Citrus Sinensis ID: 002109
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 965 | ||||||
| 225438408 | 949 | PREDICTED: auxilin-related protein 2-lik | 0.860 | 0.874 | 0.607 | 0.0 | |
| 255567186 | 983 | auxilin, putative [Ricinus communis] gi| | 0.864 | 0.848 | 0.584 | 0.0 | |
| 356512862 | 985 | PREDICTED: auxilin-related protein 2-lik | 0.830 | 0.813 | 0.551 | 0.0 | |
| 356527526 | 935 | PREDICTED: auxilin-related protein 2-lik | 0.829 | 0.855 | 0.549 | 1e-176 | |
| 356516393 | 922 | PREDICTED: auxilin-related protein 2-lik | 0.841 | 0.880 | 0.520 | 1e-161 | |
| 147777401 | 977 | hypothetical protein VITISV_018382 [Viti | 0.814 | 0.804 | 0.539 | 1e-160 | |
| 297790814 | 890 | hypothetical protein ARALYDRAFT_497125 [ | 0.777 | 0.842 | 0.479 | 1e-156 | |
| 145340151 | 891 | auxilin-related protein 2 [Arabidopsis t | 0.781 | 0.846 | 0.464 | 1e-147 | |
| 334186464 | 889 | auxilin-related protein 2 [Arabidopsis t | 0.779 | 0.845 | 0.464 | 1e-145 | |
| 297790666 | 920 | hypothetical protein ARALYDRAFT_333056 [ | 0.776 | 0.814 | 0.435 | 1e-139 |
| >gi|225438408|ref|XP_002275766.1| PREDICTED: auxilin-related protein 2-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 753 bits (1943), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 563/926 (60%), Positives = 662/926 (71%), Gaps = 96/926 (10%)
Query: 2 PVYDKPVYDDDVDIFKGLPGLRTSSTPAAAASSSGANFDDVFASFSRSSAKHESARESSP 61
PVYDKPVYDDD IF G+PGL+TS + N+D F++ S S K A
Sbjct: 83 PVYDKPVYDDD--IFDGVPGLKTSGS---------VNYD-AFSTVSGSKQKQNDA----- 125
Query: 62 LDDLLGNLGKKETE-SRVKSEKDV-SAFDDLLPGFGRSRSPSSNRSTSESSQSQKPPSNS 119
DDLLG G+K+ E R + +DV S FDDLL GFGR SP SNR T++ + + K N+
Sbjct: 126 FDDLLGGFGRKDPEPKRSGNVEDVGSGFDDLLHGFGRI-SPPSNRPTTDINWAPKSTVNA 184
Query: 120 TKTASSVMEDPFGVSESTSTHVGSSSEVFTDRLEEIGKFGGSGSAKVNGSS-VSGGVFDD 178
T+T S+V+EDPF V ESTST SSS +F+D LEEI K SGS +V+GSS V GG F+D
Sbjct: 185 TETTSNVIEDPFVVLESTSTPAVSSSVLFSDPLEEISKLSNSGSTRVDGSSAVGGGAFND 244
Query: 179 LDSLNILGKSVPPVSPEINKRGNDRSLRS-KSVSGTQTHPRKESIDRSSVENFDGYAQNN 237
LD L+ LGKS P E+NKRG +RS S + S TQT KE I++SSVE D ++Q
Sbjct: 245 LDPLDGLGKSAFPS--EMNKRGKNRSPSSTEPTSETQTFATKEPIEKSSVEGQDSHSQKK 302
Query: 238 TPVDNFQGSNDTLFNMPSVATDSSRSAGRATSPPSYMSATDSLRSAGRATSPPSYMSATD 297
P +N+ S+ TLF++P+V+TDS +
Sbjct: 303 MPAENYWESHQTLFDIPTVSTDSHK----------------------------------- 327
Query: 298 SLRSAGRATSPPSYTSASPSETNSQVNTTPKSEDLFDSAEDVWLTVSEIPLFTQPTSAPP 357
S + SPPS+ +ASP+ETNSQ +P+SE+ S++DVWL VS+IPLFTQPTSAPP
Sbjct: 328 ---SFSQTPSPPSHVNASPNETNSQGEMSPRSEENLSSSDDVWLAVSDIPLFTQPTSAPP 384
Query: 358 PSRPPPPRPTRVSKLETG-----NARKKANEYSSFSNSPQCTHSPKSTRAGTRSSAASQI 412
PSRPPP RPT+VS+ ETG NARKK NE+SSF+NS Q + SPK TR +SSA SQI
Sbjct: 385 PSRPPPTRPTQVSRAETGSFGSNNARKKVNEFSSFTNSSQYSQSPKLTRGTVKSSAVSQI 444
Query: 413 DELEDFAMSRSWNNVNEYGEVPSPEDVES-SIAAASAAAMKEAMDRAEAKFRHAKEMRER 471
DELEDFAM R+ NNV+ + E ++ E+ S+AAASAAAMKEAMDRAEAKFRHAK +RER
Sbjct: 445 DELEDFAMGRTQNNVDGHAEGLYGDEFETNSVAAASAAAMKEAMDRAEAKFRHAKGVRER 504
Query: 472 ESFKAARSRESVQPDREERATQQDAQERLDREMQQREKGEEQRRLEREREREREEKEREK 531
ES KA+RS+E+ Q DR+E+A QDAQER RE Q+R + E Q R E ERE+ ER +
Sbjct: 505 ESAKASRSKEAGQLDRDEKA-MQDAQERAIREKQERLEHERQEREREEEEREQRRLERTR 563
Query: 532 KRIEKEKERAREIEKEREKAR-------------QAVERATREARERAAAEARLKAERAA 578
+ + +E+ RE + ++ QAVERAT+EARERAAAEARLKAERAA
Sbjct: 564 EIEREREEKEREQRRLEKERERAREIEREREKARQAVERATKEARERAAAEARLKAERAA 623
Query: 579 VDKANAAARERAERAAVQRAQAEARERAAAEARERAERAAAEARERANAEAREKEARERA 638
V K NA ARERAERAAV RAQAEARERAAAEA+ERAE+AAAEARERAN EAREKEARERA
Sbjct: 624 VGKVNAEARERAERAAVHRAQAEARERAAAEAKERAEKAAAEARERANTEAREKEARERA 683
Query: 639 SVARTEAEALQRAERAAVQRAASEARERAAAEARERAAAAARANQNQQKNDNDLESFFSM 698
+VAR EAE R +E A A R AAA A NQQKN+NDLESFFSM
Sbjct: 684 AVARAEAEVRLR----------TERAAVERAAAEARERAAAAARVNQQKNENDLESFFSM 733
Query: 699 SSRPSSAPRPRANTSDSLFDSQSKG--GPEPARRTSVGASSNMRKASSTTNIVDDLSSIF 756
SRPSSAPRPRAN+SD +FD+Q + GPE AR T+ ASS MRKASSTTNIVDDLSSIF
Sbjct: 734 GSRPSSAPRPRANSSDPVFDTQFQNRRGPEVAR-TAASASSTMRKASSTTNIVDDLSSIF 792
Query: 757 GAAGSSAGEFQDVEGETEERRRARLERHQRTQERAAKALAEKNERDLQAQRDQAERHRIA 816
GAA SS G+FQDVEGE+E+RRRARLERHQRTQERAAKALAEKN+RDLQAQRDQAERHRIA
Sbjct: 793 GAAPSS-GDFQDVEGESEDRRRARLERHQRTQERAAKALAEKNQRDLQAQRDQAERHRIA 851
Query: 817 ETLDVEIKRWAAGKEGNIRALLATMQYVLWPESGWQPVSLTDLITAAAVKKCYRKATLCI 876
ETLDVEIKRW+AGKEGN+RALL+T+QYVLWPE GWQPVSLTDLITAA+VKK YRKATLCI
Sbjct: 852 ETLDVEIKRWSAGKEGNLRALLSTLQYVLWPECGWQPVSLTDLITAASVKKVYRKATLCI 911
Query: 877 HPDKVQQKGANLQQKYIAEKVFDLLK 902
HPDKVQQKGANLQQKYIAEKVFDLLK
Sbjct: 912 HPDKVQQKGANLQQKYIAEKVFDLLK 937
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255567186|ref|XP_002524574.1| auxilin, putative [Ricinus communis] gi|223536127|gb|EEF37782.1| auxilin, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|356512862|ref|XP_003525134.1| PREDICTED: auxilin-related protein 2-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356527526|ref|XP_003532360.1| PREDICTED: auxilin-related protein 2-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356516393|ref|XP_003526879.1| PREDICTED: auxilin-related protein 2-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|147777401|emb|CAN64950.1| hypothetical protein VITISV_018382 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297790814|ref|XP_002863292.1| hypothetical protein ARALYDRAFT_497125 [Arabidopsis lyrata subsp. lyrata] gi|297309126|gb|EFH39551.1| hypothetical protein ARALYDRAFT_497125 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|145340151|ref|NP_193013.2| auxilin-related protein 2 [Arabidopsis thaliana] gi|122230016|sp|Q0WQ57.1|AUXI2_ARATH RecName: Full=Auxilin-related protein 2 gi|110737602|dbj|BAF00742.1| auxilin-like protein [Arabidopsis thaliana] gi|332657777|gb|AEE83177.1| auxilin-related protein 2 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|334186464|ref|NP_001190708.1| auxilin-related protein 2 [Arabidopsis thaliana] gi|332657778|gb|AEE83178.1| auxilin-related protein 2 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297790666|ref|XP_002863218.1| hypothetical protein ARALYDRAFT_333056 [Arabidopsis lyrata subsp. lyrata] gi|297309052|gb|EFH39477.1| hypothetical protein ARALYDRAFT_333056 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 965 | ||||||
| TAIR|locus:2135763 | 891 | AT4G12770 [Arabidopsis thalian | 0.227 | 0.246 | 0.607 | 3e-98 | |
| TAIR|locus:2135778 | 904 | AT4G12780 [Arabidopsis thalian | 0.227 | 0.243 | 0.607 | 4.3e-95 | |
| TAIR|locus:2036967 | 523 | AT1G21660 [Arabidopsis thalian | 0.189 | 0.349 | 0.481 | 8.1e-50 | |
| TAIR|locus:2115245 | 1422 | AT4G36520 [Arabidopsis thalian | 0.123 | 0.083 | 0.764 | 8.9e-50 | |
| TAIR|locus:2018462 | 1448 | AUL1 "AT1G75310" [Arabidopsis | 0.123 | 0.082 | 0.647 | 2.4e-39 | |
| TAIR|locus:2037256 | 651 | JAC1 "J-domain protein require | 0.104 | 0.155 | 0.5 | 4.6e-23 | |
| TAIR|locus:2009817 | 455 | AT1G30280 [Arabidopsis thalian | 0.119 | 0.252 | 0.396 | 9.4e-17 | |
| UNIPROTKB|F1NC60 | 1225 | Gga.54538 "Uncharacterized pro | 0.086 | 0.067 | 0.458 | 1.4e-14 | |
| DICTYBASE|DDB_G0276447 | 730 | DDB_G0276447 "BAR domain-conta | 0.097 | 0.128 | 0.418 | 1.8e-14 | |
| UNIPROTKB|F1NL76 | 1265 | Gga.54538 "Uncharacterized pro | 0.086 | 0.065 | 0.458 | 3.5e-14 |
| TAIR|locus:2135763 AT4G12770 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 663 (238.4 bits), Expect = 3.0e-98, Sum P(3) = 3.0e-98
Identities = 136/224 (60%), Positives = 152/224 (67%)
Query: 683 QNQQKNDNDLEXXXXXXXXXXXXXXXXXNTSDSLFDSQSKGGP----EPARRTSVGASSN 738
+ QQ+N+NDL+ N D DS +KGG P+ R G + N
Sbjct: 656 KQQQENNNDLDSFFNSVSRPSSVPRQRTNPPDPFQDSWNKGGSFESSRPSSRVPSGPTEN 715
Query: 739 MRKASSTTNIVDDLXXXXXXXXXXXXEFQDVXXXXXXXXXXXXXXHQRTQERAAKALAEK 798
+RKASS TNIVDDL FQDV HQRTQERAAKALAEK
Sbjct: 716 LRKASSATNIVDDLSSIFGAPASQSGGFQDVDGETEERRRARLERHQRTQERAAKALAEK 775
Query: 799 NERDLQAQRDQAERHRIAETLDVEIKRWAAGKEGNIRALLATMQYVLWPESGWQPVSLTD 858
NERDLQ QR+QAE+ RI TLDVEI+RW AGKEGN+RALL+T+QYVLWPE GWQPVSLTD
Sbjct: 776 NERDLQVQREQAEKDRIGGTLDVEIRRWGAGKEGNLRALLSTLQYVLWPECGWQPVSLTD 835
Query: 859 LITAAAVKKCYRKATLCIHPDKVQQKGANLQQKYIAEKVFDLLK 902
LIT A+VKK YRKATLCIHPDKVQQKGANLQQKYIAEKVFD+LK
Sbjct: 836 LITGASVKKVYRKATLCIHPDKVQQKGANLQQKYIAEKVFDMLK 879
|
|
| TAIR|locus:2135778 AT4G12780 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2036967 AT1G21660 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2115245 AT4G36520 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2018462 AUL1 "AT1G75310" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2037256 JAC1 "J-domain protein required for chloroplast accumulation response 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2009817 AT1G30280 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NC60 Gga.54538 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0276447 DDB_G0276447 "BAR domain-containing protein" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NL76 Gga.54538 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| fgenesh2_kg.9__90__AT4G12770.1 | annotation not avaliable (890 aa) | |||||||
(Arabidopsis lyrata) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 965 | |||
| PRK09510 | 387 | PRK09510, tolA, cell envelope integrity inner memb | 2e-21 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 4e-19 | |
| PRK09510 | 387 | PRK09510, tolA, cell envelope integrity inner memb | 5e-19 | |
| PRK09510 | 387 | PRK09510, tolA, cell envelope integrity inner memb | 5e-18 | |
| PRK05035 | 695 | PRK05035, PRK05035, electron transport complex pro | 2e-16 | |
| COG3064 | 387 | COG3064, TolA, Membrane protein involved in colici | 4e-16 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 8e-16 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 3e-15 | |
| pfam13868 | 349 | pfam13868, Trichoplein, Tumour suppressor, Mitosta | 7e-15 | |
| COG3064 | 387 | COG3064, TolA, Membrane protein involved in colici | 1e-14 | |
| pfam13868 | 349 | pfam13868, Trichoplein, Tumour suppressor, Mitosta | 1e-14 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 5e-14 | |
| COG2268 | 548 | COG2268, COG2268, Uncharacterized protein conserve | 2e-13 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 3e-13 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 4e-13 | |
| pfam13868 | 349 | pfam13868, Trichoplein, Tumour suppressor, Mitosta | 5e-13 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 2e-12 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 3e-12 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 3e-12 | |
| pfam13868 | 349 | pfam13868, Trichoplein, Tumour suppressor, Mitosta | 4e-12 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 9e-12 | |
| PRK02224 | 880 | PRK02224, PRK02224, chromosome segregation protein | 9e-12 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 1e-11 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 3e-11 | |
| COG2268 | 548 | COG2268, COG2268, Uncharacterized protein conserve | 3e-11 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 3e-11 | |
| PRK12678 | 672 | PRK12678, PRK12678, transcription termination fact | 4e-11 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 4e-11 | |
| COG3064 | 387 | COG3064, TolA, Membrane protein involved in colici | 5e-11 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 5e-11 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 6e-11 | |
| PRK12678 | 672 | PRK12678, PRK12678, transcription termination fact | 7e-11 | |
| TIGR02680 | 1353 | TIGR02680, TIGR02680, TIGR02680 family protein | 9e-11 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 1e-10 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 2e-10 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 2e-10 | |
| PRK07735 | 430 | PRK07735, PRK07735, NADH dehydrogenase subunit C; | 2e-10 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 3e-10 | |
| PRK02224 | 880 | PRK02224, PRK02224, chromosome segregation protein | 3e-10 | |
| PRK07735 | 430 | PRK07735, PRK07735, NADH dehydrogenase subunit C; | 3e-10 | |
| COG2268 | 548 | COG2268, COG2268, Uncharacterized protein conserve | 4e-10 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 5e-10 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 6e-10 | |
| TIGR02680 | 1353 | TIGR02680, TIGR02680, TIGR02680 family protein | 6e-10 | |
| pfam13514 | 1118 | pfam13514, AAA_27, AAA domain | 6e-10 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 1e-09 | |
| PRK12678 | 672 | PRK12678, PRK12678, transcription termination fact | 1e-09 | |
| PRK07735 | 430 | PRK07735, PRK07735, NADH dehydrogenase subunit C; | 1e-09 | |
| pfam13868 | 349 | pfam13868, Trichoplein, Tumour suppressor, Mitosta | 2e-09 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 2e-09 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 2e-09 | |
| PRK02224 | 880 | PRK02224, PRK02224, chromosome segregation protein | 2e-09 | |
| PRK02224 | 880 | PRK02224, PRK02224, chromosome segregation protein | 2e-09 | |
| COG2268 | 548 | COG2268, COG2268, Uncharacterized protein conserve | 3e-09 | |
| PRK02224 | 880 | PRK02224, PRK02224, chromosome segregation protein | 3e-09 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 3e-09 | |
| pfam13514 | 1118 | pfam13514, AAA_27, AAA domain | 4e-09 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 5e-09 | |
| TIGR02680 | 1353 | TIGR02680, TIGR02680, TIGR02680 family protein | 5e-09 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 6e-09 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 8e-09 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 9e-09 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 1e-08 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 1e-08 | |
| PRK12704 | 520 | PRK12704, PRK12704, phosphodiesterase; Provisional | 1e-08 | |
| TIGR02680 | 1353 | TIGR02680, TIGR02680, TIGR02680 family protein | 2e-08 | |
| COG4942 | 420 | COG4942, COG4942, Membrane-bound metallopeptidase | 2e-08 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 2e-08 | |
| PRK06991 | 270 | PRK06991, PRK06991, ferredoxin; Provisional | 2e-08 | |
| pfam13830 | 321 | pfam13830, DUF4192, Domain of unknown function (DU | 2e-08 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 3e-08 | |
| PRK02224 | 880 | PRK02224, PRK02224, chromosome segregation protein | 4e-08 | |
| TIGR02680 | 1353 | TIGR02680, TIGR02680, TIGR02680 family protein | 4e-08 | |
| pfam13514 | 1118 | pfam13514, AAA_27, AAA domain | 4e-08 | |
| pfam13514 | 1118 | pfam13514, AAA_27, AAA domain | 4e-08 | |
| PRK06991 | 270 | PRK06991, PRK06991, ferredoxin; Provisional | 4e-08 | |
| PRK05035 | 695 | PRK05035, PRK05035, electron transport complex pro | 5e-08 | |
| PRK07735 | 430 | PRK07735, PRK07735, NADH dehydrogenase subunit C; | 5e-08 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 6e-08 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 8e-08 | |
| COG3064 | 387 | COG3064, TolA, Membrane protein involved in colici | 1e-07 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 1e-07 | |
| TIGR00618 | 1042 | TIGR00618, sbcc, exonuclease SbcC | 1e-07 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 2e-07 | |
| TIGR02680 | 1353 | TIGR02680, TIGR02680, TIGR02680 family protein | 4e-07 | |
| PRK12704 | 520 | PRK12704, PRK12704, phosphodiesterase; Provisional | 4e-07 | |
| COG0711 | 161 | COG0711, AtpF, F0F1-type ATP synthase, subunit b [ | 4e-07 | |
| PRK12678 | 672 | PRK12678, PRK12678, transcription termination fact | 5e-07 | |
| TIGR02680 | 1353 | TIGR02680, TIGR02680, TIGR02680 family protein | 5e-07 | |
| TIGR03319 | 514 | TIGR03319, RNase_Y, ribonuclease Y | 5e-07 | |
| PRK14900 | 1052 | PRK14900, valS, valyl-tRNA synthetase; Provisional | 7e-07 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 8e-07 | |
| PRK12678 | 672 | PRK12678, PRK12678, transcription termination fact | 1e-06 | |
| PRK12704 | 520 | PRK12704, PRK12704, phosphodiesterase; Provisional | 1e-06 | |
| PRK10811 | 1068 | PRK10811, rne, ribonuclease E; Reviewed | 1e-06 | |
| PRK07003 | 830 | PRK07003, PRK07003, DNA polymerase III subunits ga | 1e-06 | |
| pfam13868 | 349 | pfam13868, Trichoplein, Tumour suppressor, Mitosta | 2e-06 | |
| PRK02224 | 880 | PRK02224, PRK02224, chromosome segregation protein | 2e-06 | |
| PRK12678 | 672 | PRK12678, PRK12678, transcription termination fact | 2e-06 | |
| pfam12128 | 1198 | pfam12128, DUF3584, Protein of unknown function (D | 2e-06 | |
| PLN03237 | 1465 | PLN03237, PLN03237, DNA topoisomerase 2; Provision | 2e-06 | |
| PLN03237 | 1465 | PLN03237, PLN03237, DNA topoisomerase 2; Provision | 2e-06 | |
| COG4372 | 499 | COG4372, COG4372, Uncharacterized protein conserve | 2e-06 | |
| PRK12705 | 508 | PRK12705, PRK12705, hypothetical protein; Provisio | 2e-06 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 3e-06 | |
| COG1340 | 294 | COG1340, COG1340, Uncharacterized archaeal coiled- | 3e-06 | |
| pfam05262 | 489 | pfam05262, Borrelia_P83, Borrelia P83/100 protein | 3e-06 | |
| PRK06669 | 281 | PRK06669, fliH, flagellar assembly protein H; Vali | 3e-06 | |
| pfam08017 | 393 | pfam08017, Fibrinogen_BP, Fibrinogen binding prote | 3e-06 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 4e-06 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 4e-06 | |
| COG1566 | 352 | COG1566, EmrA, Multidrug resistance efflux pump [D | 4e-06 | |
| PRK00247 | 429 | PRK00247, PRK00247, putative inner membrane protei | 4e-06 | |
| PRK05759 | 156 | PRK05759, PRK05759, F0F1 ATP synthase subunit B; V | 4e-06 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 6e-06 | |
| TIGR02680 | 1353 | TIGR02680, TIGR02680, TIGR02680 family protein | 6e-06 | |
| COG4372 | 499 | COG4372, COG4372, Uncharacterized protein conserve | 6e-06 | |
| PRK00409 | 782 | PRK00409, PRK00409, recombination and DNA strand e | 6e-06 | |
| PRK05035 | 695 | PRK05035, PRK05035, electron transport complex pro | 7e-06 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 7e-06 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 7e-06 | |
| pfam07767 | 387 | pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) | 7e-06 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 8e-06 | |
| PRK05759 | 156 | PRK05759, PRK05759, F0F1 ATP synthase subunit B; V | 8e-06 | |
| COG4372 | 499 | COG4372, COG4372, Uncharacterized protein conserve | 9e-06 | |
| pfam12128 | 1198 | pfam12128, DUF3584, Protein of unknown function (D | 1e-05 | |
| pfam07767 | 387 | pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) | 1e-05 | |
| PRK12472 | 508 | PRK12472, PRK12472, hypothetical protein; Provisio | 1e-05 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 1e-05 | |
| COG2433 | 652 | COG2433, COG2433, Uncharacterized conserved protei | 1e-05 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 2e-05 | |
| COG0711 | 161 | COG0711, AtpF, F0F1-type ATP synthase, subunit b [ | 2e-05 | |
| TIGR03319 | 514 | TIGR03319, RNase_Y, ribonuclease Y | 2e-05 | |
| PRK12705 | 508 | PRK12705, PRK12705, hypothetical protein; Provisio | 2e-05 | |
| pfam05262 | 489 | pfam05262, Borrelia_P83, Borrelia P83/100 protein | 2e-05 | |
| PRK05759 | 156 | PRK05759, PRK05759, F0F1 ATP synthase subunit B; V | 2e-05 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 2e-05 | |
| COG1842 | 225 | COG1842, PspA, Phage shock protein A (IM30), suppr | 2e-05 | |
| pfam07767 | 387 | pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) | 3e-05 | |
| COG0330 | 291 | COG0330, HflC, Membrane protease subunits, stomati | 3e-05 | |
| COG3599 | 212 | COG3599, DivIVA, Cell division initiation protein | 3e-05 | |
| TIGR02680 | 1353 | TIGR02680, TIGR02680, TIGR02680 family protein | 4e-05 | |
| TIGR02680 | 1353 | TIGR02680, TIGR02680, TIGR02680 family protein | 4e-05 | |
| PRK00106 | 535 | PRK00106, PRK00106, hypothetical protein; Provisio | 4e-05 | |
| pfam13868 | 349 | pfam13868, Trichoplein, Tumour suppressor, Mitosta | 5e-05 | |
| COG4942 | 420 | COG4942, COG4942, Membrane-bound metallopeptidase | 5e-05 | |
| PRK07003 | 830 | PRK07003, PRK07003, DNA polymerase III subunits ga | 5e-05 | |
| pfam00769 | 244 | pfam00769, ERM, Ezrin/radixin/moesin family | 5e-05 | |
| TIGR02971 | 327 | TIGR02971, heterocyst_DevB, ABC exporter membrane | 5e-05 | |
| pfam05701 | 484 | pfam05701, DUF827, Plant protein of unknown functi | 5e-05 | |
| PRK07352 | 174 | PRK07352, PRK07352, F0F1 ATP synthase subunit B; V | 6e-05 | |
| TIGR02680 | 1353 | TIGR02680, TIGR02680, TIGR02680 family protein | 7e-05 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 7e-05 | |
| PRK04863 | 1486 | PRK04863, mukB, cell division protein MukB; Provis | 9e-05 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 1e-04 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 1e-04 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 1e-04 | |
| PRK12704 | 520 | PRK12704, PRK12704, phosphodiesterase; Provisional | 1e-04 | |
| PRK00247 | 429 | PRK00247, PRK00247, putative inner membrane protei | 1e-04 | |
| PRK12472 | 508 | PRK12472, PRK12472, hypothetical protein; Provisio | 1e-04 | |
| pfam10174 | 774 | pfam10174, Cast, RIM-binding protein of the cytoma | 1e-04 | |
| PRK06995 | 484 | PRK06995, flhF, flagellar biosynthesis regulator F | 1e-04 | |
| pfam09756 | 189 | pfam09756, DDRGK, DDRGK domain | 1e-04 | |
| COG5281 | 833 | COG5281, COG5281, Phage-related minor tail protein | 1e-04 | |
| PRK11637 | 428 | PRK11637, PRK11637, AmiB activator; Provisional | 1e-04 | |
| PRK10811 | 1068 | PRK10811, rne, ribonuclease E; Reviewed | 2e-04 | |
| pfam07767 | 387 | pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) | 2e-04 | |
| PRK12472 | 508 | PRK12472, PRK12472, hypothetical protein; Provisio | 2e-04 | |
| PRK12472 | 508 | PRK12472, PRK12472, hypothetical protein; Provisio | 2e-04 | |
| COG0330 | 291 | COG0330, HflC, Membrane protease subunits, stomati | 2e-04 | |
| pfam00769 | 244 | pfam00769, ERM, Ezrin/radixin/moesin family | 2e-04 | |
| PRK04863 | 1486 | PRK04863, mukB, cell division protein MukB; Provis | 2e-04 | |
| pfam09756 | 189 | pfam09756, DDRGK, DDRGK domain | 2e-04 | |
| TIGR01843 | 423 | TIGR01843, type_I_hlyD, type I secretion membrane | 2e-04 | |
| TIGR01843 | 423 | TIGR01843, type_I_hlyD, type I secretion membrane | 2e-04 | |
| COG5269 | 379 | COG5269, ZUO1, Ribosome-associated chaperone zuoti | 2e-04 | |
| COG1538 | 457 | COG1538, TolC, Outer membrane protein [Cell envelo | 2e-04 | |
| TIGR03345 | 852 | TIGR03345, VI_ClpV1, type VI secretion ATPase, Clp | 2e-04 | |
| COG1579 | 239 | COG1579, COG1579, Zn-ribbon protein, possibly nucl | 2e-04 | |
| COG0711 | 161 | COG0711, AtpF, F0F1-type ATP synthase, subunit b [ | 3e-04 | |
| pfam00769 | 244 | pfam00769, ERM, Ezrin/radixin/moesin family | 3e-04 | |
| pfam05914 | 379 | pfam05914, RIB43A, RIB43A | 3e-04 | |
| pfam12037 | 276 | pfam12037, DUF3523, Domain of unknown function (DU | 3e-04 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 3e-04 | |
| pfam07111 | 739 | pfam07111, HCR, Alpha helical coiled-coil rod prot | 3e-04 | |
| COG0711 | 161 | COG0711, AtpF, F0F1-type ATP synthase, subunit b [ | 4e-04 | |
| COG4372 | 499 | COG4372, COG4372, Uncharacterized protein conserve | 4e-04 | |
| pfam07767 | 387 | pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) | 4e-04 | |
| pfam09756 | 189 | pfam09756, DDRGK, DDRGK domain | 4e-04 | |
| TIGR03345 | 852 | TIGR03345, VI_ClpV1, type VI secretion ATPase, Clp | 4e-04 | |
| PRK09098 | 233 | PRK09098, PRK09098, type III secretion system prot | 4e-04 | |
| PRK13108 | 460 | PRK13108, PRK13108, prolipoprotein diacylglyceryl | 4e-04 | |
| COG0845 | 372 | COG0845, AcrA, Membrane-fusion protein [Cell envel | 4e-04 | |
| COG5192 | 1077 | COG5192, BMS1, GTP-binding protein required for 40 | 4e-04 | |
| pfam13514 | 1118 | pfam13514, AAA_27, AAA domain | 5e-04 | |
| PRK05759 | 156 | PRK05759, PRK05759, F0F1 ATP synthase subunit B; V | 5e-04 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 5e-04 | |
| PHA00430 | 568 | PHA00430, PHA00430, tail fiber protein | 5e-04 | |
| pfam13863 | 126 | pfam13863, DUF4200, Domain of unknown function (DU | 5e-04 | |
| PRK09510 | 387 | PRK09510, tolA, cell envelope integrity inner memb | 6e-04 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 6e-04 | |
| COG3064 | 387 | COG3064, TolA, Membrane protein involved in colici | 6e-04 | |
| PRK06995 | 484 | PRK06995, flhF, flagellar biosynthesis regulator F | 6e-04 | |
| PHA00430 | 568 | PHA00430, PHA00430, tail fiber protein | 6e-04 | |
| pfam03962 | 188 | pfam03962, Mnd1, Mnd1 family | 6e-04 | |
| PRK12323 | 700 | PRK12323, PRK12323, DNA polymerase III subunits ga | 6e-04 | |
| TIGR03346 | 852 | TIGR03346, chaperone_ClpB, ATP-dependent chaperone | 7e-04 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 7e-04 | |
| pfam09731 | 493 | pfam09731, Mitofilin, Mitochondrial inner membrane | 7e-04 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 8e-04 | |
| PRK07352 | 174 | PRK07352, PRK07352, F0F1 ATP synthase subunit B; V | 8e-04 | |
| PTZ00436 | 357 | PTZ00436, PTZ00436, 60S ribosomal protein L19-like | 8e-04 | |
| pfam05279 | 240 | pfam05279, Asp-B-Hydro_N, Aspartyl beta-hydroxylas | 9e-04 | |
| PRK02224 | 880 | PRK02224, PRK02224, chromosome segregation protein | 0.001 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 0.001 | |
| PRK12704 | 520 | PRK12704, PRK12704, phosphodiesterase; Provisional | 0.001 | |
| COG4942 | 420 | COG4942, COG4942, Membrane-bound metallopeptidase | 0.001 | |
| PRK06991 | 270 | PRK06991, PRK06991, ferredoxin; Provisional | 0.001 | |
| PRK00247 | 429 | PRK00247, PRK00247, putative inner membrane protei | 0.001 | |
| COG1842 | 225 | COG1842, PspA, Phage shock protein A (IM30), suppr | 0.001 | |
| PRK06995 | 484 | PRK06995, flhF, flagellar biosynthesis regulator F | 0.001 | |
| PRK06995 | 484 | PRK06995, flhF, flagellar biosynthesis regulator F | 0.001 | |
| pfam09756 | 189 | pfam09756, DDRGK, DDRGK domain | 0.001 | |
| TIGR03345 | 852 | TIGR03345, VI_ClpV1, type VI secretion ATPase, Clp | 0.001 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 0.001 | |
| PRK13108 | 460 | PRK13108, PRK13108, prolipoprotein diacylglyceryl | 0.001 | |
| PTZ00436 | 357 | PTZ00436, PTZ00436, 60S ribosomal protein L19-like | 0.001 | |
| PLN02316 | 1036 | PLN02316, PLN02316, synthase/transferase | 0.001 | |
| pfam04632 | 649 | pfam04632, FUSC, Fusaric acid resistance protein f | 0.001 | |
| pfam10721 | 162 | pfam10721, DUF2514, Protein of unknown function (D | 0.001 | |
| pfam10721 | 162 | pfam10721, DUF2514, Protein of unknown function (D | 0.001 | |
| PLN03086 | 567 | PLN03086, PLN03086, PRLI-interacting factor K; Pro | 0.001 | |
| pfam04156 | 186 | pfam04156, IncA, IncA protein | 0.001 | |
| PRK14521 | 186 | PRK14521, rpsP, 30S ribosomal protein S16; Provisi | 0.001 | |
| TIGR03185 | 650 | TIGR03185, DNA_S_dndD, DNA sulfur modification pro | 0.001 | |
| pfam04094 | 843 | pfam04094, DUF390, Protein of unknown function (DU | 0.001 | |
| pfam00430 | 132 | pfam00430, ATP-synt_B, ATP synthase B/B' CF(0) | 0.001 | |
| PTZ00491 | 850 | PTZ00491, PTZ00491, major vault protein; Provision | 0.001 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 0.002 | |
| PRK07735 | 430 | PRK07735, PRK07735, NADH dehydrogenase subunit C; | 0.002 | |
| pfam13514 | 1118 | pfam13514, AAA_27, AAA domain | 0.002 | |
| pfam12128 | 1198 | pfam12128, DUF3584, Protein of unknown function (D | 0.002 | |
| pfam05262 | 489 | pfam05262, Borrelia_P83, Borrelia P83/100 protein | 0.002 | |
| pfam08017 | 393 | pfam08017, Fibrinogen_BP, Fibrinogen binding prote | 0.002 | |
| COG1566 | 352 | COG1566, EmrA, Multidrug resistance efflux pump [D | 0.002 | |
| COG1566 | 352 | COG1566, EmrA, Multidrug resistance efflux pump [D | 0.002 | |
| PRK00247 | 429 | PRK00247, PRK00247, putative inner membrane protei | 0.002 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 0.002 | |
| COG3599 | 212 | COG3599, DivIVA, Cell division initiation protein | 0.002 | |
| PRK11637 | 428 | PRK11637, PRK11637, AmiB activator; Provisional | 0.002 | |
| PRK09098 | 233 | PRK09098, PRK09098, type III secretion system prot | 0.002 | |
| COG0845 | 372 | COG0845, AcrA, Membrane-fusion protein [Cell envel | 0.002 | |
| PTZ00436 | 357 | PTZ00436, PTZ00436, 60S ribosomal protein L19-like | 0.002 | |
| PRK14521 | 186 | PRK14521, rpsP, 30S ribosomal protein S16; Provisi | 0.002 | |
| pfam00430 | 132 | pfam00430, ATP-synt_B, ATP synthase B/B' CF(0) | 0.002 | |
| pfam13904 | 261 | pfam13904, DUF4207, Domain of unknown function (DU | 0.002 | |
| COG3206 | 458 | COG3206, GumC, Uncharacterized protein involved in | 0.002 | |
| pfam11740 | 120 | pfam11740, KfrA_N, Plasmid replication region DNA- | 0.002 | |
| pfam01576 | 859 | pfam01576, Myosin_tail_1, Myosin tail | 0.002 | |
| pfam06637 | 442 | pfam06637, PV-1, PV-1 protein (PLVAP) | 0.002 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 0.003 | |
| PRK04863 | 1486 | PRK04863, mukB, cell division protein MukB; Provis | 0.003 | |
| COG1538 | 457 | COG1538, TolC, Outer membrane protein [Cell envelo | 0.003 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 0.003 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 0.003 | |
| PRK12323 | 700 | PRK12323, PRK12323, DNA polymerase III subunits ga | 0.003 | |
| COG4487 | 438 | COG4487, COG4487, Uncharacterized protein conserve | 0.003 | |
| TIGR01554 | 384 | TIGR01554, major_cap_HK97, phage major capsid prot | 0.003 | |
| pfam07946 | 322 | pfam07946, DUF1682, Protein of unknown function (D | 0.003 | |
| COG0488 | 530 | COG0488, Uup, ATPase components of ABC transporter | 0.003 | |
| PRK12372 | 413 | PRK12372, PRK12372, ribonuclease III; Reviewed | 0.003 | |
| cd08045 | 212 | cd08045, TAF4, TATA Binding Protein (TBP) Associat | 0.003 | |
| PTZ00399 | 651 | PTZ00399, PTZ00399, cysteinyl-tRNA-synthetase; Pro | 0.003 | |
| PRK13709 | 1747 | PRK13709, PRK13709, conjugal transfer nickase/heli | 0.003 | |
| PRK00247 | 429 | PRK00247, PRK00247, putative inner membrane protei | 0.004 | |
| COG0330 | 291 | COG0330, HflC, Membrane protease subunits, stomati | 0.004 | |
| pfam00769 | 244 | pfam00769, ERM, Ezrin/radixin/moesin family | 0.004 | |
| PLN03086 | 567 | PLN03086, PLN03086, PRLI-interacting factor K; Pro | 0.004 | |
| pfam07946 | 322 | pfam07946, DUF1682, Protein of unknown function (D | 0.004 | |
| pfam00529 | 304 | pfam00529, HlyD, HlyD family secretion protein | 0.004 | |
| pfam02841 | 297 | pfam02841, GBP_C, Guanylate-binding protein, C-ter | 0.004 | |
| pfam14362 | 297 | pfam14362, DUF4407, Domain of unknown function (DU | 0.004 | |
| PRK14472 | 175 | PRK14472, PRK14472, F0F1 ATP synthase subunit B; P | 0.004 | |
| PRK14473 | 164 | PRK14473, PRK14473, F0F1 ATP synthase subunit B; P | 0.004 | |
| pfam08524 | 150 | pfam08524, rRNA_processing, rRNA processing | 0.004 | |
| pfam05236 | 255 | pfam05236, TAF4, Transcription initiation factor T | 0.004 | |
| smart00880 | 262 | smart00880, CHAD, The CHAD domain is an alpha-heli | 0.004 | |
| pfam00901 | 507 | pfam00901, Orbi_VP5, Orbivirus outer capsid protei | 0.004 |
| >gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional | Back alignment and domain information |
|---|
Score = 97.6 bits (243), Expect = 2e-21
Identities = 74/200 (37%), Positives = 117/200 (58%), Gaps = 12/200 (6%)
Query: 488 EERATQQDAQERLDREMQQREKGEEQRRLEREREREREEKEREKKRIEKEKERAREIEKE 547
E+ QQ Q+ R +QR+K E+Q+ E ++++ ++ K++EKE+ A+E +K+
Sbjct: 62 EQYNRQQQQQKSAKRAEEQRKKKEQQQ--AEELQQKQAAEQERLKQLEKERLAAQEQKKQ 119
Query: 548 REKARQAVERATREARE---RAAAEARLKAERAAVDKANAAARERAERAAVQRAQAEARE 604
E+A + ++A E +AAA A+ KAE A K AAA ++A A ++A+AEA +
Sbjct: 120 AEEAAKQAALKQKQAEEAAAKAAAAAKAKAEAEA--KRAAAAAKKAAAEAKKKAEAEAAK 177
Query: 605 RAAAEARERAE-----RAAAEARERANAEAREKEARERASVARTEAEALQRAERAAVQRA 659
+AAAEA+++AE +AAAEA+++A AEA++K A E A EA+A A + A
Sbjct: 178 KAAAEAKKKAEAEAAAKAAAEAKKKAEAEAKKKAAAEAKKKAAAEAKAAAAKAAAEAKAA 237
Query: 660 ASEARERAAAEARERAAAAA 679
A +A AAE A AAA
Sbjct: 238 AEKAAAAKAAEKAAAAKAAA 257
|
Length = 387 |
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235334 PRK05035, PRK05035, electron transport complex protein RnfC; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin | Back alignment and domain information |
|---|
| >gnl|CDD|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|225177 COG2268, COG2268, Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225177 COG2268, COG2268, Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233973 TIGR02680, TIGR02680, TIGR02680 family protein | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|236081 PRK07735, PRK07735, NADH dehydrogenase subunit C; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236081 PRK07735, PRK07735, NADH dehydrogenase subunit C; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|225177 COG2268, COG2268, Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233973 TIGR02680, TIGR02680, TIGR02680 family protein | Back alignment and domain information |
|---|
| >gnl|CDD|205692 pfam13514, AAA_27, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236081 PRK07735, PRK07735, NADH dehydrogenase subunit C; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225177 COG2268, COG2268, Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|205692 pfam13514, AAA_27, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233973 TIGR02680, TIGR02680, TIGR02680 family protein | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233973 TIGR02680, TIGR02680, TIGR02680 family protein | Back alignment and domain information |
|---|
| >gnl|CDD|227278 COG4942, COG4942, Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|235903 PRK06991, PRK06991, ferredoxin; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222405 pfam13830, DUF4192, Domain of unknown function (DUF4192) | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233973 TIGR02680, TIGR02680, TIGR02680 family protein | Back alignment and domain information |
|---|
| >gnl|CDD|205692 pfam13514, AAA_27, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|205692 pfam13514, AAA_27, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|235903 PRK06991, PRK06991, ferredoxin; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235334 PRK05035, PRK05035, electron transport complex protein RnfC; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236081 PRK07735, PRK07735, NADH dehydrogenase subunit C; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|129705 TIGR00618, sbcc, exonuclease SbcC | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233973 TIGR02680, TIGR02680, TIGR02680 family protein | Back alignment and domain information |
|---|
| >gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223783 COG0711, AtpF, F0F1-type ATP synthase, subunit b [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233973 TIGR02680, TIGR02680, TIGR02680 family protein | Back alignment and domain information |
|---|
| >gnl|CDD|188306 TIGR03319, RNase_Y, ribonuclease Y | Back alignment and domain information |
|---|
| >gnl|CDD|237855 PRK14900, valS, valyl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236766 PRK10811, rne, ribonuclease E; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin | Back alignment and domain information |
|---|
| >gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|221432 pfam12128, DUF3584, Protein of unknown function (DUF3584) | Back alignment and domain information |
|---|
| >gnl|CDD|215641 PLN03237, PLN03237, DNA topoisomerase 2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215641 PLN03237, PLN03237, DNA topoisomerase 2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226809 COG4372, COG4372, Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|237178 PRK12705, PRK12705, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|224259 COG1340, COG1340, Uncharacterized archaeal coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|114011 pfam05262, Borrelia_P83, Borrelia P83/100 protein | Back alignment and domain information |
|---|
| >gnl|CDD|235850 PRK06669, fliH, flagellar assembly protein H; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|116627 pfam08017, Fibrinogen_BP, Fibrinogen binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|224482 COG1566, EmrA, Multidrug resistance efflux pump [Defense mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|178945 PRK00247, PRK00247, putative inner membrane protein translocase component YidC; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|180240 PRK05759, PRK05759, F0F1 ATP synthase subunit B; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|233973 TIGR02680, TIGR02680, TIGR02680 family protein | Back alignment and domain information |
|---|
| >gnl|CDD|226809 COG4372, COG4372, Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|234750 PRK00409, PRK00409, recombination and DNA strand exchange inhibitor protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|235334 PRK05035, PRK05035, electron transport complex protein RnfC; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|219563 pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|180240 PRK05759, PRK05759, F0F1 ATP synthase subunit B; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|226809 COG4372, COG4372, Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|221432 pfam12128, DUF3584, Protein of unknown function (DUF3584) | Back alignment and domain information |
|---|
| >gnl|CDD|219563 pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) | Back alignment and domain information |
|---|
| >gnl|CDD|237110 PRK12472, PRK12472, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225288 COG2433, COG2433, Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|223783 COG0711, AtpF, F0F1-type ATP synthase, subunit b [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|188306 TIGR03319, RNase_Y, ribonuclease Y | Back alignment and domain information |
|---|
| >gnl|CDD|237178 PRK12705, PRK12705, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|114011 pfam05262, Borrelia_P83, Borrelia P83/100 protein | Back alignment and domain information |
|---|
| >gnl|CDD|180240 PRK05759, PRK05759, F0F1 ATP synthase subunit B; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|224755 COG1842, PspA, Phage shock protein A (IM30), suppresses sigma54-dependent transcription [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|219563 pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) | Back alignment and domain information |
|---|
| >gnl|CDD|223407 COG0330, HflC, Membrane protease subunits, stomatin/prohibitin homologs [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|226127 COG3599, DivIVA, Cell division initiation protein [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233973 TIGR02680, TIGR02680, TIGR02680 family protein | Back alignment and domain information |
|---|
| >gnl|CDD|233973 TIGR02680, TIGR02680, TIGR02680 family protein | Back alignment and domain information |
|---|
| >gnl|CDD|178867 PRK00106, PRK00106, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin | Back alignment and domain information |
|---|
| >gnl|CDD|227278 COG4942, COG4942, Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|216108 pfam00769, ERM, Ezrin/radixin/moesin family | Back alignment and domain information |
|---|
| >gnl|CDD|213754 TIGR02971, heterocyst_DevB, ABC exporter membrane fusion protein, DevB family | Back alignment and domain information |
|---|
| >gnl|CDD|218704 pfam05701, DUF827, Plant protein of unknown function (DUF827) | Back alignment and domain information |
|---|
| >gnl|CDD|180941 PRK07352, PRK07352, F0F1 ATP synthase subunit B; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|233973 TIGR02680, TIGR02680, TIGR02680 family protein | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235316 PRK04863, mukB, cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|178945 PRK00247, PRK00247, putative inner membrane protein translocase component YidC; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237110 PRK12472, PRK12472, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220614 pfam10174, Cast, RIM-binding protein of the cytomatrix active zone | Back alignment and domain information |
|---|
| >gnl|CDD|235904 PRK06995, flhF, flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|220383 pfam09756, DDRGK, DDRGK domain | Back alignment and domain information |
|---|
| >gnl|CDD|227606 COG5281, COG5281, Phage-related minor tail protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|236942 PRK11637, PRK11637, AmiB activator; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236766 PRK10811, rne, ribonuclease E; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|219563 pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) | Back alignment and domain information |
|---|
| >gnl|CDD|237110 PRK12472, PRK12472, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237110 PRK12472, PRK12472, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223407 COG0330, HflC, Membrane protease subunits, stomatin/prohibitin homologs [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|216108 pfam00769, ERM, Ezrin/radixin/moesin family | Back alignment and domain information |
|---|
| >gnl|CDD|235316 PRK04863, mukB, cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220383 pfam09756, DDRGK, DDRGK domain | Back alignment and domain information |
|---|
| >gnl|CDD|130902 TIGR01843, type_I_hlyD, type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >gnl|CDD|130902 TIGR01843, type_I_hlyD, type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >gnl|CDD|227594 COG5269, ZUO1, Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|224455 COG1538, TolC, Outer membrane protein [Cell envelope biogenesis, outer membrane / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >gnl|CDD|234172 TIGR03345, VI_ClpV1, type VI secretion ATPase, ClpV1 family | Back alignment and domain information |
|---|
| >gnl|CDD|224495 COG1579, COG1579, Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|223783 COG0711, AtpF, F0F1-type ATP synthase, subunit b [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|216108 pfam00769, ERM, Ezrin/radixin/moesin family | Back alignment and domain information |
|---|
| >gnl|CDD|147845 pfam05914, RIB43A, RIB43A | Back alignment and domain information |
|---|
| >gnl|CDD|221389 pfam12037, DUF3523, Domain of unknown function (DUF3523) | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|148617 pfam07111, HCR, Alpha helical coiled-coil rod protein (HCR) | Back alignment and domain information |
|---|
| >gnl|CDD|223783 COG0711, AtpF, F0F1-type ATP synthase, subunit b [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|226809 COG4372, COG4372, Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|219563 pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) | Back alignment and domain information |
|---|
| >gnl|CDD|220383 pfam09756, DDRGK, DDRGK domain | Back alignment and domain information |
|---|
| >gnl|CDD|234172 TIGR03345, VI_ClpV1, type VI secretion ATPase, ClpV1 family | Back alignment and domain information |
|---|
| >gnl|CDD|181646 PRK09098, PRK09098, type III secretion system protein HrpB; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237284 PRK13108, PRK13108, prolipoprotein diacylglyceryl transferase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|223914 COG0845, AcrA, Membrane-fusion protein [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|227519 COG5192, BMS1, GTP-binding protein required for 40S ribosome biogenesis [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|205692 pfam13514, AAA_27, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|180240 PRK05759, PRK05759, F0F1 ATP synthase subunit B; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|222790 PHA00430, PHA00430, tail fiber protein | Back alignment and domain information |
|---|
| >gnl|CDD|206034 pfam13863, DUF4200, Domain of unknown function (DUF4200) | Back alignment and domain information |
|---|
| >gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|235904 PRK06995, flhF, flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|222790 PHA00430, PHA00430, tail fiber protein | Back alignment and domain information |
|---|
| >gnl|CDD|202833 pfam03962, Mnd1, Mnd1 family | Back alignment and domain information |
|---|
| >gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234173 TIGR03346, chaperone_ClpB, ATP-dependent chaperone ClpB | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220369 pfam09731, Mitofilin, Mitochondrial inner membrane protein | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|180941 PRK07352, PRK07352, F0F1 ATP synthase subunit B; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|185616 PTZ00436, PTZ00436, 60S ribosomal protein L19-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|191249 pfam05279, Asp-B-Hydro_N, Aspartyl beta-hydroxylase N-terminal region | Back alignment and domain information |
|---|
| >gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227278 COG4942, COG4942, Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|235903 PRK06991, PRK06991, ferredoxin; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|178945 PRK00247, PRK00247, putative inner membrane protein translocase component YidC; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|224755 COG1842, PspA, Phage shock protein A (IM30), suppresses sigma54-dependent transcription [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|235904 PRK06995, flhF, flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235904 PRK06995, flhF, flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|220383 pfam09756, DDRGK, DDRGK domain | Back alignment and domain information |
|---|
| >gnl|CDD|234172 TIGR03345, VI_ClpV1, type VI secretion ATPase, ClpV1 family | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237284 PRK13108, PRK13108, prolipoprotein diacylglyceryl transferase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|185616 PTZ00436, PTZ00436, 60S ribosomal protein L19-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215180 PLN02316, PLN02316, synthase/transferase | Back alignment and domain information |
|---|
| >gnl|CDD|218184 pfam04632, FUSC, Fusaric acid resistance protein family | Back alignment and domain information |
|---|
| >gnl|CDD|119241 pfam10721, DUF2514, Protein of unknown function (DUF2514) | Back alignment and domain information |
|---|
| >gnl|CDD|119241 pfam10721, DUF2514, Protein of unknown function (DUF2514) | Back alignment and domain information |
|---|
| >gnl|CDD|178635 PLN03086, PLN03086, PRLI-interacting factor K; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217933 pfam04156, IncA, IncA protein | Back alignment and domain information |
|---|
| >gnl|CDD|237744 PRK14521, rpsP, 30S ribosomal protein S16; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234141 TIGR03185, DNA_S_dndD, DNA sulfur modification protein DndD | Back alignment and domain information |
|---|
| >gnl|CDD|112890 pfam04094, DUF390, Protein of unknown function (DUF390) | Back alignment and domain information |
|---|
| >gnl|CDD|109486 pfam00430, ATP-synt_B, ATP synthase B/B' CF(0) | Back alignment and domain information |
|---|
| >gnl|CDD|240439 PTZ00491, PTZ00491, major vault protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|236081 PRK07735, PRK07735, NADH dehydrogenase subunit C; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|205692 pfam13514, AAA_27, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|221432 pfam12128, DUF3584, Protein of unknown function (DUF3584) | Back alignment and domain information |
|---|
| >gnl|CDD|114011 pfam05262, Borrelia_P83, Borrelia P83/100 protein | Back alignment and domain information |
|---|
| >gnl|CDD|116627 pfam08017, Fibrinogen_BP, Fibrinogen binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|224482 COG1566, EmrA, Multidrug resistance efflux pump [Defense mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|224482 COG1566, EmrA, Multidrug resistance efflux pump [Defense mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|178945 PRK00247, PRK00247, putative inner membrane protein translocase component YidC; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|226127 COG3599, DivIVA, Cell division initiation protein [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|236942 PRK11637, PRK11637, AmiB activator; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181646 PRK09098, PRK09098, type III secretion system protein HrpB; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|223914 COG0845, AcrA, Membrane-fusion protein [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|185616 PTZ00436, PTZ00436, 60S ribosomal protein L19-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237744 PRK14521, rpsP, 30S ribosomal protein S16; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|109486 pfam00430, ATP-synt_B, ATP synthase B/B' CF(0) | Back alignment and domain information |
|---|
| >gnl|CDD|222447 pfam13904, DUF4207, Domain of unknown function (DUF4207) | Back alignment and domain information |
|---|
| >gnl|CDD|225747 COG3206, GumC, Uncharacterized protein involved in exopolysaccharide biosynthesis [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|221198 pfam11740, KfrA_N, Plasmid replication region DNA-binding N-term | Back alignment and domain information |
|---|
| >gnl|CDD|144972 pfam01576, Myosin_tail_1, Myosin tail | Back alignment and domain information |
|---|
| >gnl|CDD|115307 pfam06637, PV-1, PV-1 protein (PLVAP) | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235316 PRK04863, mukB, cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224455 COG1538, TolC, Outer membrane protein [Cell envelope biogenesis, outer membrane / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226889 COG4487, COG4487, Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|233467 TIGR01554, major_cap_HK97, phage major capsid protein, HK97 family | Back alignment and domain information |
|---|
| >gnl|CDD|219655 pfam07946, DUF1682, Protein of unknown function (DUF1682) | Back alignment and domain information |
|---|
| >gnl|CDD|223562 COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|237081 PRK12372, PRK12372, ribonuclease III; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|173965 cd08045, TAF4, TATA Binding Protein (TBP) Associated Factor 4 (TAF4) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex | Back alignment and domain information |
|---|
| >gnl|CDD|240402 PTZ00399, PTZ00399, cysteinyl-tRNA-synthetase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237478 PRK13709, PRK13709, conjugal transfer nickase/helicase TraI; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|178945 PRK00247, PRK00247, putative inner membrane protein translocase component YidC; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|223407 COG0330, HflC, Membrane protease subunits, stomatin/prohibitin homologs [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|216108 pfam00769, ERM, Ezrin/radixin/moesin family | Back alignment and domain information |
|---|
| >gnl|CDD|178635 PLN03086, PLN03086, PRLI-interacting factor K; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219655 pfam07946, DUF1682, Protein of unknown function (DUF1682) | Back alignment and domain information |
|---|
| >gnl|CDD|215974 pfam00529, HlyD, HlyD family secretion protein | Back alignment and domain information |
|---|
| >gnl|CDD|202427 pfam02841, GBP_C, Guanylate-binding protein, C-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|222709 pfam14362, DUF4407, Domain of unknown function (DUF4407) | Back alignment and domain information |
|---|
| >gnl|CDD|172947 PRK14472, PRK14472, F0F1 ATP synthase subunit B; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172948 PRK14473, PRK14473, F0F1 ATP synthase subunit B; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219882 pfam08524, rRNA_processing, rRNA processing | Back alignment and domain information |
|---|
| >gnl|CDD|218517 pfam05236, TAF4, Transcription initiation factor TFIID component TAF4 family | Back alignment and domain information |
|---|
| >gnl|CDD|214880 smart00880, CHAD, The CHAD domain is an alpha-helical domain functionally associated with some members of the adenylate cyclase family | Back alignment and domain information |
|---|
| >gnl|CDD|189762 pfam00901, Orbi_VP5, Orbivirus outer capsid protein VP5 | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 965 | |||
| KOG0431 | 453 | consensus Auxilin-like protein and related protein | 100.0 | |
| PRK09510 | 387 | tolA cell envelope integrity inner membrane protei | 99.44 | |
| PTZ00121 | 2084 | MAEBL; Provisional | 99.35 | |
| COG3064 | 387 | TolA Membrane protein involved in colicin uptake [ | 99.29 | |
| PRK09510 | 387 | tolA cell envelope integrity inner membrane protei | 98.82 | |
| TIGR02794 | 346 | tolA_full TolA protein. TolA couples the inner mem | 98.6 | |
| COG3064 | 387 | TolA Membrane protein involved in colicin uptake [ | 98.42 | |
| TIGR02794 | 346 | tolA_full TolA protein. TolA couples the inner mem | 98.32 | |
| PTZ00266 | 1021 | NIMA-related protein kinase; Provisional | 98.14 | |
| KOG1029 | 1118 | consensus Endocytic adaptor protein intersectin [S | 98.05 | |
| KOG1029 | 1118 | consensus Endocytic adaptor protein intersectin [S | 97.84 | |
| smart00271 | 60 | DnaJ DnaJ molecular chaperone homology domain. | 97.61 | |
| cd06257 | 55 | DnaJ DnaJ domain or J-domain. DnaJ/Hsp40 (heat sho | 97.55 | |
| KOG2072 | 988 | consensus Translation initiation factor 3, subunit | 97.54 | |
| PF00226 | 64 | DnaJ: DnaJ domain; InterPro: IPR001623 The prokary | 97.37 | |
| PRK09430 | 267 | djlA Dna-J like membrane chaperone protein; Provis | 97.15 | |
| KOG4364 | 811 | consensus Chromatin assembly factor-I [Chromatin s | 96.83 | |
| KOG4364 | 811 | consensus Chromatin assembly factor-I [Chromatin s | 96.77 | |
| PRK03578 | 176 | hscB co-chaperone HscB; Provisional | 96.62 | |
| TIGR00714 | 157 | hscB Fe-S protein assembly co-chaperone HscB. This | 96.62 | |
| PRK05014 | 171 | hscB co-chaperone HscB; Provisional | 96.59 | |
| KOG1150 | 250 | consensus Predicted molecular chaperone (DnaJ supe | 96.57 | |
| KOG2072 | 988 | consensus Translation initiation factor 3, subunit | 96.43 | |
| PRK01356 | 166 | hscB co-chaperone HscB; Provisional | 96.39 | |
| KOG0718 | 546 | consensus Molecular chaperone (DnaJ superfamily) [ | 96.38 | |
| PRK00294 | 173 | hscB co-chaperone HscB; Provisional | 96.31 | |
| PHA03102 | 153 | Small T antigen; Reviewed | 96.05 | |
| KOG0713 | 336 | consensus Molecular chaperone (DnaJ superfamily) [ | 95.79 | |
| KOG0163 | 1259 | consensus Myosin class VI heavy chain [Cytoskeleto | 95.74 | |
| PRK10266 | 306 | curved DNA-binding protein CbpA; Provisional | 95.7 | |
| KOG4661 | 940 | consensus Hsp27-ERE-TATA-binding protein/Scaffold | 95.7 | |
| PRK14299 | 291 | chaperone protein DnaJ; Provisional | 95.61 | |
| KOG0163 | 1259 | consensus Myosin class VI heavy chain [Cytoskeleto | 95.5 | |
| KOG2891 | 445 | consensus Surface glycoprotein [General function p | 95.48 | |
| COG0484 | 371 | DnaJ DnaJ-class molecular chaperone with C-termina | 95.37 | |
| PRK14281 | 397 | chaperone protein DnaJ; Provisional | 95.3 | |
| PRK10767 | 371 | chaperone protein DnaJ; Provisional | 95.23 | |
| PRK14295 | 389 | chaperone protein DnaJ; Provisional | 95.2 | |
| PRK14280 | 376 | chaperone protein DnaJ; Provisional | 95.04 | |
| PRK14284 | 391 | chaperone protein DnaJ; Provisional | 94.92 | |
| PTZ00100 | 116 | DnaJ chaperone protein; Provisional | 94.88 | |
| PRK14276 | 380 | chaperone protein DnaJ; Provisional | 94.88 | |
| PRK14277 | 386 | chaperone protein DnaJ; Provisional | 94.87 | |
| PRK14278 | 378 | chaperone protein DnaJ; Provisional | 94.86 | |
| PRK14293 | 374 | chaperone protein DnaJ; Provisional | 94.85 | |
| KOG0716 | 279 | consensus Molecular chaperone (DnaJ superfamily) [ | 94.76 | |
| KOG1144 | 1064 | consensus Translation initiation factor 5B (eIF-5B | 94.76 | |
| PRK14285 | 365 | chaperone protein DnaJ; Provisional | 94.73 | |
| PRK14300 | 372 | chaperone protein DnaJ; Provisional | 94.72 | |
| PRK14283 | 378 | chaperone protein DnaJ; Provisional | 94.71 | |
| PRK14297 | 380 | chaperone protein DnaJ; Provisional | 94.69 | |
| KOG0691 | 296 | consensus Molecular chaperone (DnaJ superfamily) [ | 94.52 | |
| TIGR02349 | 354 | DnaJ_bact chaperone protein DnaJ. This model repre | 94.51 | |
| PRK14288 | 369 | chaperone protein DnaJ; Provisional | 94.47 | |
| PRK14290 | 365 | chaperone protein DnaJ; Provisional | 94.47 | |
| PRK14296 | 372 | chaperone protein DnaJ; Provisional | 94.43 | |
| PTZ00037 | 421 | DnaJ_C chaperone protein; Provisional | 94.39 | |
| PRK14279 | 392 | chaperone protein DnaJ; Provisional | 94.28 | |
| PRK14301 | 373 | chaperone protein DnaJ; Provisional | 94.21 | |
| PRK14282 | 369 | chaperone protein DnaJ; Provisional | 94.21 | |
| PRK14291 | 382 | chaperone protein DnaJ; Provisional | 94.16 | |
| PRK14292 | 371 | chaperone protein DnaJ; Provisional | 94.14 | |
| PRK14286 | 372 | chaperone protein DnaJ; Provisional | 94.05 | |
| PRK14294 | 366 | chaperone protein DnaJ; Provisional | 94.01 | |
| PTZ00341 | 1136 | Ring-infected erythrocyte surface antigen; Provisi | 93.96 | |
| KOG0720 | 490 | consensus Molecular chaperone (DnaJ superfamily) [ | 93.9 | |
| PRK14298 | 377 | chaperone protein DnaJ; Provisional | 93.85 | |
| PRK14287 | 371 | chaperone protein DnaJ; Provisional | 93.56 | |
| PRK01773 | 173 | hscB co-chaperone HscB; Provisional | 93.35 | |
| PF12037 | 276 | DUF3523: Domain of unknown function (DUF3523); Int | 93.25 | |
| KOG4661 | 940 | consensus Hsp27-ERE-TATA-binding protein/Scaffold | 93.18 | |
| KOG0719 | 264 | consensus Molecular chaperone (DnaJ superfamily) [ | 93.1 | |
| KOG0742 | 630 | consensus AAA+-type ATPase [Posttranslational modi | 92.98 | |
| KOG0712 | 337 | consensus Molecular chaperone (DnaJ superfamily) [ | 92.89 | |
| COG2214 | 237 | CbpA DnaJ-class molecular chaperone [Posttranslati | 92.85 | |
| PRK14289 | 386 | chaperone protein DnaJ; Provisional | 92.73 | |
| PRK07735 | 430 | NADH dehydrogenase subunit C; Validated | 92.71 | |
| KOG0721 | 230 | consensus Molecular chaperone (DnaJ superfamily) [ | 92.7 | |
| KOG2891 | 445 | consensus Surface glycoprotein [General function p | 92.5 | |
| KOG0717 | 508 | consensus Molecular chaperone (DnaJ superfamily) [ | 92.43 | |
| KOG0550 | 486 | consensus Molecular chaperone (DnaJ superfamily) [ | 92.41 | |
| PHA02624 | 647 | large T antigen; Provisional | 92.22 | |
| KOG2412 | 591 | consensus Nuclear-export-signal (NES)-containing p | 89.82 | |
| TIGR03835 | 871 | termin_org_DnaJ terminal organelle assembly protei | 89.36 | |
| KOG2412 | 591 | consensus Nuclear-export-signal (NES)-containing p | 89.22 | |
| PF02029 | 492 | Caldesmon: Caldesmon; InterPro: IPR006018 This gro | 89.18 | |
| COG5407 | 610 | SEC63 Preprotein translocase subunit Sec63 [Intrac | 89.11 | |
| KOG3054 | 299 | consensus Uncharacterized conserved protein [Funct | 87.13 | |
| TIGR03319 | 514 | YmdA_YtgF conserved hypothetical protein YmdA/YtgF | 85.23 | |
| KOG3054 | 299 | consensus Uncharacterized conserved protein [Funct | 84.62 | |
| KOG0624 | 504 | consensus dsRNA-activated protein kinase inhibitor | 82.33 | |
| PRK00106 | 535 | hypothetical protein; Provisional | 82.06 | |
| KOG0715 | 288 | consensus Molecular chaperone (DnaJ superfamily) [ | 81.4 | |
| PRK12704 | 520 | phosphodiesterase; Provisional | 80.94 | |
| KOG0742 | 630 | consensus AAA+-type ATPase [Posttranslational modi | 80.92 |
| >KOG0431 consensus Auxilin-like protein and related proteins containing DnaJ domain [General function prediction only] | Back alignment and domain information |
|---|
Probab=100.00 E-value=6.1e-40 Score=375.05 Aligned_cols=224 Identities=43% Similarity=0.595 Sum_probs=175.9
Q ss_pred hhccccccccccCCCCCCCCCCCCCCCCCCccCCCCCCCCCCCc-------cCCCCCCC-cccccCCCcccccchhhhhc
Q 002109 686 QKNDNDLESFFSMSSRPSSAPRPRANTSDSLFDSQSKGGPEPAR-------RTSVGASS-NMRKASSTTNIVDDLSSIFG 757 (965)
Q Consensus 686 ~~~~~dlesfFs~~Sr~sSaPrsr~~s~ds~fdsq~q~~~~~~~-------r~sss~S~-s~rkasSs~ni~DDlss~Fg 757 (965)
....+.|++++....+.++++..+.+.++.|.+...-+..+... ...++... +...+...++.......+|+
T Consensus 195 ~~~~~~~~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~~~~~~~~s~~~~~~~~~~~~~~~~~~~~ 274 (453)
T KOG0431|consen 195 QATAPKADSFFNSTSRGASAPADPFADLDDLSSGSNASKSGSSSDLSSRVSPGITETTDSPPSKTSSPPNQQKKSPPDFQ 274 (453)
T ss_pred cCCCccccccccccccCCCCCCCccccccchhhhcccCCCCCcccccCCCCCCCCCCCCCchhhhcccccchhccchhhh
Confidence 45666788899888888888887777766654443333222111 11111111 13344444455555444444
Q ss_pred cCCC-------------CCC------ccccccCChHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHH----HH
Q 002109 758 AAGS-------------SAG------EFQDVEGETEERRRARLERHQRTQERAAKALAEKNERDLQAQRDQAER----HR 814 (965)
Q Consensus 758 ~~~~-------------s~~------~f~~~~~e~~~rr~a~~~r~~~~~~r~~k~l~ek~~r~~~~~~eq~e~----~~ 814 (965)
..+- -.. .+..+-|+..+++..+..++..+..+....+.++..+|++..++++++ .+
T Consensus 275 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~k~~~~~ae~~~e~~r 354 (453)
T KOG0431|consen 275 AKPSSESPEASTQKRPNYAQKRSDVPPGNTERGKRAESSSTRTKKQMDTFSDLLNPQGFKSTSDEKRPREIAEMRKELSR 354 (453)
T ss_pred cccCccchhhccccccchhccCCCCCcccccccccccccccccchhhhhhhhhhccccccchhhhhhHHHHHHHHHHHHh
Confidence 4310 011 122345778888999999999999999999999999999999999999 89
Q ss_pred hHHhHHHHHHHHhccccccHHHHhhccccccCCCCCCccCcccccchhhhHhHHhhhccccccCccccccCCCHHHHHHH
Q 002109 815 IAETLDVEIKRWAAGKEGNIRALLATMQYVLWPESGWQPVSLTDLITAAAVKKCYRKATLCIHPDKVQQKGANLQQKYIA 894 (965)
Q Consensus 815 l~d~~~~ki~~W~~gke~nIRaLLssL~~VLW~~~~W~~v~~~dl~~~~~VKk~YrKA~l~vHPDK~~~~~~~~eqk~iA 894 (965)
|+|+|+.+|+.|..||++|||+||+|||||||++|||++|+|.|||+|++|||+|||||||||||||+|+|++++|||||
T Consensus 355 ~~e~~d~~I~~W~~GKE~NIRALLSTLh~VLW~es~WqpVsltDLVtp~~VKKaYrKA~L~VHPDKlqq~gas~~qK~Ia 434 (453)
T KOG0431|consen 355 LMEPLDEEIRRWSEGKEGNIRALLSTLHYVLWPESGWQPVSLTDLVTPAQVKKAYRKAVLCVHPDKLQQKGASLEQKYIA 434 (453)
T ss_pred hcchHHHHHHHhcccccccHHHHHHHHhHhhcCccCcccCchhhccCHHHHHHHHHhhhheeCcccccCCcccHHHHHHH
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHHHHHHhh
Q 002109 895 EKVFDLLKVQQIYCR 909 (965)
Q Consensus 895 ~~vF~~Ln~a~~~~r 909 (965)
+.||++|++||+.|.
T Consensus 435 ekvfd~l~eawn~f~ 449 (453)
T KOG0431|consen 435 EKVFDALSEAWNKFN 449 (453)
T ss_pred HHHHHHHHHHHHhhh
Confidence 999999999999986
|
|
| >PRK09510 tolA cell envelope integrity inner membrane protein TolA; Provisional | Back alignment and domain information |
|---|
| >PTZ00121 MAEBL; Provisional | Back alignment and domain information |
|---|
| >COG3064 TolA Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PRK09510 tolA cell envelope integrity inner membrane protein TolA; Provisional | Back alignment and domain information |
|---|
| >TIGR02794 tolA_full TolA protein | Back alignment and domain information |
|---|
| >COG3064 TolA Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >TIGR02794 tolA_full TolA protein | Back alignment and domain information |
|---|
| >PTZ00266 NIMA-related protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >smart00271 DnaJ DnaJ molecular chaperone homology domain | Back alignment and domain information |
|---|
| >cd06257 DnaJ DnaJ domain or J-domain | Back alignment and domain information |
|---|
| >KOG2072 consensus Translation initiation factor 3, subunit a (eIF-3a) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF00226 DnaJ: DnaJ domain; InterPro: IPR001623 The prokaryotic heat shock protein DnaJ interacts with the chaperone hsp70-like DnaK protein [] | Back alignment and domain information |
|---|
| >PRK09430 djlA Dna-J like membrane chaperone protein; Provisional | Back alignment and domain information |
|---|
| >KOG4364 consensus Chromatin assembly factor-I [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG4364 consensus Chromatin assembly factor-I [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PRK03578 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >TIGR00714 hscB Fe-S protein assembly co-chaperone HscB | Back alignment and domain information |
|---|
| >PRK05014 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >KOG1150 consensus Predicted molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2072 consensus Translation initiation factor 3, subunit a (eIF-3a) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK01356 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >KOG0718 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK00294 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >PHA03102 Small T antigen; Reviewed | Back alignment and domain information |
|---|
| >KOG0713 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0163 consensus Myosin class VI heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK10266 curved DNA-binding protein CbpA; Provisional | Back alignment and domain information |
|---|
| >KOG4661 consensus Hsp27-ERE-TATA-binding protein/Scaffold attachment factor (SAF-B) [Transcription] | Back alignment and domain information |
|---|
| >PRK14299 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >KOG0163 consensus Myosin class VI heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG2891 consensus Surface glycoprotein [General function prediction only] | Back alignment and domain information |
|---|
| >COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14281 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK10767 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14295 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14280 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14284 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PTZ00100 DnaJ chaperone protein; Provisional | Back alignment and domain information |
|---|
| >PRK14276 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14277 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14278 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14293 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >KOG0716 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1144 consensus Translation initiation factor 5B (eIF-5B) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK14285 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14300 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14283 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14297 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >KOG0691 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02349 DnaJ_bact chaperone protein DnaJ | Back alignment and domain information |
|---|
| >PRK14288 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14290 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14296 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PTZ00037 DnaJ_C chaperone protein; Provisional | Back alignment and domain information |
|---|
| >PRK14279 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14301 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14282 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14291 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14292 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14286 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14294 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PTZ00341 Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >KOG0720 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14298 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14287 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK01773 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >PF12037 DUF3523: Domain of unknown function (DUF3523); InterPro: IPR021911 This presumed domain is functionally uncharacterised | Back alignment and domain information |
|---|
| >KOG4661 consensus Hsp27-ERE-TATA-binding protein/Scaffold attachment factor (SAF-B) [Transcription] | Back alignment and domain information |
|---|
| >KOG0719 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0712 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG2214 CbpA DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14289 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK07735 NADH dehydrogenase subunit C; Validated | Back alignment and domain information |
|---|
| >KOG0721 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2891 consensus Surface glycoprotein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0717 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PHA02624 large T antigen; Provisional | Back alignment and domain information |
|---|
| >KOG2412 consensus Nuclear-export-signal (NES)-containing protein/polyadenylated-RNA export factor [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR03835 termin_org_DnaJ terminal organelle assembly protein TopJ | Back alignment and domain information |
|---|
| >KOG2412 consensus Nuclear-export-signal (NES)-containing protein/polyadenylated-RNA export factor [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF02029 Caldesmon: Caldesmon; InterPro: IPR006018 This group of proteins includes two protein families: caldesmon and lymphocyte specific protein | Back alignment and domain information |
|---|
| >COG5407 SEC63 Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >KOG3054 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF | Back alignment and domain information |
|---|
| >KOG3054 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK00106 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0715 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK12704 phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 965 | ||||
| 3ag7_A | 106 | An Auxilin-Like J-Domain Containing Protein, Jac1 J | 3e-26 | ||
| 1n4c_A | 182 | Nmr Structure Of The J-Domain And Clathrin Substrat | 3e-15 | ||
| 1xi5_J | 114 | Clathrin D6 Coat With Auxilin J-Domain Length = 114 | 7e-14 | ||
| 2qwn_B | 94 | Crystal Structure Of Disulfide-Bond-Crosslinked Com | 6e-13 | ||
| 2qwo_B | 92 | Crystal Structure Of Disulfide-Bond-Crosslinked Com | 8e-13 | ||
| 1nz6_A | 101 | Crystal Structure Of Auxilin J-Domain Length = 101 | 3e-12 |
| >pdb|3AG7|A Chain A, An Auxilin-Like J-Domain Containing Protein, Jac1 J-Domain Length = 106 | Back alignment and structure |
|
| >pdb|1N4C|A Chain A, Nmr Structure Of The J-Domain And Clathrin Substrate Binding Domain Of Bovine Auxilin Length = 182 | Back alignment and structure |
| >pdb|1XI5|J Chain J, Clathrin D6 Coat With Auxilin J-Domain Length = 114 | Back alignment and structure |
| >pdb|2QWN|B Chain B, Crystal Structure Of Disulfide-Bond-Crosslinked Complex Of Bovine Hsc70 (1-386aa)r171c And Bovine Auxilin (810-910aa)d876c In The AdpPi State Length = 94 | Back alignment and structure |
| >pdb|2QWO|B Chain B, Crystal Structure Of Disulfide-Bond-Crosslinked Complex Of Bovine Hsc70 (1-394aa)r171c And Bovine Auxilin (810-910aa)d876c In The AdpPi Form #1 Length = 92 | Back alignment and structure |
| >pdb|1NZ6|A Chain A, Crystal Structure Of Auxilin J-Domain Length = 101 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 965 | |||
| 3ag7_A | 106 | Putative uncharacterized protein F9E10.5; J-domain | 1e-34 | |
| 1n4c_A | 182 | Auxilin; four helix bundle, protein binding; NMR { | 3e-31 | |
| 2qwo_B | 92 | Putative tyrosine-protein phosphatase auxilin; cha | 5e-29 | |
| 2zuo_A | 861 | MVP, major vault protein; repeat domains, protein- | 2e-21 | |
| 2zuo_A | 861 | MVP, major vault protein; repeat domains, protein- | 5e-19 | |
| 2zuo_A | 861 | MVP, major vault protein; repeat domains, protein- | 4e-17 | |
| 2zuo_A | 861 | MVP, major vault protein; repeat domains, protein- | 2e-13 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 8e-16 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 3e-15 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 3e-12 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 1e-11 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 5e-10 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 6e-08 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 6e-06 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 1e-04 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 1e-12 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 3e-10 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 1e-04 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-11 | |
| 2ycu_A | 995 | Non muscle myosin 2C, alpha-actinin; motor protein | 3e-10 | |
| 3lvg_D | 190 | LCB, clathrin light chain B; SELF assembly, coated | 1e-08 | |
| 3lvg_D | 190 | LCB, clathrin light chain B; SELF assembly, coated | 1e-08 | |
| 3lvg_D | 190 | LCB, clathrin light chain B; SELF assembly, coated | 5e-08 | |
| 3lvg_D | 190 | LCB, clathrin light chain B; SELF assembly, coated | 2e-07 | |
| 3lvg_D | 190 | LCB, clathrin light chain B; SELF assembly, coated | 4e-05 | |
| 3lvg_D | 190 | LCB, clathrin light chain B; SELF assembly, coated | 2e-04 | |
| 3lvg_D | 190 | LCB, clathrin light chain B; SELF assembly, coated | 2e-04 | |
| 3lvg_D | 190 | LCB, clathrin light chain B; SELF assembly, coated | 5e-04 | |
| 1cii_A | 602 | Colicin IA; bacteriocin, ION channel formation, tr | 5e-07 | |
| 1g8x_A | 1010 | Myosin II heavy chain fused to alpha-actinin 3; mo | 1e-06 | |
| 2es4_D | 332 | Lipase chaperone; protein-protein complex, steric | 1e-05 | |
| 1f5n_A | 592 | Interferon-induced guanylate-binding protein 1; GB | 2e-05 | |
| 1f5n_A | 592 | Interferon-induced guanylate-binding protein 1; GB | 2e-04 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 3e-05 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 6e-05 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 1e-04 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 2e-04 | |
| 2dg7_A | 195 | Putative transcriptional regulator; helix-turn-hel | 3e-05 | |
| 1jad_A | 251 | PLC-beta, phospholipase C beta; alpha helical coil | 4e-05 | |
| 3iyk_A | 526 | VP5; icosahedral virus; HET: MNA; 7.00A {Bluetongu | 4e-05 | |
| 3iyk_A | 526 | VP5; icosahedral virus; HET: MNA; 7.00A {Bluetongu | 5e-05 | |
| 3iyk_A | 526 | VP5; icosahedral virus; HET: MNA; 7.00A {Bluetongu | 1e-04 | |
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 1e-04 | |
| 1w1w_A | 430 | Structural maintenance of chromosome 1; cohesin, c | 1e-04 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 1e-04 | |
| 4f61_I | 240 | Stathmin-like domain R4; alpha-tubulin, beta-tubul | 1e-04 | |
| 4f61_I | 240 | Stathmin-like domain R4; alpha-tubulin, beta-tubul | 5e-04 | |
| 2rae_A | 207 | Transcriptional regulator, ACRR family protein; TE | 2e-04 | |
| 3dmq_A | 968 | RNA polymerase-associated protein RAPA; SWF2/SNF2, | 3e-04 | |
| 2qag_C | 418 | Septin-7; cell cycle, cell division, GTP-binding, | 4e-04 | |
| 2dg6_A | 222 | Putative transcriptional regulator; winged-helix m | 7e-04 | |
| 2dm9_A | 198 | V-type ATP synthase subunit E; A-ATPase, structura | 8e-04 |
| >3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Length = 106 | Back alignment and structure |
|---|
Score = 127 bits (319), Expect = 1e-34
Identities = 49/91 (53%), Positives = 71/91 (78%)
Query: 812 RHRIAETLDVEIKRWAAGKEGNIRALLATMQYVLWPESGWQPVSLTDLITAAAVKKCYRK 871
+ +D +I++W++GK GNIR+LL+T+QY+LW SGW+PV L D+I AV+K Y++
Sbjct: 4 GSEEIKNIDAKIRKWSSGKSGNIRSLLSTLQYILWSGSGWKPVPLMDMIEGNAVRKSYQR 63
Query: 872 ATLCIHPDKVQQKGANLQQKYIAEKVFDLLK 902
A L +HPDK+QQKGA+ QKY+AEKVF+LL+
Sbjct: 64 ALLILHPDKLQQKGASANQKYMAEKVFELLQ 94
|
| >1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Length = 182 | Back alignment and structure |
|---|
| >2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Length = 92 | Back alignment and structure |
|---|
| >2zuo_A MVP, major vault protein; repeat domains, protein-protein complex, cytoplasm, ribonucleoprotein, structural protein; 3.50A {Rattus norvegicus} PDB: 2zv4_N 2zv5_a 2qzv_A Length = 861 | Back alignment and structure |
|---|
| >2zuo_A MVP, major vault protein; repeat domains, protein-protein complex, cytoplasm, ribonucleoprotein, structural protein; 3.50A {Rattus norvegicus} PDB: 2zv4_N 2zv5_a 2qzv_A Length = 861 | Back alignment and structure |
|---|
| >2zuo_A MVP, major vault protein; repeat domains, protein-protein complex, cytoplasm, ribonucleoprotein, structural protein; 3.50A {Rattus norvegicus} PDB: 2zv4_N 2zv5_a 2qzv_A Length = 861 | Back alignment and structure |
|---|
| >2zuo_A MVP, major vault protein; repeat domains, protein-protein complex, cytoplasm, ribonucleoprotein, structural protein; 3.50A {Rattus norvegicus} PDB: 2zv4_N 2zv5_a 2qzv_A Length = 861 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2ycu_A Non muscle myosin 2C, alpha-actinin; motor protein; HET: AOV; 2.25A {Homo sapiens} PDB: 1br1_A* 1br4_A* 1br2_A* Length = 995 | Back alignment and structure |
|---|
| >3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 | Back alignment and structure |
|---|
| >3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 | Back alignment and structure |
|---|
| >3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 | Back alignment and structure |
|---|
| >3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 | Back alignment and structure |
|---|
| >3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 | Back alignment and structure |
|---|
| >3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 | Back alignment and structure |
|---|
| >3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 | Back alignment and structure |
|---|
| >3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 | Back alignment and structure |
|---|
| >1cii_A Colicin IA; bacteriocin, ION channel formation, transmembrane protein; 3.00A {Escherichia coli} SCOP: f.1.1.1 h.4.3.1 Length = 602 | Back alignment and structure |
|---|
| >1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 | Back alignment and structure |
|---|
| >2es4_D Lipase chaperone; protein-protein complex, steric chaperone, triacylglycerol hydrolase, all alpha helix protein, A/B hydrolase fold; 1.85A {Burkholderia glumae} SCOP: a.137.15.1 Length = 332 | Back alignment and structure |
|---|
| >1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Length = 592 | Back alignment and structure |
|---|
| >1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Length = 592 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >2dg7_A Putative transcriptional regulator; helix-turn-helix motif, TETR family, gene regulation; 2.30A {Streptomyces coelicolor} Length = 195 | Back alignment and structure |
|---|
| >1jad_A PLC-beta, phospholipase C beta; alpha helical coiled coil, hydrolase; 2.40A {Meleagris gallopavo} SCOP: h.4.10.1 Length = 251 | Back alignment and structure |
|---|
| >3iyk_A VP5; icosahedral virus; HET: MNA; 7.00A {Bluetongue virus} Length = 526 | Back alignment and structure |
|---|
| >3iyk_A VP5; icosahedral virus; HET: MNA; 7.00A {Bluetongue virus} Length = 526 | Back alignment and structure |
|---|
| >3iyk_A VP5; icosahedral virus; HET: MNA; 7.00A {Bluetongue virus} Length = 526 | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Length = 256 | Back alignment and structure |
|---|
| >1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 Length = 430 | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Length = 681 | Back alignment and structure |
|---|
| >4f61_I Stathmin-like domain R4; alpha-tubulin, beta-tubulin, GTPase, microtubule, RB3, stath tubulin, cell cycle; HET: GTP GDP; 4.17A {Artificial gene} Length = 240 | Back alignment and structure |
|---|
| >4f61_I Stathmin-like domain R4; alpha-tubulin, beta-tubulin, GTPase, microtubule, RB3, stath tubulin, cell cycle; HET: GTP GDP; 4.17A {Artificial gene} Length = 240 | Back alignment and structure |
|---|
| >2rae_A Transcriptional regulator, ACRR family protein; TETR/ACRR family transcriptional regulator, structural genom 2, RHA08332, MCSG; 2.20A {Rhodococcus SP} Length = 207 | Back alignment and structure |
|---|
| >3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Length = 968 | Back alignment and structure |
|---|
| >2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Length = 418 | Back alignment and structure |
|---|
| >2dg6_A Putative transcriptional regulator; winged-helix motif, MERR family, gene regulation; 2.20A {Streptomyces coelicolor} Length = 222 | Back alignment and structure |
|---|
| >2dm9_A V-type ATP synthase subunit E; A-ATPase, structural genomics, NPPSFA, national project on P structural and functional analyses; 1.85A {Pyrococcus horikoshii} SCOP: d.81.4.1 PDB: 2dma_A 4dt0_A Length = 198 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 965 | |||
| 2qwo_B | 92 | Putative tyrosine-protein phosphatase auxilin; cha | 99.83 | |
| 3ag7_A | 106 | Putative uncharacterized protein F9E10.5; J-domain | 99.77 | |
| 1n4c_A | 182 | Auxilin; four helix bundle, protein binding; NMR { | 99.73 | |
| 1wjz_A | 94 | 1700030A21RIK protein; J-domain, DNAJ like protein | 97.76 | |
| 2ys8_A | 90 | RAB-related GTP-binding protein RABJ; DNAJ domain, | 97.49 | |
| 1iur_A | 88 | KIAA0730 protein; DNAJ like domain, riken structur | 97.44 | |
| 2ej7_A | 82 | HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati | 97.35 | |
| 1hdj_A | 77 | Human HSP40, HDJ-1; molecular chaperone; NMR {Homo | 97.25 | |
| 2dmx_A | 92 | DNAJ homolog subfamily B member 8; DNAJ J domain, | 97.24 | |
| 3hho_A | 174 | CO-chaperone protein HSCB homolog; structural geno | 97.23 | |
| 2cug_A | 88 | Mkiaa0962 protein; DNAJ-like domain, structural ge | 97.2 | |
| 2yua_A | 99 | Williams-beuren syndrome chromosome region 18 prot | 97.18 | |
| 1fpo_A | 171 | HSC20, chaperone protein HSCB; molecular chaperone | 97.18 | |
| 2ctr_A | 88 | DNAJ homolog subfamily B member 9; J-domain, chape | 97.13 | |
| 2ctp_A | 78 | DNAJ homolog subfamily B member 12; J-domain, chap | 97.12 | |
| 2qsa_A | 109 | DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s | 97.07 | |
| 3bvo_A | 207 | CO-chaperone protein HSCB, mitochondrial precurso; | 97.01 | |
| 2lgw_A | 99 | DNAJ homolog subfamily B member 2; J domain, HSJ1A | 96.98 | |
| 1bq0_A | 103 | DNAJ, HSP40; chaperone, heat shock, protein foldin | 96.97 | |
| 2l6l_A | 155 | DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, | 96.97 | |
| 2ctw_A | 109 | DNAJ homolog subfamily C member 5; J-domain, chape | 96.89 | |
| 2guz_A | 71 | Mitochondrial import inner membrane translocase su | 96.86 | |
| 2och_A | 73 | Hypothetical protein DNJ-12; HSP40, J-domain, chap | 96.82 | |
| 2dn9_A | 79 | DNAJ homolog subfamily A member 3; J-domain, TID1, | 96.82 | |
| 2ctq_A | 112 | DNAJ homolog subfamily C member 12; J-domain, chap | 96.66 | |
| 1gh6_A | 114 | Large T antigen; tumor suppressor, oncoprotein, an | 96.27 | |
| 2o37_A | 92 | Protein SIS1; HSP40, J-domain, cochaperone, APC900 | 96.25 | |
| 1faf_A | 79 | Large T antigen; J domain, HPD motif, anti-paralle | 96.19 | |
| 3uo3_A | 181 | J-type CO-chaperone JAC1, mitochondrial; structura | 95.53 | |
| 3apq_A | 210 | DNAJ homolog subfamily C member 10; thioredoxin fo | 94.83 | |
| 3lz8_A | 329 | Putative chaperone DNAJ; structure genomics, struc | 94.25 | |
| 2guz_B | 65 | Mitochondrial import inner membrane translocase su | 93.65 | |
| 2i1j_A | 575 | Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, | 93.34 | |
| 2i1j_A | 575 | Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, | 92.88 | |
| 2pf4_E | 174 | Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, | 92.01 | |
| 3apo_A | 780 | DNAJ homolog subfamily C member 10; PDI family, th | 86.05 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 85.83 |
| >2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A | Back alignment and structure |
|---|
Probab=99.83 E-value=2.7e-21 Score=177.20 Aligned_cols=89 Identities=40% Similarity=0.649 Sum_probs=82.5
Q ss_pred HhHHHHHHHHhccccccHHHHhhccccccCCC-CCCccCcccccchhhhHhHHhhhccccccCccccccCCCHHHHHHHH
Q 002109 817 ETLDVEIKRWAAGKEGNIRALLATMQYVLWPE-SGWQPVSLTDLITAAAVKKCYRKATLCIHPDKVQQKGANLQQKYIAE 895 (965)
Q Consensus 817 d~~~~ki~~W~~gke~nIRaLLssL~~VLW~~-~~W~~v~~~dl~~~~~VKk~YrKA~l~vHPDK~~~~~~~~eqk~iA~ 895 (965)
|.|+.+|+.|+.||++|||+||+|||.|||++ +.|+.+++..+.++..||++|||+++.+||||++. . +++++|+
T Consensus 1 ~~i~~~i~~W~~gk~~~ir~lL~~l~~~L~~~~~~y~~Lgv~~~as~~eIKkAYRklal~~HPDK~~~--~--~~~~~A~ 76 (92)
T 2qwo_B 1 DPEKLKILEWIEGKERNIRALLSTMHTVLWAGETKWKPVGMADLVTPEQVKKVYRKAVLVVHPCKATG--Q--PYEQYAK 76 (92)
T ss_dssp CHHHHHHHHHHHHHTTCHHHHHHHGGGTSCTTCCSCCCCCGGGSSSHHHHHHHHHHHHHHTCHHHHTT--S--TTHHHHH
T ss_pred ChHHHHHHHHHccChhHHHHHHHHHHHHhcccccCCeecCCCCCCCHHHHHHHHHHHHHHHCcCCCCC--c--hhHhHHH
Confidence 57999999999999999999999999999995 99999999999999999999999999999999974 2 2346999
Q ss_pred HHHHHHHHHHHHhh
Q 002109 896 KVFDLLKVQQIYCR 909 (965)
Q Consensus 896 ~vF~~Ln~a~~~~r 909 (965)
.+|..|++||++++
T Consensus 77 ~~F~~i~eAyevL~ 90 (92)
T 2qwo_B 77 MIFMELNDAWSEFE 90 (92)
T ss_dssp HHHHHHHHHHHHHH
T ss_pred HHHHHHHHHHHHHH
Confidence 99999999999875
|
| >3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J | Back alignment and structure |
|---|
| >1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 | Back alignment and structure |
|---|
| >2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A | Back alignment and structure |
|---|
| >2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A | Back alignment and structure |
|---|
| >2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A | Back alignment and structure |
|---|
| >3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} | Back alignment and structure |
|---|
| >3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A | Back alignment and structure |
|---|
| >2guz_B Mitochondrial import inner membrane translocase subunit TIM16; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2i1j_A Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, ezrin, MER actin binding, masking, regulation, SELF-inhibition, cell A membrane protein; 2.10A {Spodoptera frugiperda} PDB: 2i1k_A 1e5w_A | Back alignment and structure |
|---|
| >2i1j_A Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, ezrin, MER actin binding, masking, regulation, SELF-inhibition, cell A membrane protein; 2.10A {Spodoptera frugiperda} PDB: 2i1k_A 1e5w_A | Back alignment and structure |
|---|
| >2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C | Back alignment and structure |
|---|
| >3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 965 | ||||
| d1nz6a_ | 98 | a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [T | 4e-19 | |
| d2es4d1 | 280 | a.137.15.1 (D:53-332) Lipase chaperone LifO (LipB) | 3e-10 | |
| d1f5na1 | 300 | a.114.1.1 (A:284-583) Interferon-induced guanylate | 6e-07 | |
| d1f5na1 | 300 | a.114.1.1 (A:284-583) Interferon-induced guanylate | 3e-06 | |
| d1f5na1 | 300 | a.114.1.1 (A:284-583) Interferon-induced guanylate | 5e-05 | |
| d1f5na1 | 300 | a.114.1.1 (A:284-583) Interferon-induced guanylate | 5e-05 | |
| d1f5na1 | 300 | a.114.1.1 (A:284-583) Interferon-induced guanylate | 2e-04 | |
| d1sa0e_ | 138 | a.137.10.1 (E:) Stathmin 4 {Rat (Rattus norvegicus | 5e-04 | |
| d1sa0e_ | 138 | a.137.10.1 (E:) Stathmin 4 {Rat (Rattus norvegicus | 6e-04 | |
| d1sa0e_ | 138 | a.137.10.1 (E:) Stathmin 4 {Rat (Rattus norvegicus | 0.001 |
| >d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Length = 98 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Long alpha-hairpin superfamily: Chaperone J-domain family: Chaperone J-domain domain: Auxilin J-domain species: Cow (Bos taurus) [TaxId: 9913]
Score = 81.1 bits (200), Expect = 4e-19
Identities = 35/63 (55%), Positives = 43/63 (68%), Gaps = 1/63 (1%)
Query: 819 LDVEIKRWAAGKEGNIRALLATMQYVLWP-ESGWQPVSLTDLITAAAVKKCYRKATLCIH 877
++I W GKE NIRALL+TM VLW E+ W+PV + DL+T VKK YRKA L +H
Sbjct: 3 EKLKILEWIEGKERNIRALLSTMHTVLWAGETKWKPVGMADLVTPEQVKKVYRKAVLVVH 62
Query: 878 PDK 880
PDK
Sbjct: 63 PDK 65
|
| >d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 300 | Back information, alignment and structure |
|---|
| >d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 300 | Back information, alignment and structure |
|---|
| >d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 300 | Back information, alignment and structure |
|---|
| >d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 300 | Back information, alignment and structure |
|---|
| >d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 300 | Back information, alignment and structure |
|---|
| >d1sa0e_ a.137.10.1 (E:) Stathmin 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 138 | Back information, alignment and structure |
|---|
| >d1sa0e_ a.137.10.1 (E:) Stathmin 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 138 | Back information, alignment and structure |
|---|
| >d1sa0e_ a.137.10.1 (E:) Stathmin 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 138 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 965 | |||
| d1nz6a_ | 98 | Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} | 99.8 | |
| d1wjza_ | 94 | CSL-type zinc finger-containing protein 3 (J-domai | 97.83 | |
| d1fpoa1 | 76 | HSC20 (HSCB), N-terminal (J) domain {Escherichia c | 97.81 | |
| d1iura_ | 88 | Hypothetical protein KIAA0730 {Human (Homo sapiens | 97.34 | |
| d1xbla_ | 75 | DnaJ chaperone, N-terminal (J) domain {Escherichia | 97.29 | |
| d1fafa_ | 79 | Large T antigen, the N-terminal J domain {Murine p | 97.01 | |
| d1hdja_ | 77 | HSP40 {Human (Homo sapiens) [TaxId: 9606]} | 96.19 | |
| d1gh6a_ | 114 | Large T antigen, the N-terminal J domain {Simian v | 96.16 |
| >d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Long alpha-hairpin superfamily: Chaperone J-domain family: Chaperone J-domain domain: Auxilin J-domain species: Cow (Bos taurus) [TaxId: 9913]
Probab=99.80 E-value=2.2e-20 Score=170.77 Aligned_cols=90 Identities=41% Similarity=0.665 Sum_probs=82.1
Q ss_pred HhHHHHHHHHhccccccHHHHhhccccccCCC-CCCccCcccccchhhhHhHHhhhccccccCccccccCCCHHHHHHHH
Q 002109 817 ETLDVEIKRWAAGKEGNIRALLATMQYVLWPE-SGWQPVSLTDLITAAAVKKCYRKATLCIHPDKVQQKGANLQQKYIAE 895 (965)
Q Consensus 817 d~~~~ki~~W~~gke~nIRaLLssL~~VLW~~-~~W~~v~~~dl~~~~~VKk~YrKA~l~vHPDK~~~~~~~~eqk~iA~ 895 (965)
|.|+.+|..|+.|+++|||+||++|+.|||++ ..|++++|.+++++.+||++|+++++.+||||+... ....+|+
T Consensus 1 d~~~~~i~~W~~~~~~~ir~lL~~l~~vl~~~~~~y~~Lgl~~~~t~~eIk~aYr~l~~~~HPDk~~~~----~~~~~a~ 76 (98)
T d1nz6a_ 1 DPEKLKILEWIEGKERNIRALLSTMHTVLWAGETKWKPVGMADLVTPEQVKKVYRKAVLVVHPDKATGQ----PYEQYAK 76 (98)
T ss_dssp CHHHHHHHHHHTTTTTCHHHHHTTGGGTSCTTCCSCCCCCGGGCCSHHHHHHHHHHHHHHSCHHHHTTS----TTHHHHH
T ss_pred ChHHHHHHHHHhcchhhHHHHHHhhhhhcCCcccCCeecCCCccCCHHHHHHHHHHHHHHhccccCCCh----HHHHHHH
Confidence 57888999999999999999999999999985 789999999999999999999999999999998743 2356799
Q ss_pred HHHHHHHHHHHHhhh
Q 002109 896 KVFDLLKVQQIYCRF 910 (965)
Q Consensus 896 ~vF~~Ln~a~~~~r~ 910 (965)
.+|..||+||+.|+=
T Consensus 77 ~~f~~I~~Ay~~L~d 91 (98)
T d1nz6a_ 77 MIFMELNDAWSEFEN 91 (98)
T ss_dssp HHHHHHHHHHHHHHT
T ss_pred HHHHHHHHHHHHHCC
Confidence 999999999998863
|
| >d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} | Back information, alignment and structure |
|---|
| >d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} | Back information, alignment and structure |
|---|