.1.20 (A:) Papillomavirus large T antigen heli 4e-04
d1d2na_246 c.37.1.20 (A:) Hexamerization domain of N-ethylmal 2e-04
d1ixsb2239 c.37.1.20 (B:4-242) Holliday junction helicase Ruv 5e-04
d1in4a2238 c.37.1.20 (A:17-254) Holliday junction helicase Ru 0.002
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Length = 387 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: ClpB, AAA+ modules
species: Thermus thermophilus [TaxId: 274]

 Score =  457 bits (1176), Expect = e-153
 Identities = 237/392 (60%), Positives = 307/392 (78%), Gaps = 6/392 (1%)

Query: 249 YQALEKYGNDLTELARSGKLDPVIGRDDEIRRCIQILSRRTKNNPVIIGEPGVGKTAIAE 308
           Y ALE+YG DLT LA  GKLDPVIGRD+EIRR IQIL RRTKNNPV+IGEPGVGKTAI E
Sbjct: 2   YNALEQYGIDLTRLAAEGKLDPVIGRDEEIRRVIQILLRRTKNNPVLIGEPGVGKTAIVE 61

Query: 309 GLAQRIVRGDVPETLQNRKLISLDMASLVAGTCYRGDFEKRLKAVLKEVTKSNGQIILFI 368
           GLAQRIV+GDVPE L+ ++++SL M SL+AG  YRG+FE+RLKAV++EV +S G++ILFI
Sbjct: 62  GLAQRIVKGDVPEGLKGKRIVSLQMGSLLAGAKYRGEFEERLKAVIQEVVQSQGEVILFI 121

Query: 369 DELHTIIGAGNQSGAMDASNMLKPMLGRGELRCIGATTLNEYRNYIEKDPALERRFQQVF 428
           DELHT++GAG   GA+DA NMLKP L RGELR IGATTL+EYR    KDPALERRFQ V+
Sbjct: 122 DELHTVVGAGKAEGAVDAGNMLKPALARGELRLIGATTLDEYREIE-KDPALERRFQPVY 180

Query: 429 CDQPSVENTISILRGLRERYELHHGVKISDSALVSAAVLADRYITERFLPDKAIDLVDEA 488
            D+P+VE TISILRGL+E+YE+HHGV+ISDSA+++AA L+ RYITER LPDKAIDL+DEA
Sbjct: 181 VDEPTVEETISILRGLKEKYEVHHGVRISDSAIIAAATLSHRYITERRLPDKAIDLIDEA 240

Query: 489 AAKLKMEITSKPIELDEIDRAVLKLEMEKLSLKNDTDKASKERLSKLEHDLNSLKQKQKE 548
           AA+L+M + S P E+D ++R  L+LE+E+ +LK + D  S+ERL  +E ++  L ++  +
Sbjct: 241 AARLRMALESAPEEIDALERKKLQLEIEREALKKEKDPDSQERLKAIEAEIAKLTEEIAK 300

Query: 549 LNDQWSREKDLMSRIRSIKEEIDRVNLEMEAAERDYDLNRAAELKYGTMISLQRQLEEAE 608
           L  +W RE++++ ++R  +  +D V  E+E AER YDLNRAAEL+YG +  L+ ++E   
Sbjct: 301 LRAEWEREREILRKLREAQHRLDEVRREIELAERQYDLNRAAELRYGELPKLEAEVEALS 360

Query: 609 KNLSEFQKSGHSLLREEVTDLDIAEIVSKWTG 640
           + L      G   +R EVT+ DIAEIVS+WTG
Sbjct: 361 EKL-----RGARFVRLEVTEEDIAEIVSRWTG 387
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Length = 315 Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Length = 268 Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Length = 315 Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Length = 195 Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Length = 364 Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Length = 321 Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Length = 309 Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Length = 287 Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Length = 287 Back     information, alignment and structure
>d1qvra1 a.174.1.1 (A:4-148) N-terminal domain of ClpB (heat shock protein F84.1) {Thermus thermophilus [TaxId: 274]} Length = 145 Back     information, alignment and structure
>d1khya_ a.174.1.1 (A:) N-terminal domain of ClpB (heat shock protein F84.1) {Escherichia coli [TaxId: 562]} Length = 139 Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 276 Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 276 Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Length = 273 Back     information, alignment and structure
>d1k6ka_ a.174.1.1 (A:) N-terminal, ClpS-binding domain of ClpA, an Hsp100 chaperone {Escherichia coli [TaxId: 562]} Length = 142 Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Length = 247 Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Length = 247 Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Length = 443 Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Length = 256 Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Length = 256 Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 237 Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 237 Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Length = 247 Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Length = 247 Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Length = 362 Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Length = 362 Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Length = 246 Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Length = 239 Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Length = 238 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query982
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 100.0
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 100.0
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 100.0
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 100.0
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 100.0
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 100.0
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 99.93
d1khya_139 N-terminal domain of ClpB (heat shock protein F84. 99.88
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 99.88
d1qvra1145 N-terminal domain of ClpB (heat shock protein F84. 99.87
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 99.87
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 99.85
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 99.83
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 99.82
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 99.82
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 99.81
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 99.8
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 99.79
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 99.79
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 99.78
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 99.78
d1k6ka_142 N-terminal, ClpS-binding domain of ClpA, an Hsp100 99.77
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 99.74
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 99.74
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 99.73
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 99.73
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 99.72
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 99.7
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 99.69
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 99.69
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 99.67
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 99.65
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 99.64
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 99.64
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 99.63
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 99.62
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 99.6
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 99.59
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 99.59
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 99.58
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 99.57
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 99.56
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 99.55
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 99.54
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 99.51
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 99.5
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 99.48
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 99.47
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 99.46
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 99.41
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 99.39
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 99.29
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 99.27
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 99.26
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 99.26
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 99.25
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 99.23
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 99.23
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 99.22
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 99.18
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 99.14
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 99.13
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 99.04
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 98.79
d1svma_362 Papillomavirus large T antigen helicase domain {Si 98.71
d1svma_362 Papillomavirus large T antigen helicase domain {Si 98.6
d1k6ka_142 N-terminal, ClpS-binding domain of ClpA, an Hsp100 98.24
d1khya_139 N-terminal domain of ClpB (heat shock protein F84. 98.22
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 98.13
d1qvra1145 N-terminal domain of ClpB (heat shock protein F84. 98.12
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 97.99
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 97.96
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 97.9
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 97.66
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 97.6
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 97.56
d1tuea_205 Replication protein E1 helicase domain {Human papi 97.51
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 97.4
d1tuea_205 Replication protein E1 helicase domain {Human papi 97.34
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 97.29
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 97.27
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 97.18
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 97.08
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 97.07
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 96.98
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 96.89
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 96.87
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 96.87
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 96.82
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 96.79
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 96.78
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 96.75
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 96.72
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 96.65
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 96.59
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 96.58
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 96.57
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 96.56
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 96.56
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 96.55
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 96.54
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 96.54
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 96.51
d1vmaa2213 GTPase domain of the signal recognition particle r 96.5
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 96.48
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 96.47
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 96.46
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 96.46
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 96.43
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 96.42
d1j8yf2211 GTPase domain of the signal sequence recognition p 96.4
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 96.38
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 96.37
d1okkd2207 GTPase domain of the signal recognition particle r 96.35
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 96.34
d2qy9a2211 GTPase domain of the signal recognition particle r 96.34
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 96.33
d2qy9a2211 GTPase domain of the signal recognition particle r 96.31
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 96.27
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 96.27
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 96.25
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 96.24
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 96.21
d1okkd2207 GTPase domain of the signal recognition particle r 96.2
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 96.2
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 96.18
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 96.17
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 96.15
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 96.13
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 96.13
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 96.12
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 96.11
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 96.11
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 96.09
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 96.09
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 96.08
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 96.04
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 95.98
d1ls1a2207 GTPase domain of the signal sequence recognition p 95.96
d1ls1a2207 GTPase domain of the signal sequence recognition p 95.93
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 95.92
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 95.92
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 95.89
d1j8yf2211 GTPase domain of the signal sequence recognition p 95.89
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 95.84
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 95.84
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 95.83
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 95.81
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 95.79
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 95.76
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 95.68
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 95.66
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 95.59
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 95.59
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 95.57
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 95.51
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 95.47
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 95.46
d1vmaa2213 GTPase domain of the signal recognition particle r 95.46
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 95.44
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 95.4
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 95.38
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 95.36
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 95.32
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 95.26
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 95.23
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 95.18
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 95.16
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 95.13
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 95.11
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 94.93
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 94.9
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 94.89
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 94.88
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 94.85
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 94.81
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 94.81
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 94.78
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 94.77
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 94.76
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 94.67
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 94.61
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 94.58
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 94.44
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 94.42
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 94.32
d2fh5b1207 Signal recognition particle receptor beta-subunit 94.31
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 94.16
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 94.08
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 93.98
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 93.84
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 93.77
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 93.73
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 93.69
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 93.59
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 93.44
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 93.42
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 93.29
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 93.24
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 93.16
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 93.07
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 92.91
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 92.86
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 92.81
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 92.8
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 92.64
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 92.55
d1ihua2279 Arsenite-translocating ATPase ArsA {Escherichia co 92.42
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 92.42
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 92.31
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 92.2
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 92.12
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 91.96
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 91.73
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 91.66
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 91.66
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 91.53
d1xpua3289 Transcription termination factor Rho, ATPase domai 91.51
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 91.46
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 91.42
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 91.4
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 91.02
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 91.01
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 90.97
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 90.95
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 90.9
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 90.86
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 90.85
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 90.83
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 90.78
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 90.56
d1nrjb_209 Signal recognition particle receptor beta-subunit 90.54
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 90.5
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 90.46
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 90.3
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 90.27
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 90.23
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 90.13
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 90.11
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 90.09
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 89.98
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 89.92
d1qzma_94 ATPase domain of protease Lon (La) {Escherichia co 89.9
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 89.84
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 89.83
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 89.78
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 89.71
d2b8ta1139 Thymidine kinase, TK1, N-terminal domain {Ureaplas 89.69
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 89.65
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 89.65
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 89.61
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 89.6
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 89.58
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 89.56
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 89.56
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 89.49
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 89.48
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 89.41
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 89.34
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 89.31
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 89.27
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 89.21
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 89.2
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 89.11
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 89.05
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 89.03
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 89.02
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 88.99
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 88.94
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 88.93
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 88.92
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 88.91
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 88.88
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 88.87
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 88.8
d1ihua1296 Arsenite-translocating ATPase ArsA {Escherichia co 88.79
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 88.74
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 88.73
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 88.73
d1ihua1296 Arsenite-translocating ATPase ArsA {Escherichia co 88.64
d1xbta1133 Thymidine kinase, TK1, N-terminal domain {Human (H 88.63
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 88.59
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 88.58
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 88.58
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 88.56
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 88.53
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 88.5
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 88.39
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 88.29
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 88.28
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 88.22
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 88.13
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 88.12
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 87.98
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 87.95
d1byia_224 Dethiobiotin synthetase {Escherichia coli [TaxId: 87.91
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 87.9
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 87.9
d2awna2232 Maltose transport protein MalK, N-terminal domain 87.89
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 87.8
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 87.75
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 87.72
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 87.69
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 87.64
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 87.56
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 87.48
d1tq4a_400 Interferon-inducible GTPase {Mouse (Mus musculus) 87.43
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 87.37
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 87.37
d1g2912240 Maltose transport protein MalK, N-terminal domain 87.37
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 87.36
d2awna2232 Maltose transport protein MalK, N-terminal domain 87.24
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 87.15
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 86.98
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 86.95
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 86.88
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 86.77
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 86.75
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 86.7
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 86.66
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 86.6
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 86.6
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 86.56
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 86.46
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 86.45
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 86.43
d2jdia3285 Central domain of alpha subunit of F1 ATP synthase 86.41
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 86.39
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 86.36
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 86.35
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 86.33
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 86.31
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 86.25
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 86.23
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 86.22
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 86.16
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 86.15
d1e9ra_433 Bacterial conjugative coupling protein TrwB {Esche 86.1
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 86.06
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 86.02
d1g2912240 Maltose transport protein MalK, N-terminal domain 85.97
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 85.88
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 85.86
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 85.86
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 85.83
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 85.73
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 85.64
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 85.58
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 85.48
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 85.43
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 85.35
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 85.32
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 85.26
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 85.16
d1e9ra_433 Bacterial conjugative coupling protein TrwB {Esche 85.13
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 85.09
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 84.92
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 84.76
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 84.68
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 84.6
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 84.48
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 84.38
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 84.37
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 84.32
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 84.32
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 84.29
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 84.18
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 84.17
d1fx0a3276 Central domain of alpha subunit of F1 ATP synthase 84.15
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 84.07
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 84.07
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 83.98
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 83.92
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 83.85
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 83.79
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 83.78
d1cp2a_269 Nitrogenase iron protein {Clostridium pasteurianum 83.78
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 83.77
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 83.73
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 83.61
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 83.59
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 83.56
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 83.55
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 83.53
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 83.47
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 83.45
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 83.44
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 83.4
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 83.35
d1xx6a1141 Thymidine kinase, TK1, N-terminal domain {Clostrid 83.25
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 83.21
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 83.2
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 83.07
d2jdid3276 Central domain of beta subunit of F1 ATP synthase 83.06
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 83.04
d1byia_224 Dethiobiotin synthetase {Escherichia coli [TaxId: 83.04
d2fh5b1207 Signal recognition particle receptor beta-subunit 83.0
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 82.95
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 82.9
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 82.87
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 82.87
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 82.86
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 82.82
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 82.65
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 82.49
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 82.47
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 82.46
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 82.29
d2afhe1289 Nitrogenase iron protein {Azotobacter vinelandii [ 82.24
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 82.22
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 82.19
d1nrjb_209 Signal recognition particle receptor beta-subunit 82.12
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 81.88
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 81.8
d2b8ta1139 Thymidine kinase, TK1, N-terminal domain {Ureaplas 81.8
d2hyda1255 Putative multidrug export ATP-binding/permease pro 81.8
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 81.64
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 81.56
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 81.36
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 81.31
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 81.31
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 81.21
d1xx6a1141 Thymidine kinase, TK1, N-terminal domain {Clostrid 81.17
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 81.15
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 81.12
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 80.76
d1ihua2279 Arsenite-translocating ATPase ArsA {Escherichia co 80.74
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 80.61
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 80.54
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 80.53
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 80.51
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 80.37
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 80.37
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 80.33
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 80.31
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 80.27
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 80.21
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 80.17
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 80.06
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 80.02
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: ClpB, AAA+ modules
species: Thermus thermophilus [TaxId: 274]

Probab=100.00  E-value=1.5e-59  Score=527.60  Aligned_cols=386  Identities=62%  Similarity=1.014  Sum_probs=342.2

Q ss_pred             hHHHHHhhhhhHHHhhcCCCCCcccchHHHHHHHHHhccCCCCCcEEeCCCCCcHHHHHHHHHHHhhcCCCCCCCCCCeE
Q 002012          249 YQALEKYGNDLTELARSGKLDPVIGRDDEIRRCIQILSRRTKNNPVIIGEPGVGKTAIAEGLAQRIVRGDVPETLQNRKL  328 (982)
Q Consensus       249 ~~~l~~~~~~l~~~~~~~~l~~liG~~~~i~~l~~~L~~~~~~~iLL~GppGvGKT~la~~la~~l~~~~~p~~l~~~~v  328 (982)
                      +..|++|+.||++.++.+++||+|||++++++++++|+|+.++|+||+||||||||++++.||+++..+++|+.|.+.++
T Consensus         2 ~~~l~~~~~~l~~~a~~g~ld~~~gr~~ei~~~~~~L~r~~k~n~llvG~~GvGKtaiv~~la~~i~~~~vp~~l~~~~i   81 (387)
T d1qvra2           2 YNALEQYGIDLTRLAAEGKLDPVIGRDEEIRRVIQILLRRTKNNPVLIGEPGVGKTAIVEGLAQRIVKGDVPEGLKGKRI   81 (387)
T ss_dssp             CSHHHHHEEEHHHHHHTTCSCCCCSCHHHHHHHHHHHHCSSCCCCEEEECTTSCHHHHHHHHHHHHHHTCSCTTSTTCEE
T ss_pred             cHHHHHHHHHHHHHHHcCCCCCCcCcHHHHHHHHHHHhcCCCCCCeEECCCCCCHHHHHHHHHHHHHhCCCCHHHcCceE
Confidence            45799999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEEecccccccccccccHHHHHHHHHHHHHhcCCCeEEEEccchhhhhCCCCCchhhHHHHHHhhhcCCCeEEEEecCch
Q 002012          329 ISLDMASLVAGTCYRGDFEKRLKAVLKEVTKSNGQIILFIDELHTIIGAGNQSGAMDASNMLKPMLGRGELRCIGATTLN  408 (982)
Q Consensus       329 ~~l~~~~l~~~~~~~g~~e~~l~~l~~~~~~~~~~~IL~IDEi~~l~~~~~~~~~~~~~~~L~~~le~g~i~vI~at~~~  408 (982)
                      +.+|++.+++|++|+|+++++++.++.++....+++||||||+|.+++.|.+.|+.++.|+|+|+|++|.++|||+||+.
T Consensus        82 ~~ld~~~l~ag~~~~g~~e~r~~~i~~~~~~~~~~~ilfide~h~l~~~g~~~g~~d~a~~Lkp~L~rg~~~~I~~tT~~  161 (387)
T d1qvra2          82 VSLQMGSLLAGAKYRGEFEERLKAVIQEVVQSQGEVILFIDELHTVVGAGKAEGAVDAGNMLKPALARGELRLIGATTLD  161 (387)
T ss_dssp             EEECC-----------CHHHHHHHHHHHHHTTCSSEEEEECCC-------------------HHHHHTTCCCEEEEECHH
T ss_pred             EEeeHhhhhcccCcchhHHHHHHHHHHHhccCCCceEEEeccHHHHhcCCCCCCcccHHHHHHHHHhCCCcceeeecCHH
Confidence            99999999999999999999999999999876778999999999999998888889999999999999999999999999


Q ss_pred             hHhhhhhcChHHHhccceEEecCCCHHHHHHHHHHHHHHHhhhcCCccChHHHHHHHHHhhhhhccCCCcchhhHHHHHH
Q 002012          409 EYRNYIEKDPALERRFQQVFCDQPSVENTISILRGLRERYELHHGVKISDSALVSAAVLADRYITERFLPDKAIDLVDEA  488 (982)
Q Consensus       409 ~~~~~~~~d~al~rRf~~i~i~~Ps~~e~~~IL~~~~~~~~~~~~v~i~~~~l~~~~~~s~r~i~~~~~p~~a~~lld~a  488 (982)
                      +|++ ++.|++|.|||+.|.|.+|+.++...||+.+..+|+.+|++.++++++..++.+|.||++++++||+|++|+|+|
T Consensus       162 ey~~-~e~d~al~rrF~~v~v~ep~~~~~~~il~~~~~~~e~~h~v~~~~~ai~~~v~ls~ryi~~r~~PdKAidlld~a  240 (387)
T d1qvra2         162 EYRE-IEKDPALERRFQPVYVDEPTVEETISILRGLKEKYEVHHGVRISDSAIIAAATLSHRYITERRLPDKAIDLIDEA  240 (387)
T ss_dssp             HHHH-HTTCTTTCSCCCCEEECCCCHHHHHHHHHHHHHHHHHHTTCEECHHHHHHHHHHHHHHCCSSCTHHHHHHHHHHH
T ss_pred             HHHH-hcccHHHHHhcccccCCCCcHHHHHHHHHHHHHHHHhccCCcccHHHHHHHHHhcccccccccChhhHHHHHHHH
Confidence            9987 588999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHhhhhccCCccchHHHHHHHHHHHHHHhhccccCchhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 002012          489 AAKLKMEITSKPIELDEIDRAVLKLEMEKLSLKNDTDKASKERLSKLEHDLNSLKQKQKELNDQWSREKDLMSRIRSIKE  568 (982)
Q Consensus       489 ~~~~~~~~~~~~~~l~~~~~~~~~~~~e~~~l~~~~~~~~~~~l~~~~~e~~~l~~~~~~l~~~~~~e~~~~~~~~~~~~  568 (982)
                      |+++++...+.|..++.+++++.++++|..++.++.+..+..++..+..++..++.+...+..+|..++..+..++.+++
T Consensus       241 ~a~~~i~~~s~P~el~~ler~I~qLe~E~~aL~ke~d~~s~~rl~~le~el~~lee~~~~L~~~w~~ek~~l~~i~~Lk~  320 (387)
T d1qvra2         241 AARLRMALESAPEEIDALERKKLQLEIEREALKKEKDPDSQERLKAIEAEIAKLTEEIAKLRAEWEREREILRKLREAQH  320 (387)
T ss_dssp             HHHHHHTTTTHHHHHHHHHHHHHHHHHHHHHHSSCSSHHHHSCTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHhhccCCcHHHHHHHHHHHHHHHHHHHHHhccchHHHHHHhhhhhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHhhhcHHHHHHhhhcchHHHHHHHHHHHHhHHHHHhcCCccccccCCHhHHHHHHHHhhC
Q 002012          569 EIDRVNLEMEAAERDYDLNRAAELKYGTMISLQRQLEEAEKNLSEFQKSGHSLLREEVTDLDIAEIVSKWTG  640 (982)
Q Consensus       569 ~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~v~~~~i~~~~~~~~g  640 (982)
                      +++.++.+++.+++..++.+++++.++.+|.+++++......+     .+.++++..|++.+|++++++|||
T Consensus       321 ~Le~lr~~le~A~r~gd~e~AaeL~y~~ip~le~el~~l~~~~-----~~~~lvr~~VteedIA~VVSrWTG  387 (387)
T d1qvra2         321 RLDEVRREIELAERQYDLNRAAELRYGELPKLEAEVEALSEKL-----RGARFVRLEVTEEDIAEIVSRWTG  387 (387)
T ss_dssp             HHHHHHHHHHHHTTTTCHHHHHHHHTTHHHHHHHHHHHHHHHS-----SSCSSCCSEECHHHHHHHHHTTSS
T ss_pred             HHHHHHHHHHHHHHcccHHHHHHHhhchHHHHHHHHHHHHHHh-----cCCCCCcCccCHHHHHHHHHhhhC
Confidence            9999999999999999999999999999999999987665432     355678889999999999999998
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1khya_ a.174.1.1 (A:) N-terminal domain of ClpB (heat shock protein F84.1) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qvra1 a.174.1.1 (A:4-148) N-terminal domain of ClpB (heat shock protein F84.1) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k6ka_ a.174.1.1 (A:) N-terminal, ClpS-binding domain of ClpA, an Hsp100 chaperone {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1k6ka_ a.174.1.1 (A:) N-terminal, ClpS-binding domain of ClpA, an Hsp100 chaperone {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1khya_ a.174.1.1 (A:) N-terminal domain of ClpB (heat shock protein F84.1) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1qvra1 a.174.1.1 (A:4-148) N-terminal domain of ClpB (heat shock protein F84.1) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qzma_ c.37.1.20 (A:) ATPase domain of protease Lon (La) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xbta1 c.37.1.24 (A:18-150) Thymidine kinase, TK1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xx6a1 c.37.1.24 (A:2-142) Thymidine kinase, TK1, N-terminal domain {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xx6a1 c.37.1.24 (A:2-142) Thymidine kinase, TK1, N-terminal domain {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure