Citrus Sinensis ID: 002109


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-----
MPVYDKPVYDDDVDIFKGLPGLRTSSTPAAAASSSGANFDDVFASFSRSSAKHESARESSPLDDLLGNLGKKETESRVKSEKDVSAFDDLLPGFGRSRSPSSNRSTSESSQSQKPPSNSTKTASSVMEDPFGVSESTSTHVGSSSEVFTDRLEEIGKFGGSGSAKVNGSSVSGGVFDDLDSLNILGKSVPPVSPEINKRGNDRSLRSKSVSGTQTHPRKESIDRSSVENFDGYAQNNTPVDNFQGSNDTLFNMPSVATDSSRSAGRATSPPSYMSATDSLRSAGRATSPPSYMSATDSLRSAGRATSPPSYTSASPSETNSQVNTTPKSEDLFDSAEDVWLTVSEIPLFTQPTSAPPPSRPPPPRPTRVSKLETGNARKKANEYSSFSNSPQCTHSPKSTRAGTRSSAASQIDELEDFAMSRSWNNVNEYGEVPSPEDVESSIAAASAAAMKEAMDRAEAKFRHAKEMRERESFKAARSRESVQPDREERATQQDAQERLDREMQQREKGEEQRRLEREREREREEKEREKKRIEKEKERAREIEKEREKARQAVERATREARERAAAEARLKAERAAVDKANAAARERAERAAVQRAQAEARERAAAEARERAERAAAEARERANAEAREKEARERASVARTEAEALQRAERAAVQRAASEARERAAAEARERAAAAARANQNQQKNDNDLESFFSMSSRPSSAPRPRANTSDSLFDSQSKGGPEPARRTSVGASSNMRKASSTTNIVDDLSSIFGAAGSSAGEFQDVEGETEERRRARLERHQRTQERAAKALAEKNERDLQAQRDQAERHRIAETLDVEIKRWAAGKEGNIRALLATMQYVLWPESGWQPVSLTDLITAAAVKKCYRKATLCIHPDKVQQKGANLQQKYIAEKVFDLLKVQQIYCRFFILLCLEGFNLTMQDSFLVYYFGCFTFCCQFDDKLLLHANMNSEKYAIGVSRHRV
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHccccccHHHHHHHcccccccccccccccHHHHccHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEEEccEEEEEEcccccHHcccccccccccccccccc
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHccccccccccccccccccccccccccccccccccccccccccEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHcccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHcccHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHcccccccccccccccccccHHHHHHHccHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHccccHHHHHHHHHHccHHHHHHHHHHHHHHHcHccccccccHHHcccHHHHHHHHHHHEEEEcccHHcccccHHHHHHHHHHHHHHHccHHHHHHHcHEEEccccccccccccEEEEEEcEEEEEccccHHEEEEccccccEEEEEccccc
mpvydkpvydddvdifkglpglrtsstpaaaasssganfddvfasfsrssakhesaressplddllgnlgkketesrvksekdvsafddllpgfgrsrspssnrstsessqsqkppsnstktassvmedpfgvseststhvgssseVFTDRLEEIGkfggsgsakvngssvsggvfddldslnilgksvppvspeinkrgndrslrsksvsgtqthprkesidrssvenfdgyaqnntpvdnfqgsndtlfnmpsvatdssrsagratsppsymsatdslrsagratsppsymsatdslrsagratsppsytsaspsetnsqvnttpksedlfdsaeDVWLTvseiplftqptsapppsrpppprptrvskletgnarkkaneyssfsnspqcthspkstragtrssaaSQIDELEDFAMSRSWnnvneygevpspedveSSIAAASAAAMKEAMDRAEAKFRHAKEMRERESFKAArsresvqpdreerATQQDAQERLDREMQQREKGEEQRRLEREREREREEKEREKKRIEKEKERAREIEKEREKARQAVERATREARERAAAEARLKAERAAVDKANAAARERAERAAVQRAQAEARERAAAEARERAERAAAEARERANAEAREKEARERASVARTEAEALQRAERAAVQRAASEARERAAAEARERAAAAARANQnqqkndndlesffsmssrpssaprprantsdslfdsqskggpeparrtsvgassnmrkassttniVDDLSSIFgaagssagefqdvegETEERRRARLERHQRTQERAAKALAEKNERDLQAQRDQAERHRIAETLDVEIKRWAAGKEGNIRALLATMQYVlwpesgwqpvslTDLITAAAVKKCYRKatlcihpdkvqqKGANLQQKYIAEKVFDLLKVQQIYCRFFILLCLEGFNLTMQDSFLVYYFGCFTFCCQFDDKLLLHANMNSEKYAIGVSRHRV
mpvydkpvydddVDIFKGLPGLRTSSTpaaaasssgaNFDDVFASFSRSSAkhesaressplddllgnlgkketesrvksekdvsafddllpgfgrsrspssnrstsessqsqkppsnstkTASSVMEDPFGVseststhvgsssEVFTDRLEEIGKFggsgsakvngSSVSGGVFDDLDSLNILgksvppvspeinkrgndrslrsksvsgtqthprkesidrssveNFDGYAQNNTPVDNFQGSNDTLFNMPSVATdssrsagratsppsymsaTDSLRSAGRATSPPSYMSATDSLRSAGRATSPPsytsaspsetnsqvnTTPKSEDLFDSAEDVWLTVSEIPLftqptsapppsrpppprpTRVSKLETGNARKKaneyssfsnspqcthspkstragtrsSAASQIDELEDFAMSRSWNNVNEYGEVPSPEDVESSIAAASAAAMKEAMDRAEAKFRHAkemreresfkaarsresvqpdreeratqqdaqerldremqqrekgeeqrrlerererereekerekkriekekerareiekerekarqaveRATREARERAAAEARLKAERAAVDKANAAARERAERAAVQRAQAEARERAAAEARERAERAAAEARERANAEAREKEARERASVARTEAEALQRAERAAVQRAASEARERAAAEARERAAAAAranqnqqkndndLESFFSMSsrpssaprprantsdslfdsqskggpeparrtsvgassnmrkassttniVDDLSSIFGAAgssagefqdvegetEERRRARLERHQRTQERAAKalaeknerdlqaqrDQAERHRIAETLDVEIKRWAAGKEGNIRALLATMQYVLWPESGWQPVSLTDLITAAAVKKCYRKATLCIHPDKVQQKGANLQQKYIAEKVFDLLKVQQIYCRFFILLCLEGFNLTMQDSFLVYYFGCFTFCCQFDDKLLLHANMNsekyaigvsrhrv
MpvydkpvydddvdIFKGLPGLRTsstpaaaasssgaNFDDVFASFSRSSAKHESARESSPLDDLLGNLGKKETESRVKSEKDVSAFDDLLPGFGRsrspssnrstsessqsqkppsnstkTASSVMEDPFgvseststhvgssseVFTDRLEEIGKFGGSGSAKVNGSSVSGGVFDDLDSLNILGKSVPPVSPEINKRGNDRSLRSKSVSGTQTHPRKESIDRSSVENFDGYAQNNTPVDNFQGSNDTLFNMPSVATDSSRSAGRATSPPSYMSATDSLRSAGRATSPPSYMSATDSLRSAGRatsppsytsaspsETNSQVNTTPKSEDLFDSAEDVWLTVSEIPLFTQptsapppsrpppprptrVSKLETGNARKKANEYSSFSNSPQCTHSPKstragtrssaasQIDELEDFAMSRSWNNVNEYGEVPSPEDVESSIaaasaaamkeamdraeakFRHAKEMRERESFKAARSRESVQPDREERATQQDAQERLDremqqrekgeeqrrlerererereekerekkriekekerareiekerekarqaveratreareraaaearlkaeraavdkanaaareraeraavqraqaeareraaaeareraeraaaeareranaearekeareraSVarteaealqraeraavqraaseareraaaeareraaaaaraNQNQQKNDNDLEsffsmssrpssaprpraNTSDSLFDSQSKGGPEPARRTSVGASSNMRKASSTTNIVDDLssifgaagssagEFQDVegeteerrrarlerHQRTQERAAKALAEKNERDLQAQRDQAERHRIAETLDVEIKRWAAGKEGNIRALLATMQYVLWPESGWQPVSLTDLITAAAVKKCYRKATLCIHPDKVQQKGANLQQKYIAEKVFDLLKVQQIYCRFFILLCLEGFNLTMQDSFLVYYFGCFTFCCQFDDKLLLHANMNSEKYAIGVSRHRV
********YDDDVDIFK*******************************************************************************************************************************************************************************************************************************************************************************************************************************EDVWLTVSEIPLF*********************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************IAETLDVEIKRWAAGKEGNIRALLATMQYVLWPESGWQPVSLTDLITAAAVKKCYRKATLCIHPDKVQQKGANLQQKYIAEKVFDLLKVQQIYCRFFILLCLEGFNLTMQDSFLVYYFGCFTFCCQFDDKLLLHANMNSEKYAI*******
MPVYDKPVYDDDVDIFKGL********************DD***************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************LLATMQYVLWPESGWQPVSLTDLITAAAVKKCYRKATLCIHPDKVQ*K*ANLQQKYIAEKVFDLLKVQQIYCRFFILLCLEGFNLTMQDSFLVYYFGCFTFCCQFDDKLLLHANMNSEKYAIGVSRH**
MPVYDKPVYDDDVDIFKGLPGLRT***********GANFDDVFASF****************DDLLGNLGK***********DVSAFDDLLPGFGR******************************MEDPFG**************VFTDRLEEIGKFGGSGSAKVNGSSVSGGVFDDLDSLNILGKSVPPVSPEIN***************************SSVENFDGYAQNNTPVDNFQGSNDTLFNMPSV***********************************************************************KSEDLFDSAEDVWLTVSEIPLFTQ******************SKLE************************************SQIDELEDFAMSRSWNNVNEYGEVPSPEDVESSI*****************KFRH******************************************************************************************************************************************************************************************************************************KNDNDLESFFS***********************************************TTNIVDDLSSIFGAAGS**************************************************RHRIAETLDVEIKRWAAGKEGNIRALLATMQYVLWPESGWQPVSLTDLITAAAVKKCYRKATLCIHPDKVQQKGANLQQKYIAEKVFDLLKVQQIYCRFFILLCLEGFNLTMQDSFLVYYFGCFTFCCQFDDKLLLHANMNSEKYAIGVSRHRV
*PVYDKPVYDDDVDIFKGLPGL*******************************************************************************************************VMEDPFGVSEST******************************************************************************************************************************************************************************************************AEDVWLTVSEIPLFTQPTSAPPPSRP*****************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************ERR***L**HQRTQERAAKALAEKNERDLQAQRDQAERHRIAETLDVEIKRWAAGKEGNIRALLATMQYVLWPESGWQPVSLTDLITAAAVKKCYRKATLCIHPDKVQQKGANLQQKYIAEKVFDLLKVQQIYCRFFILLCLEGFNLTMQDSFLVYYFGCFTFCCQFDDKLLLHANMNSEKYAIGVS****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPVYDKPVYDDDVDIFKGLPGLRTSSTPAAAASSSGANFDDVFASFSRSSAKHESARESSPLDDLLGNLGKKETESRVKSEKDVSAFDDLLPGFGRSRSPSSNRSTSESSQSQKPPSNSTKTASSVMEDPFGVSESTSTHVGSSSEVFTDRLEEIGKFGGSGSAKVNGSSVSGGVFDDLDSLNILGKSVPPVSPEINKRGNDRSLRSKSVSGTQTHPRKESIDRSSVENFDGYAQNNTPVDNFQGSNDTLFNMPSVATDSSRSAGRATSPPSYMSATDSLRSAGRATSPPSYMSATDSLRSAGRATSPPSYTSASPSETNSQVNTTPKSEDLFDSAEDVWLTVSEIPLFTQPTSAPPPSRPPPPRPTRVSKLETGNARKKANEYSSFSNSPQCTHSPKSTRAGTRSSAASQIDELEDFAMSRSWNNVNEYGEVPSPEDVESSIAAASxxxxxxxxxxxxxxxxxxxxxRERESFKAARSRESVQPDREERATxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxERAAVQRAASEARERAxxxxxxxxxxxxxxxxxxxxxDNDLESFFSMSSRPSSAPRPRANTSDSLFDSQSKGGPEPARRTSVGASSNMRKASSTTNIVDDLSSIFGAAGSSAGEFQDVEGETEERRRARxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxETLDVEIKRWAAGKEGNIRALLATMQYVLWPESGWQPVSLTDLITAAAVKKCYRKATLCIHPDKVQQKGANLQQKYIAEKVFDLLKVQQIYCRFFILLCLEGFNLTMQDSFLVYYFGCFTFCCQFDDKLLLHANMNSEKYAIGVSRHRV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query965 2.2.26 [Sep-21-2011]
Q0WQ57891 Auxilin-related protein 2 yes no 0.781 0.846 0.464 1e-149
Q9SU08904 Auxilin-related protein 1 no no 0.222 0.237 0.762 5e-86
O13773697 UBA domain-containing pro yes no 0.100 0.139 0.408 1e-15
Q99KY41305 Cyclin-G-associated kinas no no 0.089 0.065 0.416 7e-13
Q8IDX63130 Reticulocyte-binding prot yes no 0.134 0.041 0.328 1e-09
>sp|Q0WQ57|AUXI2_ARATH Auxilin-related protein 2 OS=Arabidopsis thaliana GN=At4g12770 PE=1 SV=1 Back     alignment and function desciption
 Score =  528 bits (1360), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 426/917 (46%), Positives = 527/917 (57%), Gaps = 163/917 (17%)

Query: 1   MPVYDKPVYDDDVDIFKGLPGLRTSSTPAAAASSSGANFDDVFASFSRSSAKHESARESS 60
           MPVYDKPVYDD+ D+F+ +P L+  ST     SS  A F++VF+S S S  KH   + SS
Sbjct: 111 MPVYDKPVYDDE-DVFESIPELKIPST-----SSQSARFENVFSSISSSPTKHRK-QNSS 163

Query: 61  PLDDLLGN-LGKKETESRVKSEKDVSAFDDLLPGFGRSRSPSSNRSTSES-SQSQKPPSN 118
           P DDL+GN LGKKE++   + EK  S FDDL+PGFGR+ SP + R+TSE+ SQSQKPP  
Sbjct: 164 PFDDLMGNNLGKKESD---REEKGSSIFDDLIPGFGRTSSPPAKRTTSETTSQSQKPPYR 220

Query: 119 STKTASSVMEDPFGVSESTSTHVGSSSEVFTDRLEEIGKFGGSGSAKVNGSSVSGGVFDD 178
           + +T+S+V EDPF V E +++ +   S                          +GG  D 
Sbjct: 221 TAETSSNVKEDPFVVLEESTSTLREPS--------------------------TGGFTDP 254

Query: 179 LDSLNILGKSVPPVSPEINKRGNDRSLRSKSVSGTQTHPRKESIDRSSVENFDGYAQNNT 238
           L+ +   GK         N R  D S    SV G                   G   +  
Sbjct: 255 LEEI---GK--------FNSRKTDHS----SVHG-------------------GVFVDTD 280

Query: 239 PVDNFQGSNDTLFNMPSVATDSSRSAGRA-TSPPSYMSATDS-LRSAGRATSPPSYMSAT 296
           P+D+   S   +            S G++   PP  +S + S + S+G   S    +S  
Sbjct: 281 PLDSLGKSGPDM-----------NSRGKSHLRPPGNISGSQSPVESSGLYHS--KNVSFD 327

Query: 297 DSLRSAGRATSPPSYTSASPSETNSQVNTTPKSEDLFDSAEDVWLTVSEIPLFTQPTSAP 356
           D +     +T PP+ +  S                 F+S++DVWLTVSEIPLFTQPTSAP
Sbjct: 328 DVVEPQNTSTPPPTNSDGS-----------------FESSDDVWLTVSEIPLFTQPTSAP 370

Query: 357 PPSRPPPPRPTRVSKLETGNARKKANEYSSFSNSPQCTHSPKSTRAGTRSSAASQIDELE 416
           PP+              T   +KK NE  S   S   +H P S RA   S  ASQ+DEL+
Sbjct: 371 PPT-------RPPPPRPTRPIKKKVNE-PSIPTSAYHSHVPSSGRASVNSPTASQMDELD 422

Query: 417 DFAMSRSWNNVNEYGEVPSPEDVES-SIAAASAAAMKEAMDRAEAKFRHAKEMRERESFK 475
           DF++ R+    N Y +  S ED +  S AAASAAAMK+AMD+AEAKFRHAKE RE+ES K
Sbjct: 423 DFSIGRNQTAANGYPDPSSGEDSDVFSTAAASAAAMKDAMDKAEAKFRHAKERREKESLK 482

Query: 476 AARSRESVQPDREERATQQDAQERLDREMQQREKGEEQRRLEREREREREEKEREKKRIE 535
           A+RSRE             D  E  D   ++RE  E+Q RL+RER     E E+ + R  
Sbjct: 483 ASRSREG------------DHTENYDS--RERELREKQVRLDRERAEREAEMEKTQARER 528

Query: 536 KEKERAREIEKEREK---ARQAVERATREARERAAAEARLKAERAAVDKANAAARERAER 592
           +E+ER ++  +   +   ARQAVERATREARE           RAA +     A  + +R
Sbjct: 529 EEREREQKRIERERERLLARQAVERATREARE-----------RAATE-----AHAKVQR 572

Query: 593 AAVQRAQAEARERAAAEARERAERAAAEARERANAEAREKEARERASVARTEAEALQRA- 651
           AAV +           +ARERAERAA +       E     ARE+A  A  EA     A 
Sbjct: 573 AAVGKV---------TDARERAERAAVQRAHAEARERAAAGAREKAEKAAAEARERANAE 623

Query: 652 --ERAAVQRAASEARERAAAEARERAAAAARANQNQQKNDNDLESFFSMSSRPSSAPRPR 709
             E+ A +  A  A    AA      AAA    + QQ+N+NDL+SFF+  SRPSS PR R
Sbjct: 624 VREKEA-KVRAERAAVERAAAEARGRAAAQAKAKQQQENNNDLDSFFNSVSRPSSVPRQR 682

Query: 710 ANTSDSLFDSQSKGG----PEPARRTSVGASSNMRKASSTTNIVDDLSSIFGAAGSSAGE 765
            N  D   DS +KGG      P+ R   G + N+RKASS TNIVDDLSSIFGA  S +G 
Sbjct: 683 TNPPDPFQDSWNKGGSFESSRPSSRVPSGPTENLRKASSATNIVDDLSSIFGAPASQSGG 742

Query: 766 FQDVEGETEERRRARLERHQRTQERAAKALAEKNERDLQAQRDQAERHRIAETLDVEIKR 825
           FQDV+GETEERRRARLERHQRTQERAAKALAEKNERDLQ QR+QAE+ RI  TLDVEI+R
Sbjct: 743 FQDVDGETEERRRARLERHQRTQERAAKALAEKNERDLQVQREQAEKDRIGGTLDVEIRR 802

Query: 826 WAAGKEGNIRALLATMQYVLWPESGWQPVSLTDLITAAAVKKCYRKATLCIHPDKVQQKG 885
           W AGKEGN+RALL+T+QYVLWPE GWQPVSLTDLIT A+VKK YRKATLCIHPDKVQQKG
Sbjct: 803 WGAGKEGNLRALLSTLQYVLWPECGWQPVSLTDLITGASVKKVYRKATLCIHPDKVQQKG 862

Query: 886 ANLQQKYIAEKVFDLLK 902
           ANLQQKYIAEKVFD+LK
Sbjct: 863 ANLQQKYIAEKVFDMLK 879




Promotes probably uncoating of clathrin-coated vesicles.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9SU08|AUXI1_ARATH Auxilin-related protein 1 OS=Arabidopsis thaliana GN=At4g12780 PE=1 SV=2 Back     alignment and function description
>sp|O13773|UCP7_SCHPO UBA domain-containing protein 7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ucp7 PE=4 SV=1 Back     alignment and function description
>sp|Q99KY4|GAK_MOUSE Cyclin-G-associated kinase OS=Mus musculus GN=Gak PE=1 SV=2 Back     alignment and function description
>sp|Q8IDX6|RBP2A_PLAF7 Reticulocyte-binding protein 2 homolog a OS=Plasmodium falciparum (isolate 3D7) GN=PF13_0198 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query965
225438408949 PREDICTED: auxilin-related protein 2-lik 0.860 0.874 0.607 0.0
255567186983 auxilin, putative [Ricinus communis] gi| 0.864 0.848 0.584 0.0
356512862985 PREDICTED: auxilin-related protein 2-lik 0.830 0.813 0.551 0.0
356527526935 PREDICTED: auxilin-related protein 2-lik 0.829 0.855 0.549 1e-176
356516393922 PREDICTED: auxilin-related protein 2-lik 0.841 0.880 0.520 1e-161
147777401977 hypothetical protein VITISV_018382 [Viti 0.814 0.804 0.539 1e-160
297790814890 hypothetical protein ARALYDRAFT_497125 [ 0.777 0.842 0.479 1e-156
145340151891 auxilin-related protein 2 [Arabidopsis t 0.781 0.846 0.464 1e-147
334186464889 auxilin-related protein 2 [Arabidopsis t 0.779 0.845 0.464 1e-145
297790666920 hypothetical protein ARALYDRAFT_333056 [ 0.776 0.814 0.435 1e-139
>gi|225438408|ref|XP_002275766.1| PREDICTED: auxilin-related protein 2-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  753 bits (1943), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 563/926 (60%), Positives = 662/926 (71%), Gaps = 96/926 (10%)

Query: 2   PVYDKPVYDDDVDIFKGLPGLRTSSTPAAAASSSGANFDDVFASFSRSSAKHESARESSP 61
           PVYDKPVYDDD  IF G+PGL+TS +          N+D  F++ S S  K   A     
Sbjct: 83  PVYDKPVYDDD--IFDGVPGLKTSGS---------VNYD-AFSTVSGSKQKQNDA----- 125

Query: 62  LDDLLGNLGKKETE-SRVKSEKDV-SAFDDLLPGFGRSRSPSSNRSTSESSQSQKPPSNS 119
            DDLLG  G+K+ E  R  + +DV S FDDLL GFGR  SP SNR T++ + + K   N+
Sbjct: 126 FDDLLGGFGRKDPEPKRSGNVEDVGSGFDDLLHGFGRI-SPPSNRPTTDINWAPKSTVNA 184

Query: 120 TKTASSVMEDPFGVSESTSTHVGSSSEVFTDRLEEIGKFGGSGSAKVNGSS-VSGGVFDD 178
           T+T S+V+EDPF V ESTST   SSS +F+D LEEI K   SGS +V+GSS V GG F+D
Sbjct: 185 TETTSNVIEDPFVVLESTSTPAVSSSVLFSDPLEEISKLSNSGSTRVDGSSAVGGGAFND 244

Query: 179 LDSLNILGKSVPPVSPEINKRGNDRSLRS-KSVSGTQTHPRKESIDRSSVENFDGYAQNN 237
           LD L+ LGKS  P   E+NKRG +RS  S +  S TQT   KE I++SSVE  D ++Q  
Sbjct: 245 LDPLDGLGKSAFPS--EMNKRGKNRSPSSTEPTSETQTFATKEPIEKSSVEGQDSHSQKK 302

Query: 238 TPVDNFQGSNDTLFNMPSVATDSSRSAGRATSPPSYMSATDSLRSAGRATSPPSYMSATD 297
            P +N+  S+ TLF++P+V+TDS +                                   
Sbjct: 303 MPAENYWESHQTLFDIPTVSTDSHK----------------------------------- 327

Query: 298 SLRSAGRATSPPSYTSASPSETNSQVNTTPKSEDLFDSAEDVWLTVSEIPLFTQPTSAPP 357
              S  +  SPPS+ +ASP+ETNSQ   +P+SE+   S++DVWL VS+IPLFTQPTSAPP
Sbjct: 328 ---SFSQTPSPPSHVNASPNETNSQGEMSPRSEENLSSSDDVWLAVSDIPLFTQPTSAPP 384

Query: 358 PSRPPPPRPTRVSKLETG-----NARKKANEYSSFSNSPQCTHSPKSTRAGTRSSAASQI 412
           PSRPPP RPT+VS+ ETG     NARKK NE+SSF+NS Q + SPK TR   +SSA SQI
Sbjct: 385 PSRPPPTRPTQVSRAETGSFGSNNARKKVNEFSSFTNSSQYSQSPKLTRGTVKSSAVSQI 444

Query: 413 DELEDFAMSRSWNNVNEYGEVPSPEDVES-SIAAASAAAMKEAMDRAEAKFRHAKEMRER 471
           DELEDFAM R+ NNV+ + E    ++ E+ S+AAASAAAMKEAMDRAEAKFRHAK +RER
Sbjct: 445 DELEDFAMGRTQNNVDGHAEGLYGDEFETNSVAAASAAAMKEAMDRAEAKFRHAKGVRER 504

Query: 472 ESFKAARSRESVQPDREERATQQDAQERLDREMQQREKGEEQRRLEREREREREEKEREK 531
           ES KA+RS+E+ Q DR+E+A  QDAQER  RE Q+R + E Q R   E ERE+   ER +
Sbjct: 505 ESAKASRSKEAGQLDRDEKA-MQDAQERAIREKQERLEHERQEREREEEEREQRRLERTR 563

Query: 532 KRIEKEKERAREIEKEREKAR-------------QAVERATREARERAAAEARLKAERAA 578
           +   + +E+ RE  +  ++               QAVERAT+EARERAAAEARLKAERAA
Sbjct: 564 EIEREREEKEREQRRLEKERERAREIEREREKARQAVERATKEARERAAAEARLKAERAA 623

Query: 579 VDKANAAARERAERAAVQRAQAEARERAAAEARERAERAAAEARERANAEAREKEARERA 638
           V K NA ARERAERAAV RAQAEARERAAAEA+ERAE+AAAEARERAN EAREKEARERA
Sbjct: 624 VGKVNAEARERAERAAVHRAQAEARERAAAEAKERAEKAAAEARERANTEAREKEARERA 683

Query: 639 SVARTEAEALQRAERAAVQRAASEARERAAAEARERAAAAARANQNQQKNDNDLESFFSM 698
           +VAR EAE   R          +E      A A  R  AAA A  NQQKN+NDLESFFSM
Sbjct: 684 AVARAEAEVRLR----------TERAAVERAAAEARERAAAAARVNQQKNENDLESFFSM 733

Query: 699 SSRPSSAPRPRANTSDSLFDSQSKG--GPEPARRTSVGASSNMRKASSTTNIVDDLSSIF 756
            SRPSSAPRPRAN+SD +FD+Q +   GPE AR T+  ASS MRKASSTTNIVDDLSSIF
Sbjct: 734 GSRPSSAPRPRANSSDPVFDTQFQNRRGPEVAR-TAASASSTMRKASSTTNIVDDLSSIF 792

Query: 757 GAAGSSAGEFQDVEGETEERRRARLERHQRTQERAAKALAEKNERDLQAQRDQAERHRIA 816
           GAA SS G+FQDVEGE+E+RRRARLERHQRTQERAAKALAEKN+RDLQAQRDQAERHRIA
Sbjct: 793 GAAPSS-GDFQDVEGESEDRRRARLERHQRTQERAAKALAEKNQRDLQAQRDQAERHRIA 851

Query: 817 ETLDVEIKRWAAGKEGNIRALLATMQYVLWPESGWQPVSLTDLITAAAVKKCYRKATLCI 876
           ETLDVEIKRW+AGKEGN+RALL+T+QYVLWPE GWQPVSLTDLITAA+VKK YRKATLCI
Sbjct: 852 ETLDVEIKRWSAGKEGNLRALLSTLQYVLWPECGWQPVSLTDLITAASVKKVYRKATLCI 911

Query: 877 HPDKVQQKGANLQQKYIAEKVFDLLK 902
           HPDKVQQKGANLQQKYIAEKVFDLLK
Sbjct: 912 HPDKVQQKGANLQQKYIAEKVFDLLK 937




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255567186|ref|XP_002524574.1| auxilin, putative [Ricinus communis] gi|223536127|gb|EEF37782.1| auxilin, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356512862|ref|XP_003525134.1| PREDICTED: auxilin-related protein 2-like [Glycine max] Back     alignment and taxonomy information
>gi|356527526|ref|XP_003532360.1| PREDICTED: auxilin-related protein 2-like [Glycine max] Back     alignment and taxonomy information
>gi|356516393|ref|XP_003526879.1| PREDICTED: auxilin-related protein 2-like [Glycine max] Back     alignment and taxonomy information
>gi|147777401|emb|CAN64950.1| hypothetical protein VITISV_018382 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297790814|ref|XP_002863292.1| hypothetical protein ARALYDRAFT_497125 [Arabidopsis lyrata subsp. lyrata] gi|297309126|gb|EFH39551.1| hypothetical protein ARALYDRAFT_497125 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|145340151|ref|NP_193013.2| auxilin-related protein 2 [Arabidopsis thaliana] gi|122230016|sp|Q0WQ57.1|AUXI2_ARATH RecName: Full=Auxilin-related protein 2 gi|110737602|dbj|BAF00742.1| auxilin-like protein [Arabidopsis thaliana] gi|332657777|gb|AEE83177.1| auxilin-related protein 2 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|334186464|ref|NP_001190708.1| auxilin-related protein 2 [Arabidopsis thaliana] gi|332657778|gb|AEE83178.1| auxilin-related protein 2 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297790666|ref|XP_002863218.1| hypothetical protein ARALYDRAFT_333056 [Arabidopsis lyrata subsp. lyrata] gi|297309052|gb|EFH39477.1| hypothetical protein ARALYDRAFT_333056 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query965
TAIR|locus:2135763891 AT4G12770 [Arabidopsis thalian 0.227 0.246 0.607 3e-98
TAIR|locus:2135778904 AT4G12780 [Arabidopsis thalian 0.227 0.243 0.607 4.3e-95
TAIR|locus:2036967523 AT1G21660 [Arabidopsis thalian 0.189 0.349 0.481 8.1e-50
TAIR|locus:21152451422 AT4G36520 [Arabidopsis thalian 0.123 0.083 0.764 8.9e-50
TAIR|locus:20184621448 AUL1 "AT1G75310" [Arabidopsis 0.123 0.082 0.647 2.4e-39
TAIR|locus:2037256651 JAC1 "J-domain protein require 0.104 0.155 0.5 4.6e-23
TAIR|locus:2009817455 AT1G30280 [Arabidopsis thalian 0.119 0.252 0.396 9.4e-17
UNIPROTKB|F1NC601225 Gga.54538 "Uncharacterized pro 0.086 0.067 0.458 1.4e-14
DICTYBASE|DDB_G0276447730 DDB_G0276447 "BAR domain-conta 0.097 0.128 0.418 1.8e-14
UNIPROTKB|F1NL761265 Gga.54538 "Uncharacterized pro 0.086 0.065 0.458 3.5e-14
TAIR|locus:2135763 AT4G12770 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 663 (238.4 bits), Expect = 3.0e-98, Sum P(3) = 3.0e-98
 Identities = 136/224 (60%), Positives = 152/224 (67%)

Query:   683 QNQQKNDNDLEXXXXXXXXXXXXXXXXXNTSDSLFDSQSKGGP----EPARRTSVGASSN 738
             + QQ+N+NDL+                 N  D   DS +KGG      P+ R   G + N
Sbjct:   656 KQQQENNNDLDSFFNSVSRPSSVPRQRTNPPDPFQDSWNKGGSFESSRPSSRVPSGPTEN 715

Query:   739 MRKASSTTNIVDDLXXXXXXXXXXXXEFQDVXXXXXXXXXXXXXXHQRTQERAAKALAEK 798
             +RKASS TNIVDDL             FQDV              HQRTQERAAKALAEK
Sbjct:   716 LRKASSATNIVDDLSSIFGAPASQSGGFQDVDGETEERRRARLERHQRTQERAAKALAEK 775

Query:   799 NERDLQAQRDQAERHRIAETLDVEIKRWAAGKEGNIRALLATMQYVLWPESGWQPVSLTD 858
             NERDLQ QR+QAE+ RI  TLDVEI+RW AGKEGN+RALL+T+QYVLWPE GWQPVSLTD
Sbjct:   776 NERDLQVQREQAEKDRIGGTLDVEIRRWGAGKEGNLRALLSTLQYVLWPECGWQPVSLTD 835

Query:   859 LITAAAVKKCYRKATLCIHPDKVQQKGANLQQKYIAEKVFDLLK 902
             LIT A+VKK YRKATLCIHPDKVQQKGANLQQKYIAEKVFD+LK
Sbjct:   836 LITGASVKKVYRKATLCIHPDKVQQKGANLQQKYIAEKVFDMLK 879


GO:0005634 "nucleus" evidence=ISM
GO:0005737 "cytoplasm" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0031072 "heat shock protein binding" evidence=IEA
GO:0005886 "plasma membrane" evidence=IDA
GO:0005829 "cytosol" evidence=IDA
TAIR|locus:2135778 AT4G12780 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2036967 AT1G21660 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2115245 AT4G36520 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2018462 AUL1 "AT1G75310" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2037256 JAC1 "J-domain protein required for chloroplast accumulation response 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2009817 AT1G30280 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|F1NC60 Gga.54538 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0276447 DDB_G0276447 "BAR domain-containing protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|F1NL76 Gga.54538 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
fgenesh2_kg.9__90__AT4G12770.1
annotation not avaliable (890 aa)
(Arabidopsis lyrata)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query965
PRK09510387 PRK09510, tolA, cell envelope integrity inner memb 2e-21
TIGR02794346 TIGR02794, tolA_full, TolA protein 4e-19
PRK09510387 PRK09510, tolA, cell envelope integrity inner memb 5e-19
PRK09510387 PRK09510, tolA, cell envelope integrity inner memb 5e-18
PRK05035695 PRK05035, PRK05035, electron transport complex pro 2e-16
COG3064387 COG3064, TolA, Membrane protein involved in colici 4e-16
TIGR02794346 TIGR02794, tolA_full, TolA protein 8e-16
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 3e-15
pfam13868349 pfam13868, Trichoplein, Tumour suppressor, Mitosta 7e-15
COG3064387 COG3064, TolA, Membrane protein involved in colici 1e-14
pfam13868349 pfam13868, Trichoplein, Tumour suppressor, Mitosta 1e-14
TIGR021681179 TIGR02168, SMC_prok_B, chromosome segregation prot 5e-14
COG2268548 COG2268, COG2268, Uncharacterized protein conserve 2e-13
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 3e-13
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 4e-13
pfam13868349 pfam13868, Trichoplein, Tumour suppressor, Mitosta 5e-13
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 2e-12
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 3e-12
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 3e-12
pfam13868349 pfam13868, Trichoplein, Tumour suppressor, Mitosta 4e-12
PTZ001212084 PTZ00121, PTZ00121, MAEBL; Provisional 9e-12
PRK02224880 PRK02224, PRK02224, chromosome segregation protein 9e-12
COG11961163 COG1196, Smc, Chromosome segregation ATPases [Cell 1e-11
PTZ001212084 PTZ00121, PTZ00121, MAEBL; Provisional 3e-11
COG2268548 COG2268, COG2268, Uncharacterized protein conserve 3e-11
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 3e-11
PRK12678 672 PRK12678, PRK12678, transcription termination fact 4e-11
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 4e-11
COG3064387 COG3064, TolA, Membrane protein involved in colici 5e-11
COG0419 908 COG0419, SbcC, ATPase involved in DNA repair [DNA 5e-11
PTZ001212084 PTZ00121, PTZ00121, MAEBL; Provisional 6e-11
PRK12678 672 PRK12678, PRK12678, transcription termination fact 7e-11
TIGR026801353 TIGR02680, TIGR02680, TIGR02680 family protein 9e-11
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 1e-10
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 2e-10
TIGR021681179 TIGR02168, SMC_prok_B, chromosome segregation prot 2e-10
PRK07735430 PRK07735, PRK07735, NADH dehydrogenase subunit C; 2e-10
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 3e-10
PRK02224 880 PRK02224, PRK02224, chromosome segregation protein 3e-10
PRK07735430 PRK07735, PRK07735, NADH dehydrogenase subunit C; 3e-10
COG2268548 COG2268, COG2268, Uncharacterized protein conserve 4e-10
COG11961163 COG1196, Smc, Chromosome segregation ATPases [Cell 5e-10
TIGR021681179 TIGR02168, SMC_prok_B, chromosome segregation prot 6e-10
TIGR02680 1353 TIGR02680, TIGR02680, TIGR02680 family protein 6e-10
pfam135141118 pfam13514, AAA_27, AAA domain 6e-10
COG11961163 COG1196, Smc, Chromosome segregation ATPases [Cell 1e-09
PRK12678 672 PRK12678, PRK12678, transcription termination fact 1e-09
PRK07735430 PRK07735, PRK07735, NADH dehydrogenase subunit C; 1e-09
pfam13868349 pfam13868, Trichoplein, Tumour suppressor, Mitosta 2e-09
TIGR021681179 TIGR02168, SMC_prok_B, chromosome segregation prot 2e-09
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 2e-09
PRK02224880 PRK02224, PRK02224, chromosome segregation protein 2e-09
PRK02224 880 PRK02224, PRK02224, chromosome segregation protein 2e-09
COG2268548 COG2268, COG2268, Uncharacterized protein conserve 3e-09
PRK02224880 PRK02224, PRK02224, chromosome segregation protein 3e-09
COG0419 908 COG0419, SbcC, ATPase involved in DNA repair [DNA 3e-09
pfam13514 1118 pfam13514, AAA_27, AAA domain 4e-09
TIGR021681179 TIGR02168, SMC_prok_B, chromosome segregation prot 5e-09
TIGR02680 1353 TIGR02680, TIGR02680, TIGR02680 family protein 5e-09
COG11961163 COG1196, Smc, Chromosome segregation ATPases [Cell 6e-09
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 8e-09
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 9e-09
TIGR02794346 TIGR02794, tolA_full, TolA protein 1e-08
COG11961163 COG1196, Smc, Chromosome segregation ATPases [Cell 1e-08
PRK12704520 PRK12704, PRK12704, phosphodiesterase; Provisional 1e-08
TIGR026801353 TIGR02680, TIGR02680, TIGR02680 family protein 2e-08
COG4942420 COG4942, COG4942, Membrane-bound metallopeptidase 2e-08
pfam10243506 pfam10243, MIP-T3, Microtubule-binding protein MIP 2e-08
PRK06991270 PRK06991, PRK06991, ferredoxin; Provisional 2e-08
pfam13830321 pfam13830, DUF4192, Domain of unknown function (DU 2e-08
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 3e-08
PRK02224 880 PRK02224, PRK02224, chromosome segregation protein 4e-08
TIGR02680 1353 TIGR02680, TIGR02680, TIGR02680 family protein 4e-08
pfam135141118 pfam13514, AAA_27, AAA domain 4e-08
pfam135141118 pfam13514, AAA_27, AAA domain 4e-08
PRK06991270 PRK06991, PRK06991, ferredoxin; Provisional 4e-08
PRK05035695 PRK05035, PRK05035, electron transport complex pro 5e-08
PRK07735430 PRK07735, PRK07735, NADH dehydrogenase subunit C; 5e-08
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 6e-08
TIGR021691164 TIGR02169, SMC_prok_A, chromosome segregation prot 8e-08
COG3064387 COG3064, TolA, Membrane protein involved in colici 1e-07
COG11961163 COG1196, Smc, Chromosome segregation ATPases [Cell 1e-07
TIGR00618 1042 TIGR00618, sbcc, exonuclease SbcC 1e-07
COG11961163 COG1196, Smc, Chromosome segregation ATPases [Cell 2e-07
TIGR02680 1353 TIGR02680, TIGR02680, TIGR02680 family protein 4e-07
PRK12704520 PRK12704, PRK12704, phosphodiesterase; Provisional 4e-07
COG0711161 COG0711, AtpF, F0F1-type ATP synthase, subunit b [ 4e-07
PRK12678 672 PRK12678, PRK12678, transcription termination fact 5e-07
TIGR02680 1353 TIGR02680, TIGR02680, TIGR02680 family protein 5e-07
TIGR03319514 TIGR03319, RNase_Y, ribonuclease Y 5e-07
PRK149001052 PRK14900, valS, valyl-tRNA synthetase; Provisional 7e-07
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 8e-07
PRK12678 672 PRK12678, PRK12678, transcription termination fact 1e-06
PRK12704520 PRK12704, PRK12704, phosphodiesterase; Provisional 1e-06
PRK108111068 PRK10811, rne, ribonuclease E; Reviewed 1e-06
PRK07003830 PRK07003, PRK07003, DNA polymerase III subunits ga 1e-06
pfam13868349 pfam13868, Trichoplein, Tumour suppressor, Mitosta 2e-06
PRK02224880 PRK02224, PRK02224, chromosome segregation protein 2e-06
PRK12678672 PRK12678, PRK12678, transcription termination fact 2e-06
pfam121281198 pfam12128, DUF3584, Protein of unknown function (D 2e-06
PLN032371465 PLN03237, PLN03237, DNA topoisomerase 2; Provision 2e-06
PLN032371465 PLN03237, PLN03237, DNA topoisomerase 2; Provision 2e-06
COG4372499 COG4372, COG4372, Uncharacterized protein conserve 2e-06
PRK12705508 PRK12705, PRK12705, hypothetical protein; Provisio 2e-06
COG0419908 COG0419, SbcC, ATPase involved in DNA repair [DNA 3e-06
COG1340294 COG1340, COG1340, Uncharacterized archaeal coiled- 3e-06
pfam05262489 pfam05262, Borrelia_P83, Borrelia P83/100 protein 3e-06
PRK06669281 PRK06669, fliH, flagellar assembly protein H; Vali 3e-06
pfam08017393 pfam08017, Fibrinogen_BP, Fibrinogen binding prote 3e-06
COG0419908 COG0419, SbcC, ATPase involved in DNA repair [DNA 4e-06
COG0419908 COG0419, SbcC, ATPase involved in DNA repair [DNA 4e-06
COG1566352 COG1566, EmrA, Multidrug resistance efflux pump [D 4e-06
PRK00247429 PRK00247, PRK00247, putative inner membrane protei 4e-06
PRK05759156 PRK05759, PRK05759, F0F1 ATP synthase subunit B; V 4e-06
COG0419 908 COG0419, SbcC, ATPase involved in DNA repair [DNA 6e-06
TIGR02680 1353 TIGR02680, TIGR02680, TIGR02680 family protein 6e-06
COG4372499 COG4372, COG4372, Uncharacterized protein conserve 6e-06
PRK00409782 PRK00409, PRK00409, recombination and DNA strand e 6e-06
PRK05035695 PRK05035, PRK05035, electron transport complex pro 7e-06
TIGR021681179 TIGR02168, SMC_prok_B, chromosome segregation prot 7e-06
pfam02463 1162 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain 7e-06
pfam07767387 pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) 7e-06
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 8e-06
PRK05759156 PRK05759, PRK05759, F0F1 ATP synthase subunit B; V 8e-06
COG4372499 COG4372, COG4372, Uncharacterized protein conserve 9e-06
pfam12128 1198 pfam12128, DUF3584, Protein of unknown function (D 1e-05
pfam07767387 pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) 1e-05
PRK12472508 PRK12472, PRK12472, hypothetical protein; Provisio 1e-05
PRK03918880 PRK03918, PRK03918, chromosome segregation protein 1e-05
COG2433652 COG2433, COG2433, Uncharacterized conserved protei 1e-05
TIGR021681179 TIGR02168, SMC_prok_B, chromosome segregation prot 2e-05
COG0711161 COG0711, AtpF, F0F1-type ATP synthase, subunit b [ 2e-05
TIGR03319514 TIGR03319, RNase_Y, ribonuclease Y 2e-05
PRK12705508 PRK12705, PRK12705, hypothetical protein; Provisio 2e-05
pfam05262489 pfam05262, Borrelia_P83, Borrelia P83/100 protein 2e-05
PRK05759156 PRK05759, PRK05759, F0F1 ATP synthase subunit B; V 2e-05
pfam02463 1162 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain 2e-05
COG1842225 COG1842, PspA, Phage shock protein A (IM30), suppr 2e-05
pfam07767387 pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) 3e-05
COG0330291 COG0330, HflC, Membrane protease subunits, stomati 3e-05
COG3599212 COG3599, DivIVA, Cell division initiation protein 3e-05
TIGR02680 1353 TIGR02680, TIGR02680, TIGR02680 family protein 4e-05
TIGR026801353 TIGR02680, TIGR02680, TIGR02680 family protein 4e-05
PRK00106535 PRK00106, PRK00106, hypothetical protein; Provisio 4e-05
pfam13868349 pfam13868, Trichoplein, Tumour suppressor, Mitosta 5e-05
COG4942420 COG4942, COG4942, Membrane-bound metallopeptidase 5e-05
PRK07003830 PRK07003, PRK07003, DNA polymerase III subunits ga 5e-05
pfam00769244 pfam00769, ERM, Ezrin/radixin/moesin family 5e-05
TIGR02971327 TIGR02971, heterocyst_DevB, ABC exporter membrane 5e-05
pfam05701484 pfam05701, DUF827, Plant protein of unknown functi 5e-05
PRK07352174 PRK07352, PRK07352, F0F1 ATP synthase subunit B; V 6e-05
TIGR02680 1353 TIGR02680, TIGR02680, TIGR02680 family protein 7e-05
PRK03918880 PRK03918, PRK03918, chromosome segregation protein 7e-05
PRK04863 1486 PRK04863, mukB, cell division protein MukB; Provis 9e-05
COG11961163 COG1196, Smc, Chromosome segregation ATPases [Cell 1e-04
TIGR021691164 TIGR02169, SMC_prok_A, chromosome segregation prot 1e-04
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 1e-04
PRK12704520 PRK12704, PRK12704, phosphodiesterase; Provisional 1e-04
PRK00247429 PRK00247, PRK00247, putative inner membrane protei 1e-04
PRK12472508 PRK12472, PRK12472, hypothetical protein; Provisio 1e-04
pfam10174774 pfam10174, Cast, RIM-binding protein of the cytoma 1e-04
PRK06995484 PRK06995, flhF, flagellar biosynthesis regulator F 1e-04
pfam09756189 pfam09756, DDRGK, DDRGK domain 1e-04
COG5281833 COG5281, COG5281, Phage-related minor tail protein 1e-04
PRK11637428 PRK11637, PRK11637, AmiB activator; Provisional 1e-04
PRK108111068 PRK10811, rne, ribonuclease E; Reviewed 2e-04
pfam07767387 pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) 2e-04
PRK12472508 PRK12472, PRK12472, hypothetical protein; Provisio 2e-04
PRK12472508 PRK12472, PRK12472, hypothetical protein; Provisio 2e-04
COG0330291 COG0330, HflC, Membrane protease subunits, stomati 2e-04
pfam00769244 pfam00769, ERM, Ezrin/radixin/moesin family 2e-04
PRK04863 1486 PRK04863, mukB, cell division protein MukB; Provis 2e-04
pfam09756189 pfam09756, DDRGK, DDRGK domain 2e-04
TIGR01843423 TIGR01843, type_I_hlyD, type I secretion membrane 2e-04
TIGR01843423 TIGR01843, type_I_hlyD, type I secretion membrane 2e-04
COG5269379 COG5269, ZUO1, Ribosome-associated chaperone zuoti 2e-04
COG1538457 COG1538, TolC, Outer membrane protein [Cell envelo 2e-04
TIGR03345852 TIGR03345, VI_ClpV1, type VI secretion ATPase, Clp 2e-04
COG1579239 COG1579, COG1579, Zn-ribbon protein, possibly nucl 2e-04
COG0711161 COG0711, AtpF, F0F1-type ATP synthase, subunit b [ 3e-04
pfam00769244 pfam00769, ERM, Ezrin/radixin/moesin family 3e-04
pfam05914379 pfam05914, RIB43A, RIB43A 3e-04
pfam12037276 pfam12037, DUF3523, Domain of unknown function (DU 3e-04
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 3e-04
pfam07111739 pfam07111, HCR, Alpha helical coiled-coil rod prot 3e-04
COG0711161 COG0711, AtpF, F0F1-type ATP synthase, subunit b [ 4e-04
COG4372499 COG4372, COG4372, Uncharacterized protein conserve 4e-04
pfam07767387 pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) 4e-04
pfam09756189 pfam09756, DDRGK, DDRGK domain 4e-04
TIGR03345852 TIGR03345, VI_ClpV1, type VI secretion ATPase, Clp 4e-04
PRK09098233 PRK09098, PRK09098, type III secretion system prot 4e-04
PRK13108460 PRK13108, PRK13108, prolipoprotein diacylglyceryl 4e-04
COG0845372 COG0845, AcrA, Membrane-fusion protein [Cell envel 4e-04
COG51921077 COG5192, BMS1, GTP-binding protein required for 40 4e-04
pfam13514 1118 pfam13514, AAA_27, AAA domain 5e-04
PRK05759156 PRK05759, PRK05759, F0F1 ATP synthase subunit B; V 5e-04
pfam02463 1162 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain 5e-04
PHA00430568 PHA00430, PHA00430, tail fiber protein 5e-04
pfam13863126 pfam13863, DUF4200, Domain of unknown function (DU 5e-04
PRK09510387 PRK09510, tolA, cell envelope integrity inner memb 6e-04
TIGR02794346 TIGR02794, tolA_full, TolA protein 6e-04
COG3064387 COG3064, TolA, Membrane protein involved in colici 6e-04
PRK06995484 PRK06995, flhF, flagellar biosynthesis regulator F 6e-04
PHA00430568 PHA00430, PHA00430, tail fiber protein 6e-04
pfam03962188 pfam03962, Mnd1, Mnd1 family 6e-04
PRK12323700 PRK12323, PRK12323, DNA polymerase III subunits ga 6e-04
TIGR03346852 TIGR03346, chaperone_ClpB, ATP-dependent chaperone 7e-04
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 7e-04
pfam09731493 pfam09731, Mitofilin, Mitochondrial inner membrane 7e-04
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 8e-04
PRK07352174 PRK07352, PRK07352, F0F1 ATP synthase subunit B; V 8e-04
PTZ00436357 PTZ00436, PTZ00436, 60S ribosomal protein L19-like 8e-04
pfam05279240 pfam05279, Asp-B-Hydro_N, Aspartyl beta-hydroxylas 9e-04
PRK02224880 PRK02224, PRK02224, chromosome segregation protein 0.001
TIGR021691164 TIGR02169, SMC_prok_A, chromosome segregation prot 0.001
PRK12704 520 PRK12704, PRK12704, phosphodiesterase; Provisional 0.001
COG4942420 COG4942, COG4942, Membrane-bound metallopeptidase 0.001
PRK06991270 PRK06991, PRK06991, ferredoxin; Provisional 0.001
PRK00247429 PRK00247, PRK00247, putative inner membrane protei 0.001
COG1842225 COG1842, PspA, Phage shock protein A (IM30), suppr 0.001
PRK06995484 PRK06995, flhF, flagellar biosynthesis regulator F 0.001
PRK06995484 PRK06995, flhF, flagellar biosynthesis regulator F 0.001
pfam09756189 pfam09756, DDRGK, DDRGK domain 0.001
TIGR03345852 TIGR03345, VI_ClpV1, type VI secretion ATPase, Clp 0.001
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 0.001
PRK13108460 PRK13108, PRK13108, prolipoprotein diacylglyceryl 0.001
PTZ00436357 PTZ00436, PTZ00436, 60S ribosomal protein L19-like 0.001
PLN02316 1036 PLN02316, PLN02316, synthase/transferase 0.001
pfam04632649 pfam04632, FUSC, Fusaric acid resistance protein f 0.001
pfam10721162 pfam10721, DUF2514, Protein of unknown function (D 0.001
pfam10721162 pfam10721, DUF2514, Protein of unknown function (D 0.001
PLN03086 567 PLN03086, PLN03086, PRLI-interacting factor K; Pro 0.001
pfam04156186 pfam04156, IncA, IncA protein 0.001
PRK14521186 PRK14521, rpsP, 30S ribosomal protein S16; Provisi 0.001
TIGR03185650 TIGR03185, DNA_S_dndD, DNA sulfur modification pro 0.001
pfam04094843 pfam04094, DUF390, Protein of unknown function (DU 0.001
pfam00430132 pfam00430, ATP-synt_B, ATP synthase B/B' CF(0) 0.001
PTZ00491850 PTZ00491, PTZ00491, major vault protein; Provision 0.001
COG0419908 COG0419, SbcC, ATPase involved in DNA repair [DNA 0.002
PRK07735430 PRK07735, PRK07735, NADH dehydrogenase subunit C; 0.002
pfam13514 1118 pfam13514, AAA_27, AAA domain 0.002
pfam12128 1198 pfam12128, DUF3584, Protein of unknown function (D 0.002
pfam05262489 pfam05262, Borrelia_P83, Borrelia P83/100 protein 0.002
pfam08017393 pfam08017, Fibrinogen_BP, Fibrinogen binding prote 0.002
COG1566352 COG1566, EmrA, Multidrug resistance efflux pump [D 0.002
COG1566352 COG1566, EmrA, Multidrug resistance efflux pump [D 0.002
PRK00247429 PRK00247, PRK00247, putative inner membrane protei 0.002
pfam024631162 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain 0.002
COG3599212 COG3599, DivIVA, Cell division initiation protein 0.002
PRK11637428 PRK11637, PRK11637, AmiB activator; Provisional 0.002
PRK09098233 PRK09098, PRK09098, type III secretion system prot 0.002
COG0845372 COG0845, AcrA, Membrane-fusion protein [Cell envel 0.002
PTZ00436357 PTZ00436, PTZ00436, 60S ribosomal protein L19-like 0.002
PRK14521186 PRK14521, rpsP, 30S ribosomal protein S16; Provisi 0.002
pfam00430132 pfam00430, ATP-synt_B, ATP synthase B/B' CF(0) 0.002
pfam13904261 pfam13904, DUF4207, Domain of unknown function (DU 0.002
COG3206458 COG3206, GumC, Uncharacterized protein involved in 0.002
pfam11740120 pfam11740, KfrA_N, Plasmid replication region DNA- 0.002
pfam01576859 pfam01576, Myosin_tail_1, Myosin tail 0.002
pfam06637442 pfam06637, PV-1, PV-1 protein (PLVAP) 0.002
PRK03918 880 PRK03918, PRK03918, chromosome segregation protein 0.003
PRK04863 1486 PRK04863, mukB, cell division protein MukB; Provis 0.003
COG1538457 COG1538, TolC, Outer membrane protein [Cell envelo 0.003
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 0.003
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 0.003
PRK12323700 PRK12323, PRK12323, DNA polymerase III subunits ga 0.003
COG4487438 COG4487, COG4487, Uncharacterized protein conserve 0.003
TIGR01554384 TIGR01554, major_cap_HK97, phage major capsid prot 0.003
pfam07946322 pfam07946, DUF1682, Protein of unknown function (D 0.003
COG0488530 COG0488, Uup, ATPase components of ABC transporter 0.003
PRK12372413 PRK12372, PRK12372, ribonuclease III; Reviewed 0.003
cd08045212 cd08045, TAF4, TATA Binding Protein (TBP) Associat 0.003
PTZ00399651 PTZ00399, PTZ00399, cysteinyl-tRNA-synthetase; Pro 0.003
PRK137091747 PRK13709, PRK13709, conjugal transfer nickase/heli 0.003
PRK00247429 PRK00247, PRK00247, putative inner membrane protei 0.004
COG0330291 COG0330, HflC, Membrane protease subunits, stomati 0.004
pfam00769244 pfam00769, ERM, Ezrin/radixin/moesin family 0.004
PLN03086 567 PLN03086, PLN03086, PRLI-interacting factor K; Pro 0.004
pfam07946322 pfam07946, DUF1682, Protein of unknown function (D 0.004
pfam00529304 pfam00529, HlyD, HlyD family secretion protein 0.004
pfam02841297 pfam02841, GBP_C, Guanylate-binding protein, C-ter 0.004
pfam14362297 pfam14362, DUF4407, Domain of unknown function (DU 0.004
PRK14472175 PRK14472, PRK14472, F0F1 ATP synthase subunit B; P 0.004
PRK14473164 PRK14473, PRK14473, F0F1 ATP synthase subunit B; P 0.004
pfam08524150 pfam08524, rRNA_processing, rRNA processing 0.004
pfam05236255 pfam05236, TAF4, Transcription initiation factor T 0.004
smart00880262 smart00880, CHAD, The CHAD domain is an alpha-heli 0.004
pfam00901507 pfam00901, Orbi_VP5, Orbivirus outer capsid protei 0.004
>gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional Back     alignment and domain information
 Score = 97.6 bits (243), Expect = 2e-21
 Identities = 74/200 (37%), Positives = 117/200 (58%), Gaps = 12/200 (6%)

Query: 488 EERATQQDAQERLDREMQQREKGEEQRRLEREREREREEKEREKKRIEKEKERAREIEKE 547
           E+   QQ  Q+   R  +QR+K E+Q+    E ++++  ++   K++EKE+  A+E +K+
Sbjct: 62  EQYNRQQQQQKSAKRAEEQRKKKEQQQ--AEELQQKQAAEQERLKQLEKERLAAQEQKKQ 119

Query: 548 REKARQAVERATREARE---RAAAEARLKAERAAVDKANAAARERAERAAVQRAQAEARE 604
            E+A +      ++A E   +AAA A+ KAE  A  K  AAA ++A   A ++A+AEA +
Sbjct: 120 AEEAAKQAALKQKQAEEAAAKAAAAAKAKAEAEA--KRAAAAAKKAAAEAKKKAEAEAAK 177

Query: 605 RAAAEARERAE-----RAAAEARERANAEAREKEARERASVARTEAEALQRAERAAVQRA 659
           +AAAEA+++AE     +AAAEA+++A AEA++K A E    A  EA+A      A  + A
Sbjct: 178 KAAAEAKKKAEAEAAAKAAAEAKKKAEAEAKKKAAAEAKKKAAAEAKAAAAKAAAEAKAA 237

Query: 660 ASEARERAAAEARERAAAAA 679
           A +A    AAE    A AAA
Sbjct: 238 AEKAAAAKAAEKAAAAKAAA 257


Length = 387

>gnl|CDD|234017 TIGR02794, tolA_full, TolA protein Back     alignment and domain information
>gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional Back     alignment and domain information
>gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional Back     alignment and domain information
>gnl|CDD|235334 PRK05035, PRK05035, electron transport complex protein RnfC; Provisional Back     alignment and domain information
>gnl|CDD|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|234017 TIGR02794, tolA_full, TolA protein Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin Back     alignment and domain information
>gnl|CDD|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|225177 COG2268, COG2268, Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|225177 COG2268, COG2268, Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional Back     alignment and domain information
>gnl|CDD|233973 TIGR02680, TIGR02680, TIGR02680 family protein Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|236081 PRK07735, PRK07735, NADH dehydrogenase subunit C; Validated Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|236081 PRK07735, PRK07735, NADH dehydrogenase subunit C; Validated Back     alignment and domain information
>gnl|CDD|225177 COG2268, COG2268, Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|233973 TIGR02680, TIGR02680, TIGR02680 family protein Back     alignment and domain information
>gnl|CDD|205692 pfam13514, AAA_27, AAA domain Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional Back     alignment and domain information
>gnl|CDD|236081 PRK07735, PRK07735, NADH dehydrogenase subunit C; Validated Back     alignment and domain information
>gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|225177 COG2268, COG2268, Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|205692 pfam13514, AAA_27, AAA domain Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|233973 TIGR02680, TIGR02680, TIGR02680 family protein Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|234017 TIGR02794, tolA_full, TolA protein Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional Back     alignment and domain information
>gnl|CDD|233973 TIGR02680, TIGR02680, TIGR02680 family protein Back     alignment and domain information
>gnl|CDD|227278 COG4942, COG4942, Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 Back     alignment and domain information
>gnl|CDD|235903 PRK06991, PRK06991, ferredoxin; Provisional Back     alignment and domain information
>gnl|CDD|222405 pfam13830, DUF4192, Domain of unknown function (DUF4192) Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|233973 TIGR02680, TIGR02680, TIGR02680 family protein Back     alignment and domain information
>gnl|CDD|205692 pfam13514, AAA_27, AAA domain Back     alignment and domain information
>gnl|CDD|205692 pfam13514, AAA_27, AAA domain Back     alignment and domain information
>gnl|CDD|235903 PRK06991, PRK06991, ferredoxin; Provisional Back     alignment and domain information
>gnl|CDD|235334 PRK05035, PRK05035, electron transport complex protein RnfC; Provisional Back     alignment and domain information
>gnl|CDD|236081 PRK07735, PRK07735, NADH dehydrogenase subunit C; Validated Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|129705 TIGR00618, sbcc, exonuclease SbcC Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233973 TIGR02680, TIGR02680, TIGR02680 family protein Back     alignment and domain information
>gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional Back     alignment and domain information
>gnl|CDD|223783 COG0711, AtpF, F0F1-type ATP synthase, subunit b [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional Back     alignment and domain information
>gnl|CDD|233973 TIGR02680, TIGR02680, TIGR02680 family protein Back     alignment and domain information
>gnl|CDD|188306 TIGR03319, RNase_Y, ribonuclease Y Back     alignment and domain information
>gnl|CDD|237855 PRK14900, valS, valyl-tRNA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional Back     alignment and domain information
>gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional Back     alignment and domain information
>gnl|CDD|236766 PRK10811, rne, ribonuclease E; Reviewed Back     alignment and domain information
>gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin Back     alignment and domain information
>gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional Back     alignment and domain information
>gnl|CDD|221432 pfam12128, DUF3584, Protein of unknown function (DUF3584) Back     alignment and domain information
>gnl|CDD|215641 PLN03237, PLN03237, DNA topoisomerase 2; Provisional Back     alignment and domain information
>gnl|CDD|215641 PLN03237, PLN03237, DNA topoisomerase 2; Provisional Back     alignment and domain information
>gnl|CDD|226809 COG4372, COG4372, Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] Back     alignment and domain information
>gnl|CDD|237178 PRK12705, PRK12705, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|224259 COG1340, COG1340, Uncharacterized archaeal coiled-coil protein [Function unknown] Back     alignment and domain information
>gnl|CDD|114011 pfam05262, Borrelia_P83, Borrelia P83/100 protein Back     alignment and domain information
>gnl|CDD|235850 PRK06669, fliH, flagellar assembly protein H; Validated Back     alignment and domain information
>gnl|CDD|116627 pfam08017, Fibrinogen_BP, Fibrinogen binding protein Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|224482 COG1566, EmrA, Multidrug resistance efflux pump [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|178945 PRK00247, PRK00247, putative inner membrane protein translocase component YidC; Validated Back     alignment and domain information
>gnl|CDD|180240 PRK05759, PRK05759, F0F1 ATP synthase subunit B; Validated Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|233973 TIGR02680, TIGR02680, TIGR02680 family protein Back     alignment and domain information
>gnl|CDD|226809 COG4372, COG4372, Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] Back     alignment and domain information
>gnl|CDD|234750 PRK00409, PRK00409, recombination and DNA strand exchange inhibitor protein; Reviewed Back     alignment and domain information
>gnl|CDD|235334 PRK05035, PRK05035, electron transport complex protein RnfC; Provisional Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain Back     alignment and domain information
>gnl|CDD|219563 pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|180240 PRK05759, PRK05759, F0F1 ATP synthase subunit B; Validated Back     alignment and domain information
>gnl|CDD|226809 COG4372, COG4372, Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] Back     alignment and domain information
>gnl|CDD|221432 pfam12128, DUF3584, Protein of unknown function (DUF3584) Back     alignment and domain information
>gnl|CDD|219563 pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) Back     alignment and domain information
>gnl|CDD|237110 PRK12472, PRK12472, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|225288 COG2433, COG2433, Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|223783 COG0711, AtpF, F0F1-type ATP synthase, subunit b [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|188306 TIGR03319, RNase_Y, ribonuclease Y Back     alignment and domain information
>gnl|CDD|237178 PRK12705, PRK12705, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|114011 pfam05262, Borrelia_P83, Borrelia P83/100 protein Back     alignment and domain information
>gnl|CDD|180240 PRK05759, PRK05759, F0F1 ATP synthase subunit B; Validated Back     alignment and domain information
>gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain Back     alignment and domain information
>gnl|CDD|224755 COG1842, PspA, Phage shock protein A (IM30), suppresses sigma54-dependent transcription [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|219563 pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) Back     alignment and domain information
>gnl|CDD|223407 COG0330, HflC, Membrane protease subunits, stomatin/prohibitin homologs [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|226127 COG3599, DivIVA, Cell division initiation protein [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233973 TIGR02680, TIGR02680, TIGR02680 family protein Back     alignment and domain information
>gnl|CDD|233973 TIGR02680, TIGR02680, TIGR02680 family protein Back     alignment and domain information
>gnl|CDD|178867 PRK00106, PRK00106, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin Back     alignment and domain information
>gnl|CDD|227278 COG4942, COG4942, Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|216108 pfam00769, ERM, Ezrin/radixin/moesin family Back     alignment and domain information
>gnl|CDD|213754 TIGR02971, heterocyst_DevB, ABC exporter membrane fusion protein, DevB family Back     alignment and domain information
>gnl|CDD|218704 pfam05701, DUF827, Plant protein of unknown function (DUF827) Back     alignment and domain information
>gnl|CDD|180941 PRK07352, PRK07352, F0F1 ATP synthase subunit B; Validated Back     alignment and domain information
>gnl|CDD|233973 TIGR02680, TIGR02680, TIGR02680 family protein Back     alignment and domain information
>gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|235316 PRK04863, mukB, cell division protein MukB; Provisional Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional Back     alignment and domain information
>gnl|CDD|178945 PRK00247, PRK00247, putative inner membrane protein translocase component YidC; Validated Back     alignment and domain information
>gnl|CDD|237110 PRK12472, PRK12472, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|220614 pfam10174, Cast, RIM-binding protein of the cytomatrix active zone Back     alignment and domain information
>gnl|CDD|235904 PRK06995, flhF, flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>gnl|CDD|220383 pfam09756, DDRGK, DDRGK domain Back     alignment and domain information
>gnl|CDD|227606 COG5281, COG5281, Phage-related minor tail protein [Function unknown] Back     alignment and domain information
>gnl|CDD|236942 PRK11637, PRK11637, AmiB activator; Provisional Back     alignment and domain information
>gnl|CDD|236766 PRK10811, rne, ribonuclease E; Reviewed Back     alignment and domain information
>gnl|CDD|219563 pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) Back     alignment and domain information
>gnl|CDD|237110 PRK12472, PRK12472, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|237110 PRK12472, PRK12472, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|223407 COG0330, HflC, Membrane protease subunits, stomatin/prohibitin homologs [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|216108 pfam00769, ERM, Ezrin/radixin/moesin family Back     alignment and domain information
>gnl|CDD|235316 PRK04863, mukB, cell division protein MukB; Provisional Back     alignment and domain information
>gnl|CDD|220383 pfam09756, DDRGK, DDRGK domain Back     alignment and domain information
>gnl|CDD|130902 TIGR01843, type_I_hlyD, type I secretion membrane fusion protein, HlyD family Back     alignment and domain information
>gnl|CDD|130902 TIGR01843, type_I_hlyD, type I secretion membrane fusion protein, HlyD family Back     alignment and domain information
>gnl|CDD|227594 COG5269, ZUO1, Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|224455 COG1538, TolC, Outer membrane protein [Cell envelope biogenesis, outer membrane / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|234172 TIGR03345, VI_ClpV1, type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>gnl|CDD|224495 COG1579, COG1579, Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>gnl|CDD|223783 COG0711, AtpF, F0F1-type ATP synthase, subunit b [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|216108 pfam00769, ERM, Ezrin/radixin/moesin family Back     alignment and domain information
>gnl|CDD|147845 pfam05914, RIB43A, RIB43A Back     alignment and domain information
>gnl|CDD|221389 pfam12037, DUF3523, Domain of unknown function (DUF3523) Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|148617 pfam07111, HCR, Alpha helical coiled-coil rod protein (HCR) Back     alignment and domain information
>gnl|CDD|223783 COG0711, AtpF, F0F1-type ATP synthase, subunit b [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|226809 COG4372, COG4372, Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] Back     alignment and domain information
>gnl|CDD|219563 pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) Back     alignment and domain information
>gnl|CDD|220383 pfam09756, DDRGK, DDRGK domain Back     alignment and domain information
>gnl|CDD|234172 TIGR03345, VI_ClpV1, type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>gnl|CDD|181646 PRK09098, PRK09098, type III secretion system protein HrpB; Validated Back     alignment and domain information
>gnl|CDD|237284 PRK13108, PRK13108, prolipoprotein diacylglyceryl transferase; Reviewed Back     alignment and domain information
>gnl|CDD|223914 COG0845, AcrA, Membrane-fusion protein [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|227519 COG5192, BMS1, GTP-binding protein required for 40S ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|205692 pfam13514, AAA_27, AAA domain Back     alignment and domain information
>gnl|CDD|180240 PRK05759, PRK05759, F0F1 ATP synthase subunit B; Validated Back     alignment and domain information
>gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain Back     alignment and domain information
>gnl|CDD|222790 PHA00430, PHA00430, tail fiber protein Back     alignment and domain information
>gnl|CDD|206034 pfam13863, DUF4200, Domain of unknown function (DUF4200) Back     alignment and domain information
>gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional Back     alignment and domain information
>gnl|CDD|234017 TIGR02794, tolA_full, TolA protein Back     alignment and domain information
>gnl|CDD|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|235904 PRK06995, flhF, flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>gnl|CDD|222790 PHA00430, PHA00430, tail fiber protein Back     alignment and domain information
>gnl|CDD|202833 pfam03962, Mnd1, Mnd1 family Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|234173 TIGR03346, chaperone_ClpB, ATP-dependent chaperone ClpB Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|220369 pfam09731, Mitofilin, Mitochondrial inner membrane protein Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|180941 PRK07352, PRK07352, F0F1 ATP synthase subunit B; Validated Back     alignment and domain information
>gnl|CDD|185616 PTZ00436, PTZ00436, 60S ribosomal protein L19-like protein; Provisional Back     alignment and domain information
>gnl|CDD|191249 pfam05279, Asp-B-Hydro_N, Aspartyl beta-hydroxylase N-terminal region Back     alignment and domain information
>gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional Back     alignment and domain information
>gnl|CDD|227278 COG4942, COG4942, Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|235903 PRK06991, PRK06991, ferredoxin; Provisional Back     alignment and domain information
>gnl|CDD|178945 PRK00247, PRK00247, putative inner membrane protein translocase component YidC; Validated Back     alignment and domain information
>gnl|CDD|224755 COG1842, PspA, Phage shock protein A (IM30), suppresses sigma54-dependent transcription [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|235904 PRK06995, flhF, flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>gnl|CDD|235904 PRK06995, flhF, flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>gnl|CDD|220383 pfam09756, DDRGK, DDRGK domain Back     alignment and domain information
>gnl|CDD|234172 TIGR03345, VI_ClpV1, type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237284 PRK13108, PRK13108, prolipoprotein diacylglyceryl transferase; Reviewed Back     alignment and domain information
>gnl|CDD|185616 PTZ00436, PTZ00436, 60S ribosomal protein L19-like protein; Provisional Back     alignment and domain information
>gnl|CDD|215180 PLN02316, PLN02316, synthase/transferase Back     alignment and domain information
>gnl|CDD|218184 pfam04632, FUSC, Fusaric acid resistance protein family Back     alignment and domain information
>gnl|CDD|119241 pfam10721, DUF2514, Protein of unknown function (DUF2514) Back     alignment and domain information
>gnl|CDD|119241 pfam10721, DUF2514, Protein of unknown function (DUF2514) Back     alignment and domain information
>gnl|CDD|178635 PLN03086, PLN03086, PRLI-interacting factor K; Provisional Back     alignment and domain information
>gnl|CDD|217933 pfam04156, IncA, IncA protein Back     alignment and domain information
>gnl|CDD|237744 PRK14521, rpsP, 30S ribosomal protein S16; Provisional Back     alignment and domain information
>gnl|CDD|234141 TIGR03185, DNA_S_dndD, DNA sulfur modification protein DndD Back     alignment and domain information
>gnl|CDD|112890 pfam04094, DUF390, Protein of unknown function (DUF390) Back     alignment and domain information
>gnl|CDD|109486 pfam00430, ATP-synt_B, ATP synthase B/B' CF(0) Back     alignment and domain information
>gnl|CDD|240439 PTZ00491, PTZ00491, major vault protein; Provisional Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|236081 PRK07735, PRK07735, NADH dehydrogenase subunit C; Validated Back     alignment and domain information
>gnl|CDD|205692 pfam13514, AAA_27, AAA domain Back     alignment and domain information
>gnl|CDD|221432 pfam12128, DUF3584, Protein of unknown function (DUF3584) Back     alignment and domain information
>gnl|CDD|114011 pfam05262, Borrelia_P83, Borrelia P83/100 protein Back     alignment and domain information
>gnl|CDD|116627 pfam08017, Fibrinogen_BP, Fibrinogen binding protein Back     alignment and domain information
>gnl|CDD|224482 COG1566, EmrA, Multidrug resistance efflux pump [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|224482 COG1566, EmrA, Multidrug resistance efflux pump [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|178945 PRK00247, PRK00247, putative inner membrane protein translocase component YidC; Validated Back     alignment and domain information
>gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain Back     alignment and domain information
>gnl|CDD|226127 COG3599, DivIVA, Cell division initiation protein [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|236942 PRK11637, PRK11637, AmiB activator; Provisional Back     alignment and domain information
>gnl|CDD|181646 PRK09098, PRK09098, type III secretion system protein HrpB; Validated Back     alignment and domain information
>gnl|CDD|223914 COG0845, AcrA, Membrane-fusion protein [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|185616 PTZ00436, PTZ00436, 60S ribosomal protein L19-like protein; Provisional Back     alignment and domain information
>gnl|CDD|237744 PRK14521, rpsP, 30S ribosomal protein S16; Provisional Back     alignment and domain information
>gnl|CDD|109486 pfam00430, ATP-synt_B, ATP synthase B/B' CF(0) Back     alignment and domain information
>gnl|CDD|222447 pfam13904, DUF4207, Domain of unknown function (DUF4207) Back     alignment and domain information
>gnl|CDD|225747 COG3206, GumC, Uncharacterized protein involved in exopolysaccharide biosynthesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|221198 pfam11740, KfrA_N, Plasmid replication region DNA-binding N-term Back     alignment and domain information
>gnl|CDD|144972 pfam01576, Myosin_tail_1, Myosin tail Back     alignment and domain information
>gnl|CDD|115307 pfam06637, PV-1, PV-1 protein (PLVAP) Back     alignment and domain information
>gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|235316 PRK04863, mukB, cell division protein MukB; Provisional Back     alignment and domain information
>gnl|CDD|224455 COG1538, TolC, Outer membrane protein [Cell envelope biogenesis, outer membrane / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|226889 COG4487, COG4487, Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>gnl|CDD|233467 TIGR01554, major_cap_HK97, phage major capsid protein, HK97 family Back     alignment and domain information
>gnl|CDD|219655 pfam07946, DUF1682, Protein of unknown function (DUF1682) Back     alignment and domain information
>gnl|CDD|223562 COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>gnl|CDD|237081 PRK12372, PRK12372, ribonuclease III; Reviewed Back     alignment and domain information
>gnl|CDD|173965 cd08045, TAF4, TATA Binding Protein (TBP) Associated Factor 4 (TAF4) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex Back     alignment and domain information
>gnl|CDD|240402 PTZ00399, PTZ00399, cysteinyl-tRNA-synthetase; Provisional Back     alignment and domain information
>gnl|CDD|237478 PRK13709, PRK13709, conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>gnl|CDD|178945 PRK00247, PRK00247, putative inner membrane protein translocase component YidC; Validated Back     alignment and domain information
>gnl|CDD|223407 COG0330, HflC, Membrane protease subunits, stomatin/prohibitin homologs [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|216108 pfam00769, ERM, Ezrin/radixin/moesin family Back     alignment and domain information
>gnl|CDD|178635 PLN03086, PLN03086, PRLI-interacting factor K; Provisional Back     alignment and domain information
>gnl|CDD|219655 pfam07946, DUF1682, Protein of unknown function (DUF1682) Back     alignment and domain information
>gnl|CDD|215974 pfam00529, HlyD, HlyD family secretion protein Back     alignment and domain information
>gnl|CDD|202427 pfam02841, GBP_C, Guanylate-binding protein, C-terminal domain Back     alignment and domain information
>gnl|CDD|222709 pfam14362, DUF4407, Domain of unknown function (DUF4407) Back     alignment and domain information
>gnl|CDD|172947 PRK14472, PRK14472, F0F1 ATP synthase subunit B; Provisional Back     alignment and domain information
>gnl|CDD|172948 PRK14473, PRK14473, F0F1 ATP synthase subunit B; Provisional Back     alignment and domain information
>gnl|CDD|219882 pfam08524, rRNA_processing, rRNA processing Back     alignment and domain information
>gnl|CDD|218517 pfam05236, TAF4, Transcription initiation factor TFIID component TAF4 family Back     alignment and domain information
>gnl|CDD|214880 smart00880, CHAD, The CHAD domain is an alpha-helical domain functionally associated with some members of the adenylate cyclase family Back     alignment and domain information
>gnl|CDD|189762 pfam00901, Orbi_VP5, Orbivirus outer capsid protein VP5 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 965
KOG0431453 consensus Auxilin-like protein and related protein 100.0
PRK09510387 tolA cell envelope integrity inner membrane protei 99.44
PTZ001212084 MAEBL; Provisional 99.35
COG3064387 TolA Membrane protein involved in colicin uptake [ 99.29
PRK09510387 tolA cell envelope integrity inner membrane protei 98.82
TIGR02794346 tolA_full TolA protein. TolA couples the inner mem 98.6
COG3064387 TolA Membrane protein involved in colicin uptake [ 98.42
TIGR02794346 tolA_full TolA protein. TolA couples the inner mem 98.32
PTZ002661021 NIMA-related protein kinase; Provisional 98.14
KOG1029 1118 consensus Endocytic adaptor protein intersectin [S 98.05
KOG1029 1118 consensus Endocytic adaptor protein intersectin [S 97.84
smart0027160 DnaJ DnaJ molecular chaperone homology domain. 97.61
cd0625755 DnaJ DnaJ domain or J-domain. DnaJ/Hsp40 (heat sho 97.55
KOG2072988 consensus Translation initiation factor 3, subunit 97.54
PF0022664 DnaJ: DnaJ domain; InterPro: IPR001623 The prokary 97.37
PRK09430267 djlA Dna-J like membrane chaperone protein; Provis 97.15
KOG4364811 consensus Chromatin assembly factor-I [Chromatin s 96.83
KOG4364811 consensus Chromatin assembly factor-I [Chromatin s 96.77
PRK03578176 hscB co-chaperone HscB; Provisional 96.62
TIGR00714157 hscB Fe-S protein assembly co-chaperone HscB. This 96.62
PRK05014171 hscB co-chaperone HscB; Provisional 96.59
KOG1150250 consensus Predicted molecular chaperone (DnaJ supe 96.57
KOG2072988 consensus Translation initiation factor 3, subunit 96.43
PRK01356166 hscB co-chaperone HscB; Provisional 96.39
KOG0718 546 consensus Molecular chaperone (DnaJ superfamily) [ 96.38
PRK00294173 hscB co-chaperone HscB; Provisional 96.31
PHA03102153 Small T antigen; Reviewed 96.05
KOG0713 336 consensus Molecular chaperone (DnaJ superfamily) [ 95.79
KOG01631259 consensus Myosin class VI heavy chain [Cytoskeleto 95.74
PRK10266 306 curved DNA-binding protein CbpA; Provisional 95.7
KOG4661940 consensus Hsp27-ERE-TATA-binding protein/Scaffold 95.7
PRK14299 291 chaperone protein DnaJ; Provisional 95.61
KOG01631259 consensus Myosin class VI heavy chain [Cytoskeleto 95.5
KOG2891445 consensus Surface glycoprotein [General function p 95.48
COG0484 371 DnaJ DnaJ-class molecular chaperone with C-termina 95.37
PRK14281 397 chaperone protein DnaJ; Provisional 95.3
PRK10767 371 chaperone protein DnaJ; Provisional 95.23
PRK14295 389 chaperone protein DnaJ; Provisional 95.2
PRK14280 376 chaperone protein DnaJ; Provisional 95.04
PRK14284 391 chaperone protein DnaJ; Provisional 94.92
PTZ00100116 DnaJ chaperone protein; Provisional 94.88
PRK14276 380 chaperone protein DnaJ; Provisional 94.88
PRK14277 386 chaperone protein DnaJ; Provisional 94.87
PRK14278 378 chaperone protein DnaJ; Provisional 94.86
PRK14293 374 chaperone protein DnaJ; Provisional 94.85
KOG0716 279 consensus Molecular chaperone (DnaJ superfamily) [ 94.76
KOG1144 1064 consensus Translation initiation factor 5B (eIF-5B 94.76
PRK14285 365 chaperone protein DnaJ; Provisional 94.73
PRK14300 372 chaperone protein DnaJ; Provisional 94.72
PRK14283 378 chaperone protein DnaJ; Provisional 94.71
PRK14297 380 chaperone protein DnaJ; Provisional 94.69
KOG0691 296 consensus Molecular chaperone (DnaJ superfamily) [ 94.52
TIGR02349 354 DnaJ_bact chaperone protein DnaJ. This model repre 94.51
PRK14288 369 chaperone protein DnaJ; Provisional 94.47
PRK14290 365 chaperone protein DnaJ; Provisional 94.47
PRK14296 372 chaperone protein DnaJ; Provisional 94.43
PTZ00037 421 DnaJ_C chaperone protein; Provisional 94.39
PRK14279 392 chaperone protein DnaJ; Provisional 94.28
PRK14301 373 chaperone protein DnaJ; Provisional 94.21
PRK14282 369 chaperone protein DnaJ; Provisional 94.21
PRK14291 382 chaperone protein DnaJ; Provisional 94.16
PRK14292 371 chaperone protein DnaJ; Provisional 94.14
PRK14286 372 chaperone protein DnaJ; Provisional 94.05
PRK14294 366 chaperone protein DnaJ; Provisional 94.01
PTZ00341 1136 Ring-infected erythrocyte surface antigen; Provisi 93.96
KOG0720 490 consensus Molecular chaperone (DnaJ superfamily) [ 93.9
PRK14298 377 chaperone protein DnaJ; Provisional 93.85
PRK14287 371 chaperone protein DnaJ; Provisional 93.56
PRK01773173 hscB co-chaperone HscB; Provisional 93.35
PF12037276 DUF3523: Domain of unknown function (DUF3523); Int 93.25
KOG4661940 consensus Hsp27-ERE-TATA-binding protein/Scaffold 93.18
KOG0719 264 consensus Molecular chaperone (DnaJ superfamily) [ 93.1
KOG0742630 consensus AAA+-type ATPase [Posttranslational modi 92.98
KOG0712 337 consensus Molecular chaperone (DnaJ superfamily) [ 92.89
COG2214 237 CbpA DnaJ-class molecular chaperone [Posttranslati 92.85
PRK14289 386 chaperone protein DnaJ; Provisional 92.73
PRK07735430 NADH dehydrogenase subunit C; Validated 92.71
KOG0721230 consensus Molecular chaperone (DnaJ superfamily) [ 92.7
KOG2891445 consensus Surface glycoprotein [General function p 92.5
KOG0717 508 consensus Molecular chaperone (DnaJ superfamily) [ 92.43
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 92.41
PHA02624 647 large T antigen; Provisional 92.22
KOG2412591 consensus Nuclear-export-signal (NES)-containing p 89.82
TIGR03835 871 termin_org_DnaJ terminal organelle assembly protei 89.36
KOG2412591 consensus Nuclear-export-signal (NES)-containing p 89.22
PF02029492 Caldesmon: Caldesmon; InterPro: IPR006018 This gro 89.18
COG5407 610 SEC63 Preprotein translocase subunit Sec63 [Intrac 89.11
KOG3054299 consensus Uncharacterized conserved protein [Funct 87.13
TIGR03319514 YmdA_YtgF conserved hypothetical protein YmdA/YtgF 85.23
KOG3054299 consensus Uncharacterized conserved protein [Funct 84.62
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 82.33
PRK00106535 hypothetical protein; Provisional 82.06
KOG0715 288 consensus Molecular chaperone (DnaJ superfamily) [ 81.4
PRK12704520 phosphodiesterase; Provisional 80.94
KOG0742630 consensus AAA+-type ATPase [Posttranslational modi 80.92
>KOG0431 consensus Auxilin-like protein and related proteins containing DnaJ domain [General function prediction only] Back     alignment and domain information
Probab=100.00  E-value=6.1e-40  Score=375.05  Aligned_cols=224  Identities=43%  Similarity=0.595  Sum_probs=175.9

Q ss_pred             hhccccccccccCCCCCCCCCCCCCCCCCCccCCCCCCCCCCCc-------cCCCCCCC-cccccCCCcccccchhhhhc
Q 002109          686 QKNDNDLESFFSMSSRPSSAPRPRANTSDSLFDSQSKGGPEPAR-------RTSVGASS-NMRKASSTTNIVDDLSSIFG  757 (965)
Q Consensus       686 ~~~~~dlesfFs~~Sr~sSaPrsr~~s~ds~fdsq~q~~~~~~~-------r~sss~S~-s~rkasSs~ni~DDlss~Fg  757 (965)
                      ....+.|++++....+.++++..+.+.++.|.+...-+..+...       ...++... +...+...++.......+|+
T Consensus       195 ~~~~~~~~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~~~~~~~~s~~~~~~~~~~~~~~~~~~~~  274 (453)
T KOG0431|consen  195 QATAPKADSFFNSTSRGASAPADPFADLDDLSSGSNASKSGSSSDLSSRVSPGITETTDSPPSKTSSPPNQQKKSPPDFQ  274 (453)
T ss_pred             cCCCccccccccccccCCCCCCCccccccchhhhcccCCCCCcccccCCCCCCCCCCCCCchhhhcccccchhccchhhh
Confidence            45666788899888888888887777766654443333222111       11111111 13344444455555444444


Q ss_pred             cCCC-------------CCC------ccccccCChHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHH----HH
Q 002109          758 AAGS-------------SAG------EFQDVEGETEERRRARLERHQRTQERAAKALAEKNERDLQAQRDQAER----HR  814 (965)
Q Consensus       758 ~~~~-------------s~~------~f~~~~~e~~~rr~a~~~r~~~~~~r~~k~l~ek~~r~~~~~~eq~e~----~~  814 (965)
                      ..+-             -..      .+..+-|+..+++..+..++..+..+....+.++..+|++..++++++    .+
T Consensus       275 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~k~~~~~ae~~~e~~r  354 (453)
T KOG0431|consen  275 AKPSSESPEASTQKRPNYAQKRSDVPPGNTERGKRAESSSTRTKKQMDTFSDLLNPQGFKSTSDEKRPREIAEMRKELSR  354 (453)
T ss_pred             cccCccchhhccccccchhccCCCCCcccccccccccccccccchhhhhhhhhhccccccchhhhhhHHHHHHHHHHHHh
Confidence            4310             011      122345778888999999999999999999999999999999999999    89


Q ss_pred             hHHhHHHHHHHHhccccccHHHHhhccccccCCCCCCccCcccccchhhhHhHHhhhccccccCccccccCCCHHHHHHH
Q 002109          815 IAETLDVEIKRWAAGKEGNIRALLATMQYVLWPESGWQPVSLTDLITAAAVKKCYRKATLCIHPDKVQQKGANLQQKYIA  894 (965)
Q Consensus       815 l~d~~~~ki~~W~~gke~nIRaLLssL~~VLW~~~~W~~v~~~dl~~~~~VKk~YrKA~l~vHPDK~~~~~~~~eqk~iA  894 (965)
                      |+|+|+.+|+.|..||++|||+||+|||||||++|||++|+|.|||+|++|||+|||||||||||||+|+|++++|||||
T Consensus       355 ~~e~~d~~I~~W~~GKE~NIRALLSTLh~VLW~es~WqpVsltDLVtp~~VKKaYrKA~L~VHPDKlqq~gas~~qK~Ia  434 (453)
T KOG0431|consen  355 LMEPLDEEIRRWSEGKEGNIRALLSTLHYVLWPESGWQPVSLTDLVTPAQVKKAYRKAVLCVHPDKLQQKGASLEQKYIA  434 (453)
T ss_pred             hcchHHHHHHHhcccccccHHHHHHHHhHhhcCccCcccCchhhccCHHHHHHHHHhhhheeCcccccCCcccHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHhh
Q 002109          895 EKVFDLLKVQQIYCR  909 (965)
Q Consensus       895 ~~vF~~Ln~a~~~~r  909 (965)
                      +.||++|++||+.|.
T Consensus       435 ekvfd~l~eawn~f~  449 (453)
T KOG0431|consen  435 EKVFDALSEAWNKFN  449 (453)
T ss_pred             HHHHHHHHHHHHhhh
Confidence            999999999999986



>PRK09510 tolA cell envelope integrity inner membrane protein TolA; Provisional Back     alignment and domain information
>PTZ00121 MAEBL; Provisional Back     alignment and domain information
>COG3064 TolA Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK09510 tolA cell envelope integrity inner membrane protein TolA; Provisional Back     alignment and domain information
>TIGR02794 tolA_full TolA protein Back     alignment and domain information
>COG3064 TolA Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR02794 tolA_full TolA protein Back     alignment and domain information
>PTZ00266 NIMA-related protein kinase; Provisional Back     alignment and domain information
>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>smart00271 DnaJ DnaJ molecular chaperone homology domain Back     alignment and domain information
>cd06257 DnaJ DnaJ domain or J-domain Back     alignment and domain information
>KOG2072 consensus Translation initiation factor 3, subunit a (eIF-3a) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF00226 DnaJ: DnaJ domain; InterPro: IPR001623 The prokaryotic heat shock protein DnaJ interacts with the chaperone hsp70-like DnaK protein [] Back     alignment and domain information
>PRK09430 djlA Dna-J like membrane chaperone protein; Provisional Back     alignment and domain information
>KOG4364 consensus Chromatin assembly factor-I [Chromatin structure and dynamics] Back     alignment and domain information
>KOG4364 consensus Chromatin assembly factor-I [Chromatin structure and dynamics] Back     alignment and domain information
>PRK03578 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>TIGR00714 hscB Fe-S protein assembly co-chaperone HscB Back     alignment and domain information
>PRK05014 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>KOG1150 consensus Predicted molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2072 consensus Translation initiation factor 3, subunit a (eIF-3a) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK01356 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>KOG0718 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK00294 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PHA03102 Small T antigen; Reviewed Back     alignment and domain information
>KOG0713 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0163 consensus Myosin class VI heavy chain [Cytoskeleton] Back     alignment and domain information
>PRK10266 curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>KOG4661 consensus Hsp27-ERE-TATA-binding protein/Scaffold attachment factor (SAF-B) [Transcription] Back     alignment and domain information
>PRK14299 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0163 consensus Myosin class VI heavy chain [Cytoskeleton] Back     alignment and domain information
>KOG2891 consensus Surface glycoprotein [General function prediction only] Back     alignment and domain information
>COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14281 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK10767 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14295 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14280 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14284 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PTZ00100 DnaJ chaperone protein; Provisional Back     alignment and domain information
>PRK14276 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14277 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14278 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14293 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0716 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1144 consensus Translation initiation factor 5B (eIF-5B) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK14285 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14300 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14283 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14297 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0691 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02349 DnaJ_bact chaperone protein DnaJ Back     alignment and domain information
>PRK14288 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14290 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14296 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PTZ00037 DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>PRK14279 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14301 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14282 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14291 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14292 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14286 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14294 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PTZ00341 Ring-infected erythrocyte surface antigen; Provisional Back     alignment and domain information
>KOG0720 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14298 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14287 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK01773 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PF12037 DUF3523: Domain of unknown function (DUF3523); InterPro: IPR021911 This presumed domain is functionally uncharacterised Back     alignment and domain information
>KOG4661 consensus Hsp27-ERE-TATA-binding protein/Scaffold attachment factor (SAF-B) [Transcription] Back     alignment and domain information
>KOG0719 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0712 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2214 CbpA DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14289 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK07735 NADH dehydrogenase subunit C; Validated Back     alignment and domain information
>KOG0721 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2891 consensus Surface glycoprotein [General function prediction only] Back     alignment and domain information
>KOG0717 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02624 large T antigen; Provisional Back     alignment and domain information
>KOG2412 consensus Nuclear-export-signal (NES)-containing protein/polyadenylated-RNA export factor [RNA processing and modification] Back     alignment and domain information
>TIGR03835 termin_org_DnaJ terminal organelle assembly protein TopJ Back     alignment and domain information
>KOG2412 consensus Nuclear-export-signal (NES)-containing protein/polyadenylated-RNA export factor [RNA processing and modification] Back     alignment and domain information
>PF02029 Caldesmon: Caldesmon; InterPro: IPR006018 This group of proteins includes two protein families: caldesmon and lymphocyte specific protein Back     alignment and domain information
>COG5407 SEC63 Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG3054 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF Back     alignment and domain information
>KOG3054 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PRK00106 hypothetical protein; Provisional Back     alignment and domain information
>KOG0715 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK12704 phosphodiesterase; Provisional Back     alignment and domain information
>KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query965
3ag7_A106 An Auxilin-Like J-Domain Containing Protein, Jac1 J 3e-26
1n4c_A182 Nmr Structure Of The J-Domain And Clathrin Substrat 3e-15
1xi5_J114 Clathrin D6 Coat With Auxilin J-Domain Length = 114 7e-14
2qwn_B94 Crystal Structure Of Disulfide-Bond-Crosslinked Com 6e-13
2qwo_B92 Crystal Structure Of Disulfide-Bond-Crosslinked Com 8e-13
1nz6_A101 Crystal Structure Of Auxilin J-Domain Length = 101 3e-12
>pdb|3AG7|A Chain A, An Auxilin-Like J-Domain Containing Protein, Jac1 J-Domain Length = 106 Back     alignment and structure

Iteration: 1

Score = 117 bits (293), Expect = 3e-26, Method: Composition-based stats. Identities = 49/86 (56%), Positives = 71/86 (82%) Query: 817 ETLDVEIKRWAAGKEGNIRALLATMQYVLWPESGWQPVSLTDLITAAAVKKCYRKATLCI 876 + +D +I++W++GK GNIR+LL+T+QY+LW SGW+PV L D+I AV+K Y++A L + Sbjct: 9 KNIDAKIRKWSSGKSGNIRSLLSTLQYILWSGSGWKPVPLMDMIEGNAVRKSYQRALLIL 68 Query: 877 HPDKVQQKGANLQQKYIAEKVFDLLK 902 HPDK+QQKGA+ QKY+AEKVF+LL+ Sbjct: 69 HPDKLQQKGASANQKYMAEKVFELLQ 94
>pdb|1N4C|A Chain A, Nmr Structure Of The J-Domain And Clathrin Substrate Binding Domain Of Bovine Auxilin Length = 182 Back     alignment and structure
>pdb|1XI5|J Chain J, Clathrin D6 Coat With Auxilin J-Domain Length = 114 Back     alignment and structure
>pdb|2QWN|B Chain B, Crystal Structure Of Disulfide-Bond-Crosslinked Complex Of Bovine Hsc70 (1-386aa)r171c And Bovine Auxilin (810-910aa)d876c In The AdpPi State Length = 94 Back     alignment and structure
>pdb|2QWO|B Chain B, Crystal Structure Of Disulfide-Bond-Crosslinked Complex Of Bovine Hsc70 (1-394aa)r171c And Bovine Auxilin (810-910aa)d876c In The AdpPi Form #1 Length = 92 Back     alignment and structure
>pdb|1NZ6|A Chain A, Crystal Structure Of Auxilin J-Domain Length = 101 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query965
3ag7_A106 Putative uncharacterized protein F9E10.5; J-domain 1e-34
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 3e-31
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; cha 5e-29
2zuo_A861 MVP, major vault protein; repeat domains, protein- 2e-21
2zuo_A861 MVP, major vault protein; repeat domains, protein- 5e-19
2zuo_A861 MVP, major vault protein; repeat domains, protein- 4e-17
2zuo_A861 MVP, major vault protein; repeat domains, protein- 2e-13
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 8e-16
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 3e-15
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 3e-12
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 1e-11
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 5e-10
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 6e-08
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 6e-06
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 1e-04
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 1e-12
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 3e-10
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 1e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-11
2ycu_A995 Non muscle myosin 2C, alpha-actinin; motor protein 3e-10
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 1e-08
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 1e-08
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 5e-08
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 2e-07
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 4e-05
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 2e-04
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 2e-04
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 5e-04
1cii_A602 Colicin IA; bacteriocin, ION channel formation, tr 5e-07
1g8x_A1010 Myosin II heavy chain fused to alpha-actinin 3; mo 1e-06
2es4_D332 Lipase chaperone; protein-protein complex, steric 1e-05
1f5n_A592 Interferon-induced guanylate-binding protein 1; GB 2e-05
1f5n_A592 Interferon-induced guanylate-binding protein 1; GB 2e-04
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 3e-05
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 6e-05
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 1e-04
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 2e-04
2dg7_A195 Putative transcriptional regulator; helix-turn-hel 3e-05
1jad_A251 PLC-beta, phospholipase C beta; alpha helical coil 4e-05
3iyk_A526 VP5; icosahedral virus; HET: MNA; 7.00A {Bluetongu 4e-05
3iyk_A526 VP5; icosahedral virus; HET: MNA; 7.00A {Bluetongu 5e-05
3iyk_A526 VP5; icosahedral virus; HET: MNA; 7.00A {Bluetongu 1e-04
3na7_A256 HP0958; flagellar biogenesis, flagellum export, C4 1e-04
1w1w_A430 Structural maintenance of chromosome 1; cohesin, c 1e-04
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 1e-04
4f61_I240 Stathmin-like domain R4; alpha-tubulin, beta-tubul 1e-04
4f61_I240 Stathmin-like domain R4; alpha-tubulin, beta-tubul 5e-04
2rae_A207 Transcriptional regulator, ACRR family protein; TE 2e-04
3dmq_A968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 3e-04
2qag_C418 Septin-7; cell cycle, cell division, GTP-binding, 4e-04
2dg6_A222 Putative transcriptional regulator; winged-helix m 7e-04
2dm9_A198 V-type ATP synthase subunit E; A-ATPase, structura 8e-04
>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Length = 106 Back     alignment and structure
 Score =  127 bits (319), Expect = 1e-34
 Identities = 49/91 (53%), Positives = 71/91 (78%)

Query: 812 RHRIAETLDVEIKRWAAGKEGNIRALLATMQYVLWPESGWQPVSLTDLITAAAVKKCYRK 871
                + +D +I++W++GK GNIR+LL+T+QY+LW  SGW+PV L D+I   AV+K Y++
Sbjct: 4   GSEEIKNIDAKIRKWSSGKSGNIRSLLSTLQYILWSGSGWKPVPLMDMIEGNAVRKSYQR 63

Query: 872 ATLCIHPDKVQQKGANLQQKYIAEKVFDLLK 902
           A L +HPDK+QQKGA+  QKY+AEKVF+LL+
Sbjct: 64  ALLILHPDKLQQKGASANQKYMAEKVFELLQ 94


>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Length = 182 Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Length = 92 Back     alignment and structure
>2zuo_A MVP, major vault protein; repeat domains, protein-protein complex, cytoplasm, ribonucleoprotein, structural protein; 3.50A {Rattus norvegicus} PDB: 2zv4_N 2zv5_a 2qzv_A Length = 861 Back     alignment and structure
>2zuo_A MVP, major vault protein; repeat domains, protein-protein complex, cytoplasm, ribonucleoprotein, structural protein; 3.50A {Rattus norvegicus} PDB: 2zv4_N 2zv5_a 2qzv_A Length = 861 Back     alignment and structure
>2zuo_A MVP, major vault protein; repeat domains, protein-protein complex, cytoplasm, ribonucleoprotein, structural protein; 3.50A {Rattus norvegicus} PDB: 2zv4_N 2zv5_a 2qzv_A Length = 861 Back     alignment and structure
>2zuo_A MVP, major vault protein; repeat domains, protein-protein complex, cytoplasm, ribonucleoprotein, structural protein; 3.50A {Rattus norvegicus} PDB: 2zv4_N 2zv5_a 2qzv_A Length = 861 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2ycu_A Non muscle myosin 2C, alpha-actinin; motor protein; HET: AOV; 2.25A {Homo sapiens} PDB: 1br1_A* 1br4_A* 1br2_A* Length = 995 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
>1cii_A Colicin IA; bacteriocin, ION channel formation, transmembrane protein; 3.00A {Escherichia coli} SCOP: f.1.1.1 h.4.3.1 Length = 602 Back     alignment and structure
>1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 Back     alignment and structure
>2es4_D Lipase chaperone; protein-protein complex, steric chaperone, triacylglycerol hydrolase, all alpha helix protein, A/B hydrolase fold; 1.85A {Burkholderia glumae} SCOP: a.137.15.1 Length = 332 Back     alignment and structure
>1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Length = 592 Back     alignment and structure
>1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Length = 592 Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 Back     alignment and structure
>2dg7_A Putative transcriptional regulator; helix-turn-helix motif, TETR family, gene regulation; 2.30A {Streptomyces coelicolor} Length = 195 Back     alignment and structure
>1jad_A PLC-beta, phospholipase C beta; alpha helical coiled coil, hydrolase; 2.40A {Meleagris gallopavo} SCOP: h.4.10.1 Length = 251 Back     alignment and structure
>3iyk_A VP5; icosahedral virus; HET: MNA; 7.00A {Bluetongue virus} Length = 526 Back     alignment and structure
>3iyk_A VP5; icosahedral virus; HET: MNA; 7.00A {Bluetongue virus} Length = 526 Back     alignment and structure
>3iyk_A VP5; icosahedral virus; HET: MNA; 7.00A {Bluetongue virus} Length = 526 Back     alignment and structure
>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Length = 256 Back     alignment and structure
>1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 Length = 430 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Length = 681 Back     alignment and structure
>4f61_I Stathmin-like domain R4; alpha-tubulin, beta-tubulin, GTPase, microtubule, RB3, stath tubulin, cell cycle; HET: GTP GDP; 4.17A {Artificial gene} Length = 240 Back     alignment and structure
>4f61_I Stathmin-like domain R4; alpha-tubulin, beta-tubulin, GTPase, microtubule, RB3, stath tubulin, cell cycle; HET: GTP GDP; 4.17A {Artificial gene} Length = 240 Back     alignment and structure
>2rae_A Transcriptional regulator, ACRR family protein; TETR/ACRR family transcriptional regulator, structural genom 2, RHA08332, MCSG; 2.20A {Rhodococcus SP} Length = 207 Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Length = 968 Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Length = 418 Back     alignment and structure
>2dg6_A Putative transcriptional regulator; winged-helix motif, MERR family, gene regulation; 2.20A {Streptomyces coelicolor} Length = 222 Back     alignment and structure
>2dm9_A V-type ATP synthase subunit E; A-ATPase, structural genomics, NPPSFA, national project on P structural and functional analyses; 1.85A {Pyrococcus horikoshii} SCOP: d.81.4.1 PDB: 2dma_A 4dt0_A Length = 198 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query965
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; cha 99.83
3ag7_A106 Putative uncharacterized protein F9E10.5; J-domain 99.77
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 99.73
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 97.76
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 97.49
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structur 97.44
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 97.35
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 97.25
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 97.24
3hho_A174 CO-chaperone protein HSCB homolog; structural geno 97.23
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 97.2
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 97.18
1fpo_A171 HSC20, chaperone protein HSCB; molecular chaperone 97.18
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 97.13
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 97.12
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 97.07
3bvo_A207 CO-chaperone protein HSCB, mitochondrial precurso; 97.01
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 96.98
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 96.97
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 96.97
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 96.89
2guz_A71 Mitochondrial import inner membrane translocase su 96.86
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 96.82
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 96.82
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 96.66
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 96.27
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 96.25
1faf_A79 Large T antigen; J domain, HPD motif, anti-paralle 96.19
3uo3_A181 J-type CO-chaperone JAC1, mitochondrial; structura 95.53
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 94.83
3lz8_A 329 Putative chaperone DNAJ; structure genomics, struc 94.25
2guz_B65 Mitochondrial import inner membrane translocase su 93.65
2i1j_A575 Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, 93.34
2i1j_A575 Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, 92.88
2pf4_E174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 92.01
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 86.05
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 85.83
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Back     alignment and structure
Probab=99.83  E-value=2.7e-21  Score=177.20  Aligned_cols=89  Identities=40%  Similarity=0.649  Sum_probs=82.5

Q ss_pred             HhHHHHHHHHhccccccHHHHhhccccccCCC-CCCccCcccccchhhhHhHHhhhccccccCccccccCCCHHHHHHHH
Q 002109          817 ETLDVEIKRWAAGKEGNIRALLATMQYVLWPE-SGWQPVSLTDLITAAAVKKCYRKATLCIHPDKVQQKGANLQQKYIAE  895 (965)
Q Consensus       817 d~~~~ki~~W~~gke~nIRaLLssL~~VLW~~-~~W~~v~~~dl~~~~~VKk~YrKA~l~vHPDK~~~~~~~~eqk~iA~  895 (965)
                      |.|+.+|+.|+.||++|||+||+|||.|||++ +.|+.+++..+.++..||++|||+++.+||||++.  .  +++++|+
T Consensus         1 ~~i~~~i~~W~~gk~~~ir~lL~~l~~~L~~~~~~y~~Lgv~~~as~~eIKkAYRklal~~HPDK~~~--~--~~~~~A~   76 (92)
T 2qwo_B            1 DPEKLKILEWIEGKERNIRALLSTMHTVLWAGETKWKPVGMADLVTPEQVKKVYRKAVLVVHPCKATG--Q--PYEQYAK   76 (92)
T ss_dssp             CHHHHHHHHHHHHHTTCHHHHHHHGGGTSCTTCCSCCCCCGGGSSSHHHHHHHHHHHHHHTCHHHHTT--S--TTHHHHH
T ss_pred             ChHHHHHHHHHccChhHHHHHHHHHHHHhcccccCCeecCCCCCCCHHHHHHHHHHHHHHHCcCCCCC--c--hhHhHHH
Confidence            57999999999999999999999999999995 99999999999999999999999999999999974  2  2346999


Q ss_pred             HHHHHHHHHHHHhh
Q 002109          896 KVFDLLKVQQIYCR  909 (965)
Q Consensus       896 ~vF~~Ln~a~~~~r  909 (965)
                      .+|..|++||++++
T Consensus        77 ~~F~~i~eAyevL~   90 (92)
T 2qwo_B           77 MIFMELNDAWSEFE   90 (92)
T ss_dssp             HHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHH
Confidence            99999999999875



>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Back     alignment and structure
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Back     alignment and structure
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Back     alignment and structure
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Back     alignment and structure
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Back     alignment and structure
>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Back     alignment and structure
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Back     alignment and structure
>2guz_B Mitochondrial import inner membrane translocase subunit TIM16; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2i1j_A Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, ezrin, MER actin binding, masking, regulation, SELF-inhibition, cell A membrane protein; 2.10A {Spodoptera frugiperda} PDB: 2i1k_A 1e5w_A Back     alignment and structure
>2i1j_A Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, ezrin, MER actin binding, masking, regulation, SELF-inhibition, cell A membrane protein; 2.10A {Spodoptera frugiperda} PDB: 2i1k_A 1e5w_A Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 965
d1nz6a_98 a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [T 4e-19
d2es4d1280 a.137.15.1 (D:53-332) Lipase chaperone LifO (LipB) 3e-10
d1f5na1300 a.114.1.1 (A:284-583) Interferon-induced guanylate 6e-07
d1f5na1300 a.114.1.1 (A:284-583) Interferon-induced guanylate 3e-06
d1f5na1300 a.114.1.1 (A:284-583) Interferon-induced guanylate 5e-05
d1f5na1300 a.114.1.1 (A:284-583) Interferon-induced guanylate 5e-05
d1f5na1300 a.114.1.1 (A:284-583) Interferon-induced guanylate 2e-04
d1sa0e_138 a.137.10.1 (E:) Stathmin 4 {Rat (Rattus norvegicus 5e-04
d1sa0e_138 a.137.10.1 (E:) Stathmin 4 {Rat (Rattus norvegicus 6e-04
d1sa0e_138 a.137.10.1 (E:) Stathmin 4 {Rat (Rattus norvegicus 0.001
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Length = 98 Back     information, alignment and structure

class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: Auxilin J-domain
species: Cow (Bos taurus) [TaxId: 9913]
 Score = 81.1 bits (200), Expect = 4e-19
 Identities = 35/63 (55%), Positives = 43/63 (68%), Gaps = 1/63 (1%)

Query: 819 LDVEIKRWAAGKEGNIRALLATMQYVLWP-ESGWQPVSLTDLITAAAVKKCYRKATLCIH 877
             ++I  W  GKE NIRALL+TM  VLW  E+ W+PV + DL+T   VKK YRKA L +H
Sbjct: 3   EKLKILEWIEGKERNIRALLSTMHTVLWAGETKWKPVGMADLVTPEQVKKVYRKAVLVVH 62

Query: 878 PDK 880
           PDK
Sbjct: 63  PDK 65


>d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 300 Back     information, alignment and structure
>d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 300 Back     information, alignment and structure
>d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 300 Back     information, alignment and structure
>d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 300 Back     information, alignment and structure
>d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 300 Back     information, alignment and structure
>d1sa0e_ a.137.10.1 (E:) Stathmin 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 138 Back     information, alignment and structure
>d1sa0e_ a.137.10.1 (E:) Stathmin 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 138 Back     information, alignment and structure
>d1sa0e_ a.137.10.1 (E:) Stathmin 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 138 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query965
d1nz6a_98 Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} 99.8
d1wjza_94 CSL-type zinc finger-containing protein 3 (J-domai 97.83
d1fpoa176 HSC20 (HSCB), N-terminal (J) domain {Escherichia c 97.81
d1iura_88 Hypothetical protein KIAA0730 {Human (Homo sapiens 97.34
d1xbla_75 DnaJ chaperone, N-terminal (J) domain {Escherichia 97.29
d1fafa_79 Large T antigen, the N-terminal J domain {Murine p 97.01
d1hdja_77 HSP40 {Human (Homo sapiens) [TaxId: 9606]} 96.19
d1gh6a_114 Large T antigen, the N-terminal J domain {Simian v 96.16
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: Auxilin J-domain
species: Cow (Bos taurus) [TaxId: 9913]
Probab=99.80  E-value=2.2e-20  Score=170.77  Aligned_cols=90  Identities=41%  Similarity=0.665  Sum_probs=82.1

Q ss_pred             HhHHHHHHHHhccccccHHHHhhccccccCCC-CCCccCcccccchhhhHhHHhhhccccccCccccccCCCHHHHHHHH
Q 002109          817 ETLDVEIKRWAAGKEGNIRALLATMQYVLWPE-SGWQPVSLTDLITAAAVKKCYRKATLCIHPDKVQQKGANLQQKYIAE  895 (965)
Q Consensus       817 d~~~~ki~~W~~gke~nIRaLLssL~~VLW~~-~~W~~v~~~dl~~~~~VKk~YrKA~l~vHPDK~~~~~~~~eqk~iA~  895 (965)
                      |.|+.+|..|+.|+++|||+||++|+.|||++ ..|++++|.+++++.+||++|+++++.+||||+...    ....+|+
T Consensus         1 d~~~~~i~~W~~~~~~~ir~lL~~l~~vl~~~~~~y~~Lgl~~~~t~~eIk~aYr~l~~~~HPDk~~~~----~~~~~a~   76 (98)
T d1nz6a_           1 DPEKLKILEWIEGKERNIRALLSTMHTVLWAGETKWKPVGMADLVTPEQVKKVYRKAVLVVHPDKATGQ----PYEQYAK   76 (98)
T ss_dssp             CHHHHHHHHHHTTTTTCHHHHHTTGGGTSCTTCCSCCCCCGGGCCSHHHHHHHHHHHHHHSCHHHHTTS----TTHHHHH
T ss_pred             ChHHHHHHHHHhcchhhHHHHHHhhhhhcCCcccCCeecCCCccCCHHHHHHHHHHHHHHhccccCCCh----HHHHHHH
Confidence            57888999999999999999999999999985 789999999999999999999999999999998743    2356799


Q ss_pred             HHHHHHHHHHHHhhh
Q 002109          896 KVFDLLKVQQIYCRF  910 (965)
Q Consensus       896 ~vF~~Ln~a~~~~r~  910 (965)
                      .+|..||+||+.|+=
T Consensus        77 ~~f~~I~~Ay~~L~d   91 (98)
T d1nz6a_          77 MIFMELNDAWSEFEN   91 (98)
T ss_dssp             HHHHHHHHHHHHHHT
T ss_pred             HHHHHHHHHHHHHCC
Confidence            999999999998863



>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Back     information, alignment and structure
>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Back     information, alignment and structure