Citrus Sinensis ID: 002164

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------96
MNQMVRGLHKVCHRGVSLLTPSSLSPPIFLCLKLGRVPGHLRTHSIKTTTAMTASRLHHLVPIHSVSSKNDGTNGSLSSSNAVATEDEDNLEGRYRLPPPEIREIVDAPPLPALSFSPQRDKILFLKRRALPPLEELARPEEKLAGLRIDGKCNTRSRMSFYTGIGIHQLFPDGKLGQEIEIQGFPDGAKLNFVTWSQDGKHLAFSIRIDAEDSSSSKLRVWVADVDTGKARPLFQSPDIYLNAIFDNFVWVNNSTLLVCTIPLLRGDPPKKPLVPLGPKMQSNEKRDIIQVRTFQDLLKDEYDEDLFDYYATTQLVLVSLDGTVKEIGPPAVYTSLDPSPDEKYILISSIHRPYSFIVPCGRFPRQVGVWTTDGIFVRELCDLPLAEDIPIAFNSVRKGMRSINWRSDKPSTLYWAETQDGGDAKVEVTPRDIIYTQQAEPVQGEGPEILHKLDLRYGGISWCDDSLALVYESWYKTRRTRTWVISPGSKDVAPRILFDRSSEDVYSDPGSPMMRRTSTGTYVIAKIKKENDEGTYILLNGNGATPEGNIPFLDLFDINTGSKERIWESDKEKYYETTVALMSDQTEGDLYLNQLKILTSKESKTENTQYYIQSWPDKKSCQITDFPHPYPQLASLQKELIKYQRKDGVQLSATLYLPPGYDPSKDGPLPCLFWSYPGEFKSKDAAGQVRGSPNEFPRIGSTSVLLWLARGFAILGGPTTPIIGEGDEEANDRFVEQLVACAEAAVEEVVRRGVAHPSKIAVGGHSYGAFMTANLLAHAPHLFCCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVEMSPFMSANKLKKPILLVHGEEDNNSGTLTMQSDRFFNALKGHGALCRLVILPFESHGYAARESIMHVLWETDRWLQKYCVSNTADRSTDLKVSKDDESKGAPHLQNKTVAASGGGGTEADFEHDGCHLAPRSSLCYCVD
cHHHHHHHHHHcccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccHHHHHHHcccccccEEEcccccEEEEEEccccccHHHHcccccccccEEEcccccccccccEEEcEEEEEcccccccccEEEEcccccccccccEEEcccccEEEEEEEEccccccccccEEEEEEcccccEEcccccccccccccccccEEEccccEEEEEEEcccccccccccccccccEEEcccccccccHHHHHHccccHHHHHHHHHcccEEEEEcccccEEEEccccccccccccccccEEEEEEccccccccccccccccEEEEEcccccEEEEccccccccccccccccccccccccEEcccccccEEEEEcccccccccccccccEEEEEEcccccccccEEEEEcccccccEEEcccccEEEEEEEcccccEEEEEEcccccccccEEEEcccccccccccccccEEEcccccEEEEEEEEccccccEEEEccccccccccccEEEEEEcccccEEEEEEccccccEEEEEEcccccccccccccccEEEEEEEccccccEEEEEEcccccEEEcccccccccccccccEEEEEEEcccccEEEEEEEcccccccccccccEEEEEEccccccccccccccccccccccccccHHHHHHHHcccEEEEccccccccccHHHHHcHHHHHHHHHHHHHHHHHHHccccccccEEEEcccHHHHHHHHHHHHccccEEEEEEccccccccccccccccccccccccHHHHHHcccccccccccccEEEEEccccccccccHHHHHHHHHHHHHccccEEEEEcccccccccccccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEc
ccHHHccHHHHHHHHHHHcccccccccccccccccccccccccccHHHHHHHHHHHHHHcccHHHccccccccccccccHHHccccHHHHcccccccccHHHHHHHcccccccEEEcccccEEEEEcccccccHHHHHcHHHHHccEEEcccccccccccccccEEEEEEccccccccccccccccccccccccEEcccccEEEEEEEEcccccccccEEEEEEEcccccccEcccccccccccccccEEEcccccEEEEEEcccccccccccccccccEEEccccccccccccHHHHHccHHHHHHHHHHHHHcEEEEcccccEEEccccccEccccccccccEEEEEEEEcccEEEEccccccccEEEEEccccEEEEHcccccHccccccccccccccccEEEccccccEEEEEEEccccccccEEcccccEEEEccccccccccEEEEccccccccEEEcccccEEEEEEccccccEEEEEEcccccccccEEEEEcccccccccccccEEEEcccccEEEEEEEEEcccccEEEEEcccccccccccEEEEEEcccccEEEEEEEcccccEEEEEEEccccccccccccccEEEEEEccccccccEEEEEcccccEEEEEccccccHHHcccccEEEEEEcccccEEEEEEEcccccccccccccEEEEEEEcccccccccccccccccccccccccccHHHHHHccEEEEcccccccccccccccccccHHHHHHHHHHHHHHHHHcccccHccEEEEcccHHHHHHHHHHHcccHHHHHEEEccccccccccccccccccccccccHHHHHHcccHHHHHcccccEEEEEccccccccccHHHHHHHHHHHHHccccEEEEEEccccccccccccHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccEEcccccccccccccccccccccHHEEEEcc
MNQMVRGLHKVChrgvslltpsslsppiflclklgrvpghlrthsiKTTTAMTAsrlhhlvpihsvsskndgtngslsssnavatedednlegryrlpppeireivdapplpalsfspqrDKILFLkrralppleelarpeEKLAglridgkcntrsrmsfytgigihqlfpdgklgqeieiqgfpdgaklnfvtwsqdgkhLAFSIRidaedssssklRVWVAdvdtgkarplfqspdiylnAIFDNFvwvnnstllvctipllrgdppkkplvplgpkmqsnekrdIIQVRTFQDLlkdeydedlfDYYATTQLVLVSLdgtvkeigppavytsldpspdekyILISSihrpysfivpcgrfprqvgvwttdgIFVRElcdlplaedipiaFNSVRKgmrsinwrsdkpstlywaetqdggdakvevtprdiiytqqaepvqgegpeilhkldlryggiswcdDSLALVYESWYKTrrtrtwvispgskdvaprilfdrssedvysdpgspmmrrtstGTYVIAKIKkendegtyillngngatpegnipfldlfdintgskeriwesdkeKYYETTVALMSDQTEGDLYLNQLKILtskeskteNTQYYIqswpdkkscqitdfphpypqLASLQKELIKYQRkdgvqlsatlylppgydpskdgplpclfwsypgefkskdaagqvrgspnefprigSTSVLLWLARGFailggpttpiigegdeEANDRFVEQLVACAEAAVEEVVRRgvahpskiavgghsygAFMTAnllahaphlfccgiarsgaynrtltpfgfqnedrTLWEATSTYvemspfmsanklkkpillvhgeednnsgtltmQSDRFFNALKGHGALCRLvilpfeshgyaARESIMHVLWETDRWLQKYCVsntadrstdlkvskddeskgaphlqnktvaasggggteadfehdgchlaprsslcycvd
MNQMVRGLHKVCHRGVSlltpsslspPIFLCLKLGRVPGHLRTHSIKTTTAMTASRLHHLVPIHsvsskndgtngslsssnavatedednlegRYRLPPPEIREIVDAPPLPALSFSPQRDKILFLKRralppleelarpeeklaglridgkcntRSRMSFYTGIGIHQLFPDGKLGQEIEIQGFPDGAKLNFVTWSQDGKHLAFSIRidaedssssklRVWVADVDTGKARPLFQSPDIYLNAIFDNFVWVNNSTLLVCTIPLLRGDPPKKPLVPlgpkmqsnekrdiiQVRTFQDLLKDEYDEDLFDYYATTQLVLVSLDGTVKEIGppavytsldpspDEKYILISSIHRPYSFIVPCGRFPRQVGVWTTDGIFVRELCDLPLAEDIPIAFnsvrkgmrsinwrsdkpstLYWAETQDGGDAKVEVTPRDIIYTqqaepvqgegpEILHKLDLRYGGISWCDDSLALVYESWYKTrrtrtwvispgskdvaprilfdrssedvysdpgspmmrrtsTGTYVIAKIKKENDEGTYILLNGngatpegniPFLDLFDINTGSKERIWESDKEKYYETTVALMSDQTEGDLYLNQLKIltskeskteNTQYYIQSWPDKKSCQITDFPHPYPQLASLQKELIKYQRKDGVQLSATLYLPPGYDPSKDGPLPCLFWSYPGEFKSKDAAGQVRGSPNEFPRIGSTSVLLWLARGFAILGGPTTPIIGEGDEEANDRFVEQLVACAEAAVEEVVRRGVAHPSKIAVGGHSYGAFMTANLLAHAPHLFCCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVEMSPFMSANKLKKPILLVHGEEDNNSGTLTMQSDRFFNALKGHGALCRLVILPFESHGYAARESIMHVLWETDRWLQKYCVSNtadrstdlkvskddeskgaphlqnktvAASGGGGTEADFEHDGChlaprsslcycvd
MNQMVRGLHKVCHRGVslltpsslsppIFLCLKLGRVPGHLRTHSIKTTTAMTASRLHHLVPIHSVSSKNDGTNGSLSSSNAVATEDEDNLEGRYRLPPPEIREIVDAPPLPALSFSPQRDKILFLKrralppleelarpeeklaGLRIDGKCNTRSRMSFYTGIGIHQLFPDGKLGQEIEIQGFPDGAKLNFVTWSQDGKHLAFSIRIDAEDSSSSKLRVWVADVDTGKARPLFQSPDIYLNAIFDNFVWVNNSTLLVCTIPLLRGDppkkplvplgpkMQSNEKRDIIQVRTFQDLLKDEYDEDLFDYYATTQLVLVSLDGTVKEIGPPAVYTSLDPSPDEKYILISSIHRPYSFIVPCGRFPRQVGVWTTDGIFVRELCDLPLAEDIPIAFNSVRKGMRSINWRSDKPSTLYWAETQDGGDAKVEVTPRDIIYTQQAEPVQGEGPEILHKLDLRYGGISWCDDSLALVYESWYKTRRTRTWVISPGSKDVAPRILFDRSSEDVYSDPGSPMMRRTSTGTYVIAKIKKENDEGTYILLNGNGATPEGNIPFLDLFDINTGSKERIWESDKEKYYETTVALMSDQTEGDLYLNQLKILTSKESKTENTQYYIQSWPDKKSCQITDFPHPYPQLASLQKELIKYQRKDGVQLSATLYLPPGYDPSKDGPLPCLFWSYPGEFKSKDAAGQVRGSPNEFPRIGSTSVLLWLARGFAILGGPTTPIIGEGDEEANDRFveqlvacaeaaveevvRRGVAHPSKIAVGGHSYGAFMTANLLAHAPHLFCCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVEMSPFMSANKLKKPILLVHGEEDNNSGTLTMQSDRFFNALKGHGALCRLVILPFESHGYAARESIMHVLWETDRWLQKYCVSNTADRSTDLKVSKDDESKGAPHLQNKTVAASGGGGTEADFEHDGCHLAPRSSLCYCVD
******GLHKVCHRGVSLLTPSSLSPPIFLCLKLGRVPGHLRTHSIKTTTAMTASRLHHLVPI**********************************************************KILFLKRRAL************LAGLRIDGKCNTRSRMSFYTGIGIHQLFPDGKLGQEIEIQGFPDGAKLNFVTWSQDGKHLAFSIRIDA******KLRVWVADVDTGKARPLFQSPDIYLNAIFDNFVWVNNSTLLVCTIPLLR*********************DIIQVRTFQDLLKDEYDEDLFDYYATTQLVLVSLDGTVKEIGPPAVYTSLDPSPDEKYILISSIHRPYSFIVPCGRFPRQVGVWTTDGIFVRELCDLPLAEDIPIAFNSVRKGMRSINWRSDKPSTLYWAETQDGGDAKVEVTPRDIIYTQQAEPVQGEGPEILHKLDLRYGGISWCDDSLALVYESWYKTRRTRTWVISPGSKDVAPRILF*********************GTYVIAKIKKENDEGTYILLNGNGATPEGNIPFLDLFDINTGSKERIWESDKEKYYETTVALMSDQTEGDLYLNQLKILTS*****ENTQYYIQSWPDKKSCQITDFPHPYPQLASLQKELIKYQRKDGVQLSATLYLPPGYDPSKDGPLPCLFWSYPGEF***************FPRIGSTSVLLWLARGFAILGGPTTPIIGEGDEEANDRFVEQLVACAEAAVEEVVRRGVAHPSKIAVGGHSYGAFMTANLLAHAPHLFCCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVEMSPFMSANKLKKPILLVHG********LTMQSDRFFNALKGHGALCRLVILPFESHGYAARESIMHVLWETDRWLQKYCVSN*******************************************CHLAPRSSLCYC**
*********KVCHRGVSLLTPSSLSPPI******************************HLVPIHSVSS********LSS*NAVA***********RLPPPEIREIVDAPPLP***FSPQRDKILFLKRRALPPLEELARPEEKLAGLRIDGKCNTRSRMSFYTGIGIHQLFP*****QEIEIQGFPDGAKLNFVTWSQDGKHLAFSIRIDAEDSSSSKLRVWVADVDTGKARPLFQSPDIYLNAIFDNFVWVNNSTLLVCTIPLL**************************VRTFQDLLKDEYDEDLFDYYATTQLVLVSLDGTVKEIGPPAVYTSLDPSPDEKYILISSIHRPYSFIVPCGRFPRQVGVWTTDGIFVRELCDLPLAEDIPIAFNSVRKGMRSINWRSDKPSTLYWAETQDGGDAKVEVTPRDIIYTQQAEPVQGEGPEILHKLDLRYGGISWCDDSLALVYESWYKTRRTRTWVISPGSKDVAPRILFDRSSEDVYSDPGSPMMRRTSTGTYVIAKIKKENDEGTYILLNGNGATPEGNIPFLDLFDINTGSKERIWESDKEKYYETTVALMSDQTEGDLYLNQLKILTSKESKTENTQYYIQSWPDKKSCQITDFPHPYPQLASLQKELIKYQRKDGVQLSATLYLPPGYDPSKDGPLPCLFWSYPGEFKSKDAAGQVRGSPNEFPRIGSTSVLLWLARGFAILGGPTTPIIGEGDEEANDRFVEQLVACAEAAVEEVVRRGVAHPSKIAVGGHSYGAFMTANLLAHAPHLFCCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVEMSPFMSANKLKKPILLVHGEEDNNSGTLTMQSDRFFNALKGHGALCRLVILPFESHGYAARESIMHVLWETDRWLQKYC***************************************************RSSLCYCVD
MNQMVRGLHKVCHRGVSLLTPSSLSPPIFLCLKLGRVPGHLRTHSIKTTTAMTASRLHHLVPIHSVS***********************LEGRYRLPPPEIREIVDAPPLPALSFSPQRDKILFLKRRALPPLEELARPEEKLAGLRIDGKCNTRSRMSFYTGIGIHQLFPDGKLGQEIEIQGFPDGAKLNFVTWSQDGKHLAFSIRIDA********RVWVADVDTGKARPLFQSPDIYLNAIFDNFVWVNNSTLLVCTIPLLRGDPPKKPLVPLGPKMQSNEKRDIIQVRTFQDLLKDEYDEDLFDYYATTQLVLVSLDGTVKEIGPPAVYTSLDPSPDEKYILISSIHRPYSFIVPCGRFPRQVGVWTTDGIFVRELCDLPLAEDIPIAFNSVRKGMRSINWRSDKPSTLYWAETQDGGDAKVEVTPRDIIYTQQAEPVQGEGPEILHKLDLRYGGISWCDDSLALVYESWYKTRRTRTWVISPGSKDVAPRILFDRSSEDVYSDPGSPMMRRTSTGTYVIAKIKKENDEGTYILLNGNGATPEGNIPFLDLFDINTGSKERIWESDKEKYYETTVALMSDQTEGDLYLNQLKILTSKESKTENTQYYIQSWPDKKSCQITDFPHPYPQLASLQKELIKYQRKDGVQLSATLYLPPGYDPSKDGPLPCLFWSYPGEFKSK********SPNEFPRIGSTSVLLWLARGFAILGGPTTPIIGEGDEEANDRFVEQLVACAEAAVEEVVRRGVAHPSKIAVGGHSYGAFMTANLLAHAPHLFCCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVEMSPFMSANKLKKPILLVHGEEDNNSGTLTMQSDRFFNALKGHGALCRLVILPFESHGYAARESIMHVLWETDRWLQKYCVSNTAD****************PHLQNKTVAASGGGGTEADFEHDGCHLAPRSSLCYCVD
****VRGLHKVCHRGVSLLTPSSLSPPIFLCLKLGRVPGHLRTHSIKTTTAMTASRLHHLVPIHSVS*************************GRYRLPPPEIREIVDAPPLPALSFSPQRDKILFLKRRALPPLEELARPEEKLAGLRIDGKCNTRSRMSFYTGIGIHQLFPDGKLGQEIEIQGFPDGAKLNFVTWSQDGKHLAFSIRIDAEDSSSSKLRVWVADVDTGKARPLFQSPDIYLNAIFDNFVWVNNSTLLVCTIPLLRGDP*KKPLVPLGPKMQSNEKRDIIQVRTFQDLLKDEYDEDLFDYYATTQLVLVSLDGTVKEIGPPAVYTSLDPSPDEKYILISSIHRPYSFIVPCGRFPRQVGVWTTDGIFVRELCDLPLAEDIPIAFNSVRKGMRSINWRSDKPSTLYWAETQDGGDAKVEVTPRDIIYTQQAEPVQGEGPEILHKLDLRYGGISWCDDSLALVYESWYKTRRTRTWVISPGSKDVAPRILFDRSSEDVYSDPGSPMMRRTSTGTYVIAKIKKENDEGTYILLNGNGATPEGNIPFLDLFDINTGSKERIWESDKEKYYETTVALMSDQTEGDLYLNQLKILTSKESKTENTQYYIQSWPDKKSCQITDFPHPYPQLASLQKELIKYQRKDGVQLSATLYLPPGYDPSKDGPLPCLFWSYPGEFKSKDAAGQVRGSPNEFPRIGSTSVLLWLARGFAILGGPTTPIIGEGDEEANDRFVEQLVACAEAAVEEVVRRGVAHPSKIAVGGHSYGAFMTANLLAHAPHLFCCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVEMSPFMSANKLKKPILLVHGEEDNNSGTLTMQSDRFFNALKGHGALCRLVILPFESHGYAARESIMHVLWETDRWLQKYCVSN********************************************HLAPRSSLCYCVD
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNQMVRGLHKVCHRGVSLLTPSSLSPPIFLCLKLGRVPGHLRTHSIKTTTAMTASRLHHLVPIHSVSSKNDGTNGSLSSSNAVATEDEDNLEGRYRLPPPEIREIVDAPPLPALSFSPQRDKILFLKRRALPPLEELARPEEKLAGLRIDGKCNTRSRMSFYTGIGIHQLFPDGKLGQEIEIQGFPDGAKLNFVTWSQDGKHLAFSIRIDAEDSSSSKLRVWVADVDTGKARPLFQSPDIYLNAIFDNFVWVNNSTLLVCTIPLLRGDPPKKPLVPLGPKMQSNEKRDIIQVRTFQDLLKDEYDEDLFDYYATTQLVLVSLDGTVKEIGPPAVYTSLDPSPDEKYILISSIHRPYSFIVPCGRFPRQVGVWTTDGIFVRELCDLPLAEDIPIAFNSVRKGMRSINWRSDKPSTLYWAETQDGGDAKVEVTPRDIIYTQQAEPVQGEGPEILHKLDLRYGGISWCDDSLALVYESWYKTRRTRTWVISPGSKDVAPRILFDRSSEDVYSDPGSPMMRRTSTGTYVIAKIKKENDEGTYILLNGNGATPEGNIPFLDLFDINTGSKERIWESDKEKYYETTVALMSDQTEGDLYLNQLKILTSKESKTENTQYYIQSWPDKKSCQITDFPHPYPQLASLQKELIKYQRKDGVQLSATLYLPPGYDPSKDGPLPCLFWSYPGEFKSKDAAGQVRGSPNEFPRIGSTSVLLWLARGFAILGGPTTPIIGEGDEEANDRFVEQLVACAEAAVEEVVRRGVAHPSKIAVGGHSYGAFMTANLLAHAPHLFCCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVEMSPFMSANKLKKPILLVHGEEDNNSGTLTMQSDRFFNALKGHGALCRLVILPFESHGYAARESIMHVLWETDRWLQKYCVSNTADRSTDLKVSKDDESKGAPHLQNKTVAASGGGGTEADFEHDGCHLAPRSSLCYCVD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query958 2.2.26 [Sep-21-2011]
Q8VZF3960 Probable glutamyl endopep yes no 0.935 0.933 0.789 0.0
Q10MJ1938 Probable glutamyl endopep yes no 0.898 0.917 0.787 0.0
P34422740 Dipeptidyl peptidase fami no no 0.213 0.277 0.257 2e-09
P13676732 Acylamino-acid-releasing yes no 0.161 0.211 0.242 8e-06
P39839657 Uncharacterized peptidase yes no 0.132 0.193 0.287 9e-06
Q8R146732 Acylamino-acid-releasing yes no 0.164 0.215 0.229 3e-05
P19205732 Acylamino-acid-releasing yes no 0.152 0.199 0.248 0.0001
P14740767 Dipeptidyl peptidase 4 OS no no 0.233 0.292 0.251 0.0001
P13798732 Acylamino-acid-releasing yes no 0.152 0.199 0.265 0.0003
P28843760 Dipeptidyl peptidase 4 OS no no 0.233 0.294 0.255 0.0003
>sp|Q8VZF3|CGEP_ARATH Probable glutamyl endopeptidase, chloroplastic OS=Arabidopsis thaliana GN=GEP PE=2 SV=2 Back     alignment and function desciption
 Score = 1472 bits (3811), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 718/910 (78%), Positives = 787/910 (86%), Gaps = 14/910 (1%)

Query: 49  TTAM---TASRLHHLVPIHSVSSKNDG--TNGSLSSSNAVATEDEDNLEGRYRLPPPEIR 103
           TT M   +ASRL  L    S  +++ G  +NGSLS+S     +DE  +   YRLPPPEIR
Sbjct: 59  TTVMASRSASRLRSLASACSGGAEDGGGTSNGSLSASATATEDDELAIGTGYRLPPPEIR 118

Query: 104 EIVDAPPLPALSFSPQRDKILFLKRRALPPLEELARPEEKLAGLRIDGKCNTRSRMSFYT 163
           +IVDAPP+PALSFSP RDKILFLKRRALPPL +LARPEEKLAG+RIDG CNTRSRMSFYT
Sbjct: 119 DIVDAPPVPALSFSPHRDKILFLKRRALPPLADLARPEEKLAGVRIDGYCNTRSRMSFYT 178

Query: 164 GIGIHQLFPDGKLGQEIEIQGFPDGAKLNFVTWSQDGKHLAFSIRIDAEDSSSSKLRVWV 223
           G+GIHQL PDG L  E EI G PDG K+NFVTWS DGKHLAFSIR+D E+ +SSK  VWV
Sbjct: 179 GLGIHQLLPDGTLSPEKEITGIPDGGKINFVTWSNDGKHLAFSIRVD-ENGNSSKPVVWV 237

Query: 224 ADVDTGKARPLFQSPDIYLNAIFDNFVWVNNSTLLVCTIPLLRGDPPKKPLVPLGPKMQS 283
           ADV+TG ARPLF S DI+LNAIF++FVW++NSTLLV TIP  RG+PPKKPLVP GPK  S
Sbjct: 238 ADVETGVARPLFNSQDIFLNAIFESFVWIDNSTLLVSTIPSSRGEPPKKPLVPSGPKTLS 297

Query: 284 NEKRDIIQVRTFQDLLKDEYDEDLFDYYATTQLVLVSLDGTVKEIGPPAVYTSLDPSPDE 343
           NE + ++QVRTFQDLLKDEYD DLFDYYA++QLVL SLDGTVKE+G PAVYTSLDPS D 
Sbjct: 298 NETKTVVQVRTFQDLLKDEYDADLFDYYASSQLVLASLDGTVKEVGVPAVYTSLDPSTDH 357

Query: 344 KYILISSIHRPYSFIVPCGRFPRQVGVWTTDGIFVRELCDLPLAEDIPIAFNSVRKGMRS 403
           KY+L+SS+HRPYSFIVPCGRFP++V VWTTDG FVR+LCDLPLAEDIPIA NSVRKGMRS
Sbjct: 358 KYLLVSSLHRPYSFIVPCGRFPKKVEVWTTDGRFVRQLCDLPLAEDIPIASNSVRKGMRS 417

Query: 404 INWRSDKPSTLYWAETQDGGDAKVEVTPRDIIYTQQAEPVQGEGPEILHKLDLRYGGISW 463
           INWR+DKPSTL WAETQDGGDAK+EV+PRDI+Y Q AEP+ GE PE+LHKLDLRYGGISW
Sbjct: 418 INWRADKPSTL-WAETQDGGDAKMEVSPRDIVYMQSAEPLAGEEPEVLHKLDLRYGGISW 476

Query: 464 CDDSLALVYESWYKTRRTRTWVISPGSKDVAPRILFDRSSEDVYSDPGSPMMRRTSTGTY 523
           CDD+LALVYESWYKTRRTRTWVISPGS DV+PRILFDRSSEDVYSDPGS M+RRT  GTY
Sbjct: 477 CDDTLALVYESWYKTRRTRTWVISPGSNDVSPRILFDRSSEDVYSDPGSTMLRRTDAGTY 536

Query: 524 VIAKIKKENDEGTYILLNGNGATPEGNIPFLDLFDINTGSKERIWESDKEKYYETTVALM 583
           VIAKIKKENDEGTY+LLNG+GATP+GN+PFLDLFDINTG+KERIWESDKEKY+ET VALM
Sbjct: 537 VIAKIKKENDEGTYVLLNGSGATPQGNVPFLDLFDINTGNKERIWESDKEKYFETVVALM 596

Query: 584 SDQTEGDLYLNQLKILTSKESKTENTQYYIQSWPDKKSCQITDFPHPYPQLASLQKELIK 643
           SDQ EGDL + +LKILTSKESKTENTQY +Q WPD+K  QIT+FPHPYPQLASLQKE+I+
Sbjct: 597 SDQKEGDLKMEELKILTSKESKTENTQYSLQLWPDRKVQQITNFPHPYPQLASLQKEMIR 656

Query: 644 YQRKDGVQLSATLYLPPGYDPSKDGPLPCLFWSYPGEFKSKDAAGQVRGSPNEFPRIGST 703
           YQRKDGVQL+ATLYLPPGYDPSKDGPLPCLFWSYPGEFKSKDAAGQVRGSPNEF  IGST
Sbjct: 657 YQRKDGVQLTATLYLPPGYDPSKDGPLPCLFWSYPGEFKSKDAAGQVRGSPNEFAGIGST 716

Query: 704 SVLLWLARGFAILGGPTTPIIGEGDEEANDRFVEQLVACAEAAVEEVVRRGVAHPSKIAV 763
           S LLWLAR FAIL GPT PIIGEGDEEANDR+VEQLVA AEAAVEEVVRRGVA  SKIAV
Sbjct: 717 SALLWLARRFAILSGPTIPIIGEGDEEANDRYVEQLVASAEAAVEEVVRRGVADRSKIAV 776

Query: 764 GGHSYGAFMTANLLAHAPHLFCCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVEMSPF 823
           GGHSYGAFMTANLLAHAPHLF CGIARSGAYNRTLTPFGFQNEDRTLWEAT+ YVEMSPF
Sbjct: 777 GGHSYGAFMTANLLAHAPHLFACGIARSGAYNRTLTPFGFQNEDRTLWEATNVYVEMSPF 836

Query: 824 MSANKLKKPILLVHGEEDNNSGTLTMQSDRFFNALKGHGALCRLVILPFESHGYAARESI 883
           MSANK+KKPILL+HGEEDNN GTLTMQSDRFFNALKGHGALCRLV+LP ESHGY+ARESI
Sbjct: 837 MSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVVLPHESHGYSARESI 896

Query: 884 MHVLWETDRWLQKYCVSNTADRSTDLKVSKDDESKGAPHLQNKTVAASGGGGTEADFEHD 943
           MHVLWETDRWLQKYCV NT+D  T       D+SK      +K    +GGG  E  F   
Sbjct: 897 MHVLWETDRWLQKYCVPNTSDADT-----SPDQSKEGSDSADKVSTGTGGGNPE--FGEH 949

Query: 944 GCHLAPRSSL 953
             H   R SL
Sbjct: 950 EVHSKLRRSL 959
Serine-type protease active in vitro against the LHCII N-terminal. Cleaves its substrate on the carboxy-side of Glu residues.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 4EC: .EC: 2EC: 1EC: .EC: -
>sp|Q10MJ1|CGEP_ORYSJ Probable glutamyl endopeptidase, chloroplastic OS=Oryza sativa subsp. japonica GN=GEP PE=2 SV=1 Back     alignment and function description
>sp|P34422|DPF6_CAEEL Dipeptidyl peptidase family member 6 OS=Caenorhabditis elegans GN=dpf-6 PE=3 SV=2 Back     alignment and function description
>sp|P13676|ACPH_RAT Acylamino-acid-releasing enzyme OS=Rattus norvegicus GN=Apeh PE=1 SV=1 Back     alignment and function description
>sp|P39839|YUXL_BACSU Uncharacterized peptidase YuxL OS=Bacillus subtilis (strain 168) GN=yuxL PE=3 SV=3 Back     alignment and function description
>sp|Q8R146|APEH_MOUSE Acylamino-acid-releasing enzyme OS=Mus musculus GN=Apeh PE=2 SV=3 Back     alignment and function description
>sp|P19205|ACPH_PIG Acylamino-acid-releasing enzyme OS=Sus scrofa GN=APEH PE=1 SV=2 Back     alignment and function description
>sp|P14740|DPP4_RAT Dipeptidyl peptidase 4 OS=Rattus norvegicus GN=Dpp4 PE=1 SV=2 Back     alignment and function description
>sp|P13798|ACPH_HUMAN Acylamino-acid-releasing enzyme OS=Homo sapiens GN=APEH PE=1 SV=4 Back     alignment and function description
>sp|P28843|DPP4_MOUSE Dipeptidyl peptidase 4 OS=Mus musculus GN=Dpp4 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query958
359479944961 PREDICTED: probable glutamyl endopeptida 0.981 0.978 0.802 0.0
297743980913 unnamed protein product [Vitis vinifera] 0.938 0.984 0.827 0.0
224130988967 predicted protein [Populus trichocarpa] 0.956 0.947 0.815 0.0
255548453926 dipeptidyl-peptidase, putative [Ricinus 0.919 0.951 0.800 0.0
224064539905 predicted protein [Populus trichocarpa] 0.932 0.986 0.810 0.0
357511363962 Acylamino-acid-releasing enzyme [Medicag 0.953 0.949 0.777 0.0
297828471962 serine-type peptidase [Arabidopsis lyrat 0.938 0.934 0.789 0.0
30690669961 prolyl oligopeptidase-like protein [Arab 0.936 0.933 0.790 0.0
332278170960 RecName: Full=Probable glutamyl endopept 0.935 0.933 0.789 0.0
18086370960 At2g47390/T8I13.23 [Arabidopsis thaliana 0.935 0.933 0.787 0.0
>gi|359479944|ref|XP_002270510.2| PREDICTED: probable glutamyl endopeptidase, chloroplastic-like [Vitis vinifera] Back     alignment and taxonomy information
 Score = 1591 bits (4119), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 774/965 (80%), Positives = 859/965 (89%), Gaps = 25/965 (2%)

Query: 8   LHKVCHRGVSLLT---PSSLSPPIFLCLKL-----GRVPGHLRT-----HSIKTTTAMTA 54
           ++K  HR +SLL+   P SLSPP FL L L      R  G LRT         T  AM++
Sbjct: 3   INKAYHR-LSLLSHHLPFSLSPPHFLSLSLPRFTSTRTRGRLRTLPSCAGGTTTRAAMSS 61

Query: 55  SRLHHLVPIHSVSSKND---GTNGSLSSSNAVATEDEDN--LEGRYRLPPPEIREIVDAP 109
           SR  HLVPI++ +++ D   G+NGS+SS+     EDE+N  L   YRLPPPEI++IVDAP
Sbjct: 62  SRFLHLVPINAAAAEGDTGVGSNGSVSST----AEDEENSALGSGYRLPPPEIKDIVDAP 117

Query: 110 PLPALSFSPQRDKILFLKRRALPPLEELARPEEKLAGLRIDGKCNTRSRMSFYTGIGIHQ 169
           PLPALSFSPQRDKILFLKRRALPPLEELA+PEEKLAG+RIDGKCNTRSRMSFYT IGIHQ
Sbjct: 118 PLPALSFSPQRDKILFLKRRALPPLEELAKPEEKLAGIRIDGKCNTRSRMSFYTSIGIHQ 177

Query: 170 LFPDGKLGQEIEIQGFPDGAKLNFVTWSQDGKHLAFSIRIDAEDSSSSKLRVWVADVDTG 229
           L PDG LG E E+ GFPDGAK+NFV+WS +G+HL+FSIR+D E++SSSKLR+WVADV+TG
Sbjct: 178 LMPDGTLGPEKEVHGFPDGAKINFVSWSLNGQHLSFSIRVD-EENSSSKLRIWVADVETG 236

Query: 230 KARPLFQSPDIYLNAIFDNFVWVNNSTLLVCTIPLLRGDPPKKPLVPLGPKMQSNEKRDI 289
           KARPLFQSPDI+LNA+FDNFVWV++STLLVCTIPL RGDPPKKPLVP GPK+QSNE++++
Sbjct: 237 KARPLFQSPDIHLNAVFDNFVWVDDSTLLVCTIPLSRGDPPKKPLVPSGPKVQSNEQKNV 296

Query: 290 IQVRTFQDLLKDEYDEDLFDYYATTQLVLVSLDGTVKEIGPPAVYTSLDPSPDEKYILIS 349
           +QVRTFQDLLKDEYD DLFDYYATTQLVL SLDGT+KEIGPPAVYTS+DPSPD+KY+LIS
Sbjct: 297 VQVRTFQDLLKDEYDADLFDYYATTQLVLASLDGTMKEIGPPAVYTSMDPSPDQKYLLIS 356

Query: 350 SIHRPYSFIVPCGRFPRQVGVWTTDGIFVRELCDLPLAEDIPIAFNSVRKGMRSINWRSD 409
           SIHRPYSFIVPCGRFP++V +WT++G FVRELCDLPLAEDIPIAFNSVRKGMRSINWR+D
Sbjct: 357 SIHRPYSFIVPCGRFPKKVDLWTSEGKFVRELCDLPLAEDIPIAFNSVRKGMRSINWRAD 416

Query: 410 KPSTLYWAETQDGGDAKVEVTPRDIIYTQQAEPVQGEGPEILHKLDLRYGGISWCDDSLA 469
           KPSTLYW ETQD GDAKVEV+PRDI+Y Q AEP+ GE   ILHKLDLRYGGISWCDDSLA
Sbjct: 417 KPSTLYWVETQDEGDAKVEVSPRDIVYMQPAEPLDGEQQAILHKLDLRYGGISWCDDSLA 476

Query: 470 LVYESWYKTRRTRTWVISPGSKDVAPRILFDRSSEDVYSDPGSPMMRRTSTGTYVIAKIK 529
           LVYESWYKTRRTRTWVISPGS+DV+PRILFDRSSEDVYSDPGSPM+RRT+ GTYVIAKIK
Sbjct: 477 LVYESWYKTRRTRTWVISPGSEDVSPRILFDRSSEDVYSDPGSPMLRRTTAGTYVIAKIK 536

Query: 530 KENDEGTYILLNGNGATPEGNIPFLDLFDINTGSKERIWESDKEKYYETTVALMSDQTEG 589
           KENDEGTYILLNG+GATPEGNIPFLDLFDINTGSKERIWESDKEKYYET VALMSDQ+EG
Sbjct: 537 KENDEGTYILLNGSGATPEGNIPFLDLFDINTGSKERIWESDKEKYYETVVALMSDQSEG 596

Query: 590 DLYLNQLKILTSKESKTENTQYYIQSWPDKKSCQITDFPHPYPQLASLQKELIKYQRKDG 649
           DLYLNQLKILTSKESKTENTQY+IQSW DKK+CQIT+FPHPYPQLASLQKE+I+Y+RKDG
Sbjct: 597 DLYLNQLKILTSKESKTENTQYFIQSWLDKKACQITNFPHPYPQLASLQKEMIRYERKDG 656

Query: 650 VQLSATLYLPPGYDPSKDGPLPCLFWSYPGEFKSKDAAGQVRGSPNEFPRIGSTSVLLWL 709
           VQL+ATLYLPPGYDPSKDGPLPCL WSYPGEFKSKDAAGQVRGSPNEF  IG TS LLWL
Sbjct: 657 VQLTATLYLPPGYDPSKDGPLPCLVWSYPGEFKSKDAAGQVRGSPNEFAGIGPTSALLWL 716

Query: 710 ARGFAILGGPTTPIIGEGDEEANDRFVEQLVACAEAAVEEVVRRGVAHPSKIAVGGHSYG 769
           AR FAIL GPT PIIGEG+EEANDR+VEQLVA AEAAVEEV+RRGVAHP+KIAVGGHSYG
Sbjct: 717 ARRFAILSGPTIPIIGEGNEEANDRYVEQLVASAEAAVEEVIRRGVAHPNKIAVGGHSYG 776

Query: 770 AFMTANLLAHAPHLFCCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVEMSPFMSANKL 829
           AFMTANLLAHAPHLFCCGIARSGAYNRTLTPFGFQNEDRTLWEAT TYVEMSPFMSANK+
Sbjct: 777 AFMTANLLAHAPHLFCCGIARSGAYNRTLTPFGFQNEDRTLWEATDTYVEMSPFMSANKI 836

Query: 830 KKPILLVHGEEDNNSGTLTMQSDRFFNALKGHGALCRLVILPFESHGYAARESIMHVLWE 889
           K+P+LL+HGEEDNN GTLTMQSDRFFNALKGHGALCRLVILPFESHGYAARESIMHVLWE
Sbjct: 837 KRPVLLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYAARESIMHVLWE 896

Query: 890 TDRWLQKYCVSNTADRSTDLKVSKDDESKGAPHLQNKTVAASGGGGTE-ADFEHDGCHLA 948
           TDRWLQK+CVSNT + + +L    D+  +     ++KTV ASGGG  E A+ EH+G H  
Sbjct: 897 TDRWLQKHCVSNTTNVNENLDTCNDEAKEEITDPESKTVPASGGGNPELAESEHEGFHPR 956

Query: 949 PRSSL 953
            R+SL
Sbjct: 957 ARASL 961

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|297743980|emb|CBI36950.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224130988|ref|XP_002320974.1| predicted protein [Populus trichocarpa] gi|222861747|gb|EEE99289.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255548453|ref|XP_002515283.1| dipeptidyl-peptidase, putative [Ricinus communis] gi|223545763|gb|EEF47267.1| dipeptidyl-peptidase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224064539|ref|XP_002301512.1| predicted protein [Populus trichocarpa] gi|222843238|gb|EEE80785.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357511363|ref|XP_003625970.1| Acylamino-acid-releasing enzyme [Medicago truncatula] gi|355500985|gb|AES82188.1| Acylamino-acid-releasing enzyme [Medicago truncatula] Back     alignment and taxonomy information
>gi|297828471|ref|XP_002882118.1| serine-type peptidase [Arabidopsis lyrata subsp. lyrata] gi|297327957|gb|EFH58377.1| serine-type peptidase [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|30690669|ref|NP_850473.1| prolyl oligopeptidase-like protein [Arabidopsis thaliana] gi|330255741|gb|AEC10835.1| prolyl oligopeptidase-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|332278170|sp|Q8VZF3.2|CGEP_ARATH RecName: Full=Probable glutamyl endopeptidase, chloroplastic; Flags: Precursor Back     alignment and taxonomy information
>gi|18086370|gb|AAL57645.1| At2g47390/T8I13.23 [Arabidopsis thaliana] gi|27363294|gb|AAO11566.1| At2g47390/T8I13.23 [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query958
UNIPROTKB|Q8EHB8801 SO_1310 "Serine peptidase S9 f 0.442 0.529 0.391 1.7e-80
TIGR_CMR|SO_1310801 SO_1310 "conserved hypothetica 0.442 0.529 0.391 1.7e-80
UNIPROTKB|Q47UC7693 CPS_4957 "Putative uncharacter 0.275 0.380 0.236 4.3e-08
TIGR_CMR|CPS_4957693 CPS_4957 "conserved hypothetic 0.275 0.380 0.236 4.3e-08
TIGR_CMR|SO_4618645 SO_4618 "prolyl oligopeptidase 0.421 0.626 0.217 5.1e-08
WB|WBGene00001059740 dpf-6 [Caenorhabditis elegans 0.429 0.555 0.215 5.3e-08
TIGR_CMR|SO_4252662 SO_4252 "prolyl oligopeptidase 0.237 0.344 0.247 0.00023
UNIPROTKB|Q8EHB8 SO_1310 "Serine peptidase S9 family" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
 Score = 783 (280.7 bits), Expect = 1.7e-80, Sum P(2) = 1.7e-80
 Identities = 172/439 (39%), Positives = 248/439 (56%)

Query:   457 RYGGISWCDDSLALVYESWYKTRRTRTWVISPGSKDVAPRILFDRSSEDVYSDPGSPMMR 516
             R   I W ++ LAL+ E   K ++ R   ++    + +   L +R+  D Y D G    +
Sbjct:   372 RITDIDWAENHLALITERNSKAQQIRLSSLNTRLGESSLHTLNERNLRDKYQDLGL-FAK 430

Query:   517 RTSTGTYVIAKIKKENDEGTYILLNGNGATPEGNIPFLDLFDINTGSKERIWESDKEKYY 576
                 G   +  ++ +  + T ++  G GATP+G+ PFL    + T     +W+S   +  
Sbjct:   431 HYYPGKGQVVSLQ-QGAKTTGLIHYGQGATPQGDKPFLKRTSLITSESSLLWQSASNRLE 489

Query:   577 ETTVALMSDQTEGDLYLNQLKILTSKESKTENTQYYIQSWPDKKSCQITDFPHPYPQLAS 636
                  L          L+ L+++ ++ES TE+    + +   K+S  + + P        
Sbjct:   490 SVRYVLN---------LDPLQLIINRESPTESPSLVLLN-AAKESV-LYEQPDGLSAYLG 538

Query:   637 LQKELIKYQRKDGVQLSATLYLPPGYDPSKDGPLPCLFWSYPGEFKSKDAAGQVRGSPNE 696
             +QK+LI ++R DGV LS TLYLP  Y   + G LP L W+YP EF   + AGQ+  S N+
Sbjct:   539 MQKQLITFKRADGVPLSGTLYLPANYT-KEQGTLPVLMWAYPREFNDPEVAGQISFSANQ 597

Query:   697 FPRIGSTSVLLWLARGFAILGGPTTPIIGEGDEEANDRFXXXXXXXXXXXXXXXXRRGVA 756
             +P I     +  +A GFA+    + PII +GD+E+ND F                  G+A
Sbjct:   598 YPTISPRGPIPLVAEGFAVFDKVSMPIIAQGDKESNDTFREQLTANAQAAIDTLVDLGIA 657

Query:   757 HPSKIAVGGHSYGAFMTANLLAHAPHLFCCGIARSGAYNRTLTPFGFQNEDRTLWEATST 816
                +IAVGGHSYGAFM ANLLAH   LF  GIARSGAYNR+LTPFGFQNE+RT W+A   
Sbjct:   658 DRKQIAVGGHSYGAFMVANLLAHTD-LFYAGIARSGAYNRSLTPFGFQNEERTYWQANDI 716

Query:   817 YVEMSPFMSANKLKKPILLVHGEEDNNSGTLTMQSDRFFNALKGHGALCRLVILPFESHG 876
             Y +MSPF  A+K+K P+LL+HGE D NSGT  +QS+R F+A++G G   RLVILPFE H 
Sbjct:   717 YQQMSPFNYADKIKSPLLLIHGEMDQNSGTFPLQSERLFDAIQGLGGKARLVILPFEGHS 776

Query:   877 YAARESIMHVLWETDRWLQ 895
             Y A+ES+ H+L+E  ++L+
Sbjct:   777 YTAKESLEHLLFEQSQFLK 795
GO:0003674 "molecular_function" evidence=ND
GO:0005575 "cellular_component" evidence=ND
GO:0008150 "biological_process" evidence=ND
TIGR_CMR|SO_1310 SO_1310 "conserved hypothetical protein" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
UNIPROTKB|Q47UC7 CPS_4957 "Putative uncharacterized protein" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_4957 CPS_4957 "conserved hypothetical protein" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
TIGR_CMR|SO_4618 SO_4618 "prolyl oligopeptidase family protein" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
WB|WBGene00001059 dpf-6 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
TIGR_CMR|SO_4252 SO_4252 "prolyl oligopeptidase family protein" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q10MJ1CGEP_ORYSJ3, ., 4, ., 2, 1, ., -0.78710.89870.9179yesno
Q8VZF3CGEP_ARATH3, ., 4, ., 2, 1, ., -0.78900.93520.9333yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
gw1.XIV.2306.1
hypothetical protein (967 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query958
COG1506620 COG1506, DAP2, Dipeptidyl aminopeptidases/acylamin 6e-45
pfam00326212 pfam00326, Peptidase_S9, Prolyl oligopeptidase fam 2e-21
pfam12697187 pfam12697, Abhydrolase_6, Alpha/beta hydrolase fam 1e-07
COG0412236 COG0412, COG0412, Dienelactone hydrolase and relat 3e-07
pfam12695145 pfam12695, Abhydrolase_5, Alpha/beta hydrolase fam 5e-06
COG0400207 COG0400, COG0400, Predicted esterase [General func 2e-05
COG4099387 COG4099, COG4099, Predicted peptidase [General fun 8e-05
pfam01738215 pfam01738, DLH, Dienelactone hydrolase family 7e-04
>gnl|CDD|224423 COG1506, DAP2, Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism] Back     alignment and domain information 
 Score =  171 bits (436), Expect = 6e-45
 Identities = 130/674 (19%), Positives = 210/674 (31%), Gaps = 115/674 (17%)

Query: 273 PLVPLGPKMQSNEKRDIIQVRTFQDLLKDEYDEDLFDYYATTQLVLVSLDGTVKEIGPPA 332
            L  +     S     +  + T  D LK  Y             + VS   TV+ +    
Sbjct: 11  ALARVSDPRVSPPGGRLAYILTGLDFLKPLY----------KSSLWVSDGKTVRLLTFGG 60

Query: 333 VYTSLDPSPDEKYILISSIHRPYSFIVPCGRFPRQVGVWTTDGIFVRELCDLPLAEDIPI 392
             + L  SPD   +   S                      TDG  V +L  + +   I  
Sbjct: 61  GVSELRWSPDGSVLAFVS----------------------TDGGRVAQLYLVDVGGLITK 98

Query: 393 AFNSVRKGMRSINWRSDKPSTLYW-AETQDGGDAKVEVTPRDIIYTQQAEP--------V 443
               V        W  D     +  AE     D    +    +                V
Sbjct: 99  TAFGVSD----ARWSPDGDRIAFLTAEGASKRDGGDHLFVDRLPVWFDGRGGERSDLYVV 154

Query: 444 QGEGPEILHKLD-LRYGGISWCDDSLALVYESWYKTRRTRTWVISPGSKDVAPRILFDRS 502
             E   I   L  L     +   D   +                 P   ++   I  +  
Sbjct: 155 DIESKLIKLGLGNLDVVSFATDGDGRLVASIRLDDD-------ADPWVTNLYVLIEGNGE 207

Query: 503 SEDVYSDPGSPMMRRTSTGTYVIAKIKKENDEGTYILLNGNGATPEGN--IPFLDLFDIN 560
            E +    GS            IA +  E+D G            E       L   D  
Sbjct: 208 LESLTPGEGSISKLAFDADGKSIALLGTESDRGLAEGDFILLLDGELGEVDGDLSSGDDT 267

Query: 561 TGSKERIWESDKEKYYETTVALMSDQTEGDLYLNQL------------------------ 596
            G+       D +               G   L ++                        
Sbjct: 268 RGAWAVEGGLDGDGLLFIA-----TDGGGSSPLFRVDDLGGGVEGLSGDDGGVPGFDVDG 322

Query: 597 -KILTSKESKTENTQYYIQSWPDKKSCQITDFPHPYPQLASLQKELIKYQRKDGVQLSAT 655
            K+  +  S TE  + Y+     +++   +       ++   + E + Y+  DG  +   
Sbjct: 323 RKLALAYSSPTEPPEIYLYD-RGEEAKLTSSNNSGLKKVKLAEPEPVTYKSNDGETIHGW 381

Query: 656 LYLPPGYDPSKDGPLPCLFWSYPGEFKSKDAAGQVRGSPNEFPRIGSTSVLLWLARGFAI 715
           LY PPG+DP K  PL  + + + G       + QV  S N   +       +  + G+A+
Sbjct: 382 LYKPPGFDPRKKYPL--IVYIHGGP------SAQVGYSFNPEIQ-------VLASAGYAV 426

Query: 716 LGGPTTPIIGEGDEEA---NDRFVEQLVACAEAAVEEVVRRGVAHPSKIAVGGHSYGAFM 772
           L        G G E A      +    +    AAV+ +V+  +  P +I + G SYG +M
Sbjct: 427 LAPNYRGSTGYGREFADAIRGDWGGVDLEDLIAAVDALVKLPLVDPERIGITGGSYGGYM 486

Query: 773 TANLLAHAPHLFCCGIARSGAYNRTLTPFGFQNEDRTLWEAT--------STYVEMSPFM 824
           T       P  F   +A +G  +  L         R   E            Y + SP  
Sbjct: 487 TLLAATKTP-RFKAAVAVAGGVDWLLYFGESTEGLRFDPEENGGGPPEDREKYEDRSPIF 545

Query: 825 SANKLKKPILLVHGEEDNNSGTLTMQSDRFFNALKGHGALCRLVILPFESHGYAARESIM 884
            A+ +K P+LL+HGEED+       Q+++  +ALK  G    LV+ P E HG++  E+ +
Sbjct: 546 YADNIKTPLLLIHGEEDDRVP--IEQAEQLVDALKRKGKPVELVVFPDEGHGFSRPENRV 603

Query: 885 HVLWETDRWLQKYC 898
            VL E   W +++ 
Sbjct: 604 KVLKEILDWFKRHL 617

Length = 620
>gnl|CDD|215859 pfam00326, Peptidase_S9, Prolyl oligopeptidase family Back     alignment and domain information
>gnl|CDD|221720 pfam12697, Abhydrolase_6, Alpha/beta hydrolase family Back     alignment and domain information
>gnl|CDD|223489 COG0412, COG0412, Dienelactone hydrolase and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|221718 pfam12695, Abhydrolase_5, Alpha/beta hydrolase family Back     alignment and domain information
>gnl|CDD|223477 COG0400, COG0400, Predicted esterase [General function prediction only] Back     alignment and domain information
>gnl|CDD|226584 COG4099, COG4099, Predicted peptidase [General function prediction only] Back     alignment and domain information
>gnl|CDD|216672 pfam01738, DLH, Dienelactone hydrolase family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 958
COG1506620 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-pept 100.0
PRK10115686 protease 2; Provisional 100.0
KOG2100755 consensus Dipeptidyl aminopeptidase [Posttranslati 100.0
KOG2281867 consensus Dipeptidyl aminopeptidases/acylaminoacyl 100.0
COG1770682 PtrB Protease II [Amino acid transport and metabol 99.97
PF00326213 Peptidase_S9: Prolyl oligopeptidase family This fa 99.95
PRK01029428 tolB translocation protein TolB; Provisional 99.93
PRK03629429 tolB translocation protein TolB; Provisional 99.91
PRK05137435 tolB translocation protein TolB; Provisional 99.91
PRK01029428 tolB translocation protein TolB; Provisional 99.91
COG1505648 Serine proteases of the peptidase family S9A [Amin 99.91
PRK04043419 tolB translocation protein TolB; Provisional 99.91
COG4946668 Uncharacterized protein related to the periplasmic 99.9
PRK02889427 tolB translocation protein TolB; Provisional 99.9
PRK04792448 tolB translocation protein TolB; Provisional 99.9
PRK04922433 tolB translocation protein TolB; Provisional 99.89
PRK05137435 tolB translocation protein TolB; Provisional 99.89
PRK03629429 tolB translocation protein TolB; Provisional 99.89
KOG2237712 consensus Predicted serine protease [Posttranslati 99.89
KOG0293519 consensus WD40 repeat-containing protein [Function 99.88
PRK00178430 tolB translocation protein TolB; Provisional 99.88
PRK04043419 tolB translocation protein TolB; Provisional 99.88
PRK01742429 tolB translocation protein TolB; Provisional 99.87
PRK04792448 tolB translocation protein TolB; Provisional 99.87
PRK02889427 tolB translocation protein TolB; Provisional 99.87
PRK04922433 tolB translocation protein TolB; Provisional 99.87
PRK00178430 tolB translocation protein TolB; Provisional 99.86
PRK10566249 esterase; Provisional 99.84
KOG1455313 consensus Lysophospholipase [Lipid transport and m 99.84
PLN02298330 hydrolase, alpha/beta fold family protein 99.83
PRK01742429 tolB translocation protein TolB; Provisional 99.83
PRK13604307 luxD acyl transferase; Provisional 99.82
PF05448320 AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR0 99.81
PRK05077414 frsA fermentation/respiration switch protein; Revi 99.81
TIGR02821275 fghA_ester_D S-formylglutathione hydrolase. This m 99.8
PF01738218 DLH: Dienelactone hydrolase family; InterPro: IPR0 99.8
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 99.8
PLN02385349 hydrolase; alpha/beta fold family protein 99.79
PLN02442283 S-formylglutathione hydrolase 99.79
PHA02857276 monoglyceride lipase; Provisional 99.79
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 99.79
KOG4391300 consensus Predicted alpha/beta hydrolase BEM46 [Ge 99.78
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 99.77
PRK10749330 lysophospholipase L2; Provisional 99.77
COG0412236 Dienelactone hydrolase and related enzymes [Second 99.77
KOG1552258 consensus Predicted alpha/beta hydrolase [General 99.76
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 99.75
PRK10162318 acetyl esterase; Provisional 99.74
PRK05371 767 x-prolyl-dipeptidyl aminopeptidase; Provisional 99.73
PLN02652395 hydrolase; alpha/beta fold family protein 99.73
KOG0271480 consensus Notchless-like WD40 repeat-containing pr 99.72
COG0823425 TolB Periplasmic component of the Tol biopolymer t 99.71
COG3458321 Acetyl esterase (deacetylase) [Secondary metabolit 99.71
COG4946668 Uncharacterized protein related to the periplasmic 99.7
COG0823425 TolB Periplasmic component of the Tol biopolymer t 99.68
COG2267298 PldB Lysophospholipase [Lipid metabolism] 99.67
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 99.67
PRK11460232 putative hydrolase; Provisional 99.66
COG1647243 Esterase/lipase [General function prediction only] 99.66
TIGR00976 550 /NonD putative hydrolase, CocE/NonD family. This m 99.65
PF12715390 Abhydrolase_7: Abhydrolase family; PDB: 3NUZ_C 3G8 99.64
KOG1515336 consensus Arylacetamide deacetylase [Defense mecha 99.63
PF02129272 Peptidase_S15: X-Pro dipeptidyl-peptidase (S15 fam 99.63
TIGR01840212 esterase_phb esterase, PHB depolymerase family. Th 99.62
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 99.62
COG0657312 Aes Esterase/lipase [Lipid metabolism] 99.61
PF06500411 DUF1100: Alpha/beta hydrolase of unknown function 99.6
TIGR03100274 hydr1_PEP hydrolase, ortholog 1, exosortase system 99.6
TIGR01607332 PST-A Plasmodium subtelomeric family (PST-A). Thes 99.59
COG4099387 Predicted peptidase [General function prediction o 99.56
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 99.56
PF07859211 Abhydrolase_3: alpha/beta hydrolase fold A web pag 99.55
PF12695145 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3 99.55
COG2945210 Predicted hydrolase of the alpha/beta superfamily 99.55
KOG0271480 consensus Notchless-like WD40 repeat-containing pr 99.54
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.54
PLN02511388 hydrolase 99.53
PF02230216 Abhydrolase_2: Phospholipase/Carboxylesterase; Int 99.53
TIGR03343282 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-die 99.52
TIGR03611257 RutD pyrimidine utilization protein D. This protei 99.52
KOG0318603 consensus WD40 repeat stress protein/actin interac 99.52
PF10503220 Esterase_phd: Esterase PHB depolymerase 99.51
PRK00870302 haloalkane dehalogenase; Provisional 99.51
KOG4178322 consensus Soluble epoxide hydrolase [Lipid transpo 99.5
PRK10985324 putative hydrolase; Provisional 99.49
PLN00021313 chlorophyllase 99.48
KOG0315311 consensus G-protein beta subunit-like protein (con 99.46
TIGR03056278 bchO_mg_che_rel putative magnesium chelatase acces 99.46
PLN02872395 triacylglycerol lipase 99.45
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.45
PLN03087481 BODYGUARD 1 domain containing hydrolase; Provision 99.45
PRK10673255 acyl-CoA esterase; Provisional 99.45
TIGR02427251 protocat_pcaD 3-oxoadipate enol-lactonase. Members 99.45
COG2936 563 Predicted acyl esterases [General function predict 99.45
PLN02824294 hydrolase, alpha/beta fold family protein 99.45
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.44
TIGR02240276 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymer 99.44
TIGR01249306 pro_imino_pep_1 proline iminopeptidase, Neisseria- 99.43
PLN02965255 Probable pheophorbidase 99.43
PF08840213 BAAT_C: BAAT / Acyl-CoA thioester hydrolase C term 99.43
TIGR01836350 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synth 99.42
COG0400207 Predicted esterase [General function prediction on 99.42
PLN02894402 hydrolase, alpha/beta fold family protein 99.42
PRK03592295 haloalkane dehalogenase; Provisional 99.4
TIGR03695251 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene 99.4
PRK11071190 esterase YqiA; Provisional 99.4
KOG0315311 consensus G-protein beta subunit-like protein (con 99.4
KOG0279315 consensus G protein beta subunit-like protein [Sig 99.39
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 99.39
PLN02679360 hydrolase, alpha/beta fold family protein 99.39
TIGR01250288 pro_imino_pep_2 proline-specific peptidases, Bacil 99.38
KOG0286343 consensus G-protein beta subunit [General function 99.38
TIGR01738245 bioH putative pimeloyl-BioC--CoA transferase BioH. 99.37
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 99.37
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 99.36
PRK03204286 haloalkane dehalogenase; Provisional 99.35
PRK10439411 enterobactin/ferric enterobactin esterase; Provisi 99.35
COG3509312 LpqC Poly(3-hydroxybutyrate) depolymerase [Seconda 99.35
COG0429345 Predicted hydrolase of the alpha/beta-hydrolase fo 99.35
TIGR03101266 hydr2_PEP hydrolase, ortholog 2, exosortase system 99.34
PRK07581339 hypothetical protein; Validated 99.34
KOG0291893 consensus WD40-repeat-containing subunit of the 18 99.33
PRK14875371 acetoin dehydrogenase E2 subunit dihydrolipoyllysi 99.33
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.32
KOG0291893 consensus WD40-repeat-containing subunit of the 18 99.31
PF12697228 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3 99.31
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 99.31
PRK06489360 hypothetical protein; Provisional 99.31
PRK10349256 carboxylesterase BioH; Provisional 99.31
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 99.29
KOG3043242 consensus Predicted hydrolase related to dienelact 99.28
KOG0973 942 consensus Histone transcription regulator HIRA, WD 99.28
PLN02578354 hydrolase 99.28
KOG3101283 consensus Esterase D [General function prediction 99.27
KOG2055514 consensus WD40 repeat protein [General function pr 99.27
KOG0279315 consensus G protein beta subunit-like protein [Sig 99.27
PRK11028330 6-phosphogluconolactonase; Provisional 99.26
PLN03084383 alpha/beta hydrolase fold protein; Provisional 99.26
KOG0318603 consensus WD40 repeat stress protein/actin interac 99.26
KOG0266456 consensus WD40 repeat-containing protein [General 99.26
PRK08775343 homoserine O-acetyltransferase; Provisional 99.25
KOG0286343 consensus G-protein beta subunit [General function 99.23
KOG4667269 consensus Predicted esterase [Lipid transport and 99.23
TIGR01392351 homoserO_Ac_trn homoserine O-acetyltransferase. Th 99.22
PRK11126242 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxyl 99.22
PF12740259 Chlorophyllase2: Chlorophyllase enzyme; InterPro: 99.21
KOG0293519 consensus WD40 repeat-containing protein [Function 99.21
KOG4409365 consensus Predicted hydrolase/acyltransferase (alp 99.21
PRK00175379 metX homoserine O-acetyltransferase; Provisional 99.2
KOG0263707 consensus Transcription initiation factor TFIID, s 99.19
PF00756251 Esterase: Putative esterase; InterPro: IPR000801 T 99.19
PLN02211273 methyl indole-3-acetate methyltransferase 99.18
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 99.17
KOG1407313 consensus WD40 repeat protein [Function unknown] 99.17
KOG0266456 consensus WD40 repeat-containing protein [General 99.17
KOG1838409 consensus Alpha/beta hydrolase [General function p 99.17
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 99.16
KOG2314698 consensus Translation initiation factor 3, subunit 99.16
PRK11028330 6-phosphogluconolactonase; Provisional 99.15
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 99.15
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.13
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 99.13
KOG4497447 consensus Uncharacterized conserved protein WDR8, 99.13
PLN00181793 protein SPA1-RELATED; Provisional 99.12
KOG1454326 consensus Predicted hydrolase/acyltransferase (alp 99.12
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 99.11
KOG4627270 consensus Kynurenine formamidase [Amino acid trans 99.09
KOG2096420 consensus WD40 repeat protein [General function pr 99.08
PRK13616591 lipoprotein LpqB; Provisional 99.07
KOG2055514 consensus WD40 repeat protein [General function pr 99.06
KOG0265338 consensus U5 snRNP-specific protein-like factor an 99.06
PF03403379 PAF-AH_p_II: Platelet-activating factor acetylhydr 99.06
PF03583290 LIP: Secretory lipase ; InterPro: IPR005152 This e 99.05
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 99.05
PRK05855 582 short chain dehydrogenase; Validated 99.05
KOG1407313 consensus WD40 repeat protein [Function unknown] 99.05
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 99.05
KOG0973942 consensus Histone transcription regulator HIRA, WD 99.04
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 99.02
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 99.02
KOG0296399 consensus Angio-associated migratory cell protein 99.02
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.02
PF08538303 DUF1749: Protein of unknown function (DUF1749); In 98.99
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 98.99
PRK06765389 homoserine O-acetyltransferase; Provisional 98.99
KOG2984277 consensus Predicted hydrolase [General function pr 98.98
PLN029801655 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesi 98.98
KOG0263707 consensus Transcription initiation factor TFIID, s 98.98
KOG1273405 consensus WD40 repeat protein [General function pr 98.95
KOG4497447 consensus Uncharacterized conserved protein WDR8, 98.95
PRK13616591 lipoprotein LpqB; Provisional 98.92
KOG0282503 consensus mRNA splicing factor [Function unknown] 98.92
KOG0265338 consensus U5 snRNP-specific protein-like factor an 98.91
COG0627316 Predicted esterase [General function prediction on 98.9
KOG0772641 consensus Uncharacterized conserved protein, conta 98.9
KOG0296399 consensus Angio-associated migratory cell protein 98.89
TIGR01838532 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, 98.88
KOG2096420 consensus WD40 repeat protein [General function pr 98.87
PRK07868 994 acyl-CoA synthetase; Validated 98.87
COG5354561 Uncharacterized protein, contains Trp-Asp (WD) rep 98.87
COG2382299 Fes Enterochelin esterase and related enzymes [Ino 98.87
PTZ00421493 coronin; Provisional 98.86
PTZ00421493 coronin; Provisional 98.85
KOG0772641 consensus Uncharacterized conserved protein, conta 98.84
PLN00181793 protein SPA1-RELATED; Provisional 98.84
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 98.82
cd00312 493 Esterase_lipase Esterases and lipases (includes fu 98.81
PF07224307 Chlorophyllase: Chlorophyllase; InterPro: IPR01082 98.8
PF09752348 DUF2048: Uncharacterized conserved protein (DUF204 98.8
KOG2314698 consensus Translation initiation factor 3, subunit 98.8
PF05728187 UPF0227: Uncharacterised protein family (UPF0227); 98.79
PTZ00420568 coronin; Provisional 98.79
PF00561230 Abhydrolase_1: alpha/beta hydrolase fold A web pag 98.79
KOG0639705 consensus Transducin-like enhancer of split protei 98.79
COG3571213 Predicted hydrolase of the alpha/beta-hydrolase fo 98.78
KOG0275508 consensus Conserved WD40 repeat-containing protein 98.76
KOG2315566 consensus Predicted translation initiation factor 98.76
KOG0284464 consensus Polyadenylation factor I complex, subuni 98.74
COG5354561 Uncharacterized protein, contains Trp-Asp (WD) rep 98.72
PTZ00420568 coronin; Provisional 98.72
KOG1274 933 consensus WD40 repeat protein [General function pr 98.71
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 98.7
KOG2315566 consensus Predicted translation initiation factor 98.69
KOG0645312 consensus WD40 repeat protein [General function pr 98.67
TIGR01839560 PHA_synth_II poly(R)-hydroxyalkanoic acid synthase 98.64
KOG0645312 consensus WD40 repeat protein [General function pr 98.64
COG4188365 Predicted dienelactone hydrolase [General function 98.64
KOG3847399 consensus Phospholipase A2 (platelet-activating fa 98.64
KOG2112206 consensus Lysophospholipase [Lipid transport and m 98.63
KOG0643327 consensus Translation initiation factor 3, subunit 98.62
KOG2139445 consensus WD40 repeat protein [General function pr 98.62
PRK10115686 protease 2; Provisional 98.61
KOG0306888 consensus WD40-repeat-containing subunit of the 18 98.59
KOG2624403 consensus Triglyceride lipase-cholesterol esterase 98.56
KOG1274 933 consensus WD40 repeat protein [General function pr 98.55
KOG0282503 consensus mRNA splicing factor [Function unknown] 98.55
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 98.54
KOG2048691 consensus WD40 repeat protein [General function pr 98.53
PF02273294 Acyl_transf_2: Acyl transferase; InterPro: IPR0031 98.53
KOG0283712 consensus WD40 repeat-containing protein [Function 98.52
COG2272 491 PnbA Carboxylesterase type B [Lipid metabolism] 98.52
KOG2382315 consensus Predicted alpha/beta hydrolase [General 98.51
KOG2139445 consensus WD40 repeat protein [General function pr 98.51
COG2819264 Predicted hydrolase of the alpha/beta superfamily 98.5
PF00135 535 COesterase: Carboxylesterase family The prints ent 98.49
KOG0275508 consensus Conserved WD40 repeat-containing protein 98.47
KOG1539910 consensus WD repeat protein [General function pred 98.46
PF06342297 DUF1057: Alpha/beta hydrolase of unknown function 98.45
PF06821171 Ser_hydrolase: Serine hydrolase; InterPro: IPR0106 98.44
KOG0319775 consensus WD40-repeat-containing subunit of the 18 98.43
KOG1273405 consensus WD40 repeat protein [General function pr 98.41
KOG0283712 consensus WD40 repeat-containing protein [Function 98.39
COG4757281 Predicted alpha/beta hydrolase [General function p 98.38
KOG0771398 consensus Prolactin regulatory element-binding pro 98.38
COG1073299 Hydrolases of the alpha/beta superfamily [General 98.37
KOG1009434 consensus Chromatin assembly complex 1 subunit B/C 98.35
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 98.34
cd00707275 Pancreat_lipase_like Pancreatic lipase-like enzyme 98.32
COG3208244 GrsT Predicted thioesterase involved in non-riboso 98.31
KOG0284464 consensus Polyadenylation factor I complex, subuni 98.31
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 98.3
KOG0295406 consensus WD40 repeat-containing protein [Function 98.3
PF06057192 VirJ: Bacterial virulence protein (VirJ); InterPro 98.29
KOG0288459 consensus WD40 repeat protein TipD [General functi 98.28
KOG0639705 consensus Transducin-like enhancer of split protei 98.26
KOG2919406 consensus Guanine nucleotide-binding protein [Gene 98.25
KOG2919406 consensus Guanine nucleotide-binding protein [Gene 98.2
KOG2564343 consensus Predicted acetyltransferases and hydrola 98.18
KOG1009434 consensus Chromatin assembly complex 1 subunit B/C 98.17
KOG0640430 consensus mRNA cleavage stimulating factor complex 98.17
KOG0643327 consensus Translation initiation factor 3, subunit 98.16
KOG0319775 consensus WD40-repeat-containing subunit of the 18 98.16
KOG1553517 consensus Predicted alpha/beta hydrolase BAT5 [Gen 98.15
COG2021368 MET2 Homoserine acetyltransferase [Amino acid tran 98.14
PF10340374 DUF2424: Protein of unknown function (DUF2424); In 98.14
KOG1524737 consensus WD40 repeat-containing protein CHE-2 [Ge 98.13
KOG0306888 consensus WD40-repeat-containing subunit of the 18 98.12
KOG2106626 consensus Uncharacterized conserved protein, conta 98.11
KOG0288459 consensus WD40 repeat protein TipD [General functi 98.11
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 98.1
KOG0310487 consensus Conserved WD40 repeat-containing protein 98.1
KOG0278334 consensus Serine/threonine kinase receptor-associa 98.09
TIGR03230 442 lipo_lipase lipoprotein lipase. Members of this pr 98.08
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 98.08
PF10142367 PhoPQ_related: PhoPQ-activated pathogenicity-relat 98.06
PLN029191057 haloacid dehalogenase-like hydrolase family protei 98.06
KOG0289506 consensus mRNA splicing factor [General function p 98.06
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 98.06
COG0596282 MhpC Predicted hydrolases or acyltransferases (alp 98.05
KOG0310487 consensus Conserved WD40 repeat-containing protein 98.04
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 98.04
KOG0289506 consensus mRNA splicing factor [General function p 98.03
COG3545181 Predicted esterase of the alpha/beta hydrolase fol 98.03
KOG14451012 consensus Tumor-specific antigen (contains WD repe 98.02
KOG1332299 consensus Vesicle coat complex COPII, subunit SEC1 98.02
KOG0647347 consensus mRNA export protein (contains WD40 repea 98.01
KOG2551230 consensus Phospholipase/carboxyhydrolase [Amino ac 98.01
KOG0295406 consensus WD40 repeat-containing protein [Function 97.99
KOG0299479 consensus U3 snoRNP-associated protein (contains W 97.95
PF1214679 Hydrolase_4: Putative lysophospholipase; InterPro: 97.95
PF03959212 FSH1: Serine hydrolase (FSH1); InterPro: IPR005645 97.94
KOG0277311 consensus Peroxisomal targeting signal type 2 rece 97.93
KOG0640430 consensus mRNA cleavage stimulating factor complex 97.93
KOG0316307 consensus Conserved WD40 repeat-containing protein 97.93
PF05677365 DUF818: Chlamydia CHLPS protein (DUF818); InterPro 97.93
PLN029191057 haloacid dehalogenase-like hydrolase family protei 97.91
KOG2394636 consensus WD40 protein DMR-N9 [General function pr 97.9
TIGR01849406 PHB_depoly_PhaZ polyhydroxyalkanoate depolymerase, 97.87
KOG1523361 consensus Actin-related protein Arp2/3 complex, su 97.86
KOG2394636 consensus WD40 protein DMR-N9 [General function pr 97.85
COG3386307 Gluconolactonase [Carbohydrate transport and metab 97.85
KOG1524737 consensus WD40 repeat-containing protein CHE-2 [Ge 97.83
KOG2048691 consensus WD40 repeat protein [General function pr 97.82
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 97.81
KOG0278334 consensus Serine/threonine kinase receptor-associa 97.8
KOG0650733 consensus WD40 repeat nucleolar protein Bop1, invo 97.79
TIGR03502792 lipase_Pla1_cef extracellular lipase, Pla-1/cef fa 97.78
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 97.77
KOG0771398 consensus Prolactin regulatory element-binding pro 97.77
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 97.76
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 97.72
PRK02888635 nitrous-oxide reductase; Validated 97.71
KOG0316307 consensus Conserved WD40 repeat-containing protein 97.69
PF11339 581 DUF3141: Protein of unknown function (DUF3141); In 97.67
COG3386307 Gluconolactonase [Carbohydrate transport and metab 97.67
KOG0641350 consensus WD40 repeat protein [General function pr 97.64
PF10230266 DUF2305: Uncharacterised conserved protein (DUF230 97.64
KOG0641350 consensus WD40 repeat protein [General function pr 97.64
KOG3253 784 consensus Predicted alpha/beta hydrolase [General 97.64
KOG1963792 consensus WD40 repeat protein [General function pr 97.62
KOG1063764 consensus RNA polymerase II elongator complex, sub 97.6
KOG14451012 consensus Tumor-specific antigen (contains WD repe 97.6
COG3243445 PhaC Poly(3-hydroxyalkanoate) synthetase [Lipid me 97.6
KOG0307 1049 consensus Vesicle coat complex COPII, subunit SEC3 97.59
KOG4378673 consensus Nuclear protein COP1 [Signal transductio 97.59
PF04762928 IKI3: IKI3 family; InterPro: IPR006849 Members of 97.59
KOG1007370 consensus WD repeat protein TSSC1, WD repeat super 97.58
KOG0294362 consensus WD40 repeat-containing protein [Function 97.57
KOG0313423 consensus Microtubule binding protein YTM1 (contai 97.56
COG4947227 Uncharacterized protein conserved in bacteria [Fun 97.56
KOG0292 1202 consensus Vesicle coat complex COPI, alpha subunit 97.55
PRK04940180 hypothetical protein; Provisional 97.54
KOG1034385 consensus Transcriptional repressor EED/ESC/FIE, r 97.5
KOG2110391 consensus Uncharacterized conserved protein, conta 97.48
PF06028255 DUF915: Alpha/beta hydrolase of unknown function ( 97.48
KOG1036323 consensus Mitotic spindle checkpoint protein BUB3, 97.44
TIGR02171912 Fb_sc_TIGR02171 Fibrobacter succinogenes paralogou 97.44
KOG1036323 consensus Mitotic spindle checkpoint protein BUB3, 97.42
PF11144403 DUF2920: Protein of unknown function (DUF2920); In 97.41
KOG2106626 consensus Uncharacterized conserved protein, conta 97.41
KOG0277311 consensus Peroxisomal targeting signal type 2 rece 97.4
KOG1516 545 consensus Carboxylesterase and related proteins [G 97.39
KOG0650733 consensus WD40 repeat nucleolar protein Bop1, invo 97.39
PF12048310 DUF3530: Protein of unknown function (DUF3530); In 97.39
KOG0285460 consensus Pleiotropic regulator 1 [RNA processing 97.37
KOG0264422 consensus Nucleosome remodeling factor, subunit CA 97.35
KOG0292 1202 consensus Vesicle coat complex COPI, alpha subunit 97.35
PF0767639 PD40: WD40-like Beta Propeller Repeat; InterPro: I 97.34
PF00975229 Thioesterase: Thioesterase domain; InterPro: IPR00 97.31
PRK02888635 nitrous-oxide reductase; Validated 97.29
KOG2110391 consensus Uncharacterized conserved protein, conta 97.27
KOG0268433 consensus Sof1-like rRNA processing protein (conta 97.27
KOG1539910 consensus WD repeat protein [General function pred 97.27
KOG0307 1049 consensus Vesicle coat complex COPII, subunit SEC3 97.25
KOG0313423 consensus Microtubule binding protein YTM1 (contai 97.24
COG3490366 Uncharacterized protein conserved in bacteria [Fun 97.24
TIGR02171912 Fb_sc_TIGR02171 Fibrobacter succinogenes paralogou 97.24
COG1770682 PtrB Protease II [Amino acid transport and metabol 97.23
KOG0303472 consensus Actin-binding protein Coronin, contains 97.23
KOG4378673 consensus Nuclear protein COP1 [Signal transductio 97.22
KOG0269839 consensus WD40 repeat-containing protein [Function 97.21
KOG0264422 consensus Nucleosome remodeling factor, subunit CA 97.21
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 97.2
KOG0290364 consensus Conserved WD40 repeat-containing protein 97.2
KOG0285460 consensus Pleiotropic regulator 1 [RNA processing 97.19
KOG0647347 consensus mRNA export protein (contains WD40 repea 97.14
COG1506620 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-pept 97.12
KOG1332299 consensus Vesicle coat complex COPII, subunit SEC1 97.11
KOG0294362 consensus WD40 repeat-containing protein [Function 97.1
PF07819225 PGAP1: PGAP1-like protein; InterPro: IPR012908 The 97.08
PLN02733440 phosphatidylcholine-sterol O-acyltransferase 97.06
KOG1063764 consensus RNA polymerase II elongator complex, sub 97.06
PTZ00472462 serine carboxypeptidase (CBP1); Provisional 97.05
PF07082250 DUF1350: Protein of unknown function (DUF1350); In 97.05
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 97.0
PF05577 434 Peptidase_S28: Serine carboxypeptidase S28; InterP 96.99
COG3150191 Predicted esterase [General function prediction on 96.98
PF07519 474 Tannase: Tannase and feruloyl esterase; InterPro: 96.98
PF05705240 DUF829: Eukaryotic protein of unknown function (DU 96.96
KOG1007370 consensus WD repeat protein TSSC1, WD repeat super 96.94
KOG4283397 consensus Transcription-coupled repair protein CSA 96.88
KOG14081080 consensus WD40 repeat protein [Function unknown] 96.86
KOG4283397 consensus Transcription-coupled repair protein CSA 96.85
KOG0303472 consensus Actin-binding protein Coronin, contains 96.85
KOG0268433 consensus Sof1-like rRNA processing protein (conta 96.81
PF03096283 Ndr: Ndr family; InterPro: IPR004142 This family c 96.8
KOG0321720 consensus WD40 repeat-containing protein L2DTL [Fu 96.77
KOG4328498 consensus WD40 protein [Function unknown] 96.76
PF0767639 PD40: WD40-like Beta Propeller Repeat; InterPro: I 96.71
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 96.69
KOG1963 792 consensus WD40 repeat protein [General function pr 96.68
KOG0299479 consensus U3 snoRNP-associated protein (contains W 96.67
KOG1523361 consensus Actin-related protein Arp2/3 complex, su 96.66
KOG0290364 consensus Conserved WD40 repeat-containing protein 96.64
KOG0302440 consensus Ribosome Assembly protein [General funct 96.55
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 96.5
KOG0308735 consensus Conserved WD40 repeat-containing protein 96.48
PF00151331 Lipase: Lipase; InterPro: IPR013818 Triglyceride l 96.46
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 96.45
COG3391381 Uncharacterized conserved protein [Function unknow 96.41
PF01674219 Lipase_2: Lipase (class 2); InterPro: IPR002918 Li 96.38
KOG4389 601 consensus Acetylcholinesterase/Butyrylcholinestera 96.35
KOG0646476 consensus WD40 repeat protein [General function pr 96.35
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 96.34
KOG0302440 consensus Ribosome Assembly protein [General funct 96.31
COG3391381 Uncharacterized conserved protein [Function unknow 96.31
KOG0646476 consensus WD40 repeat protein [General function pr 96.28
KOG2041 1189 consensus WD40 repeat protein [General function pr 96.27
KOG0281499 consensus Beta-TrCP (transducin repeats containing 96.26
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 96.25
KOG4328498 consensus WD40 protein [Function unknown] 96.24
KOG2321703 consensus WD40 repeat protein [General function pr 96.23
KOG4840299 consensus Predicted hydrolases or acyltransferases 96.21
KOG1034385 consensus Transcriptional repressor EED/ESC/FIE, r 96.17
KOG14081080 consensus WD40 repeat protein [Function unknown] 96.13
KOG0267825 consensus Microtubule severing protein katanin p80 96.1
KOG3967297 consensus Uncharacterized conserved protein [Funct 96.04
KOG0308735 consensus Conserved WD40 repeat-containing protein 95.95
PF00450415 Peptidase_S10: Serine carboxypeptidase; InterPro: 95.9
KOG0300481 consensus WD40 repeat-containing protein [Function 95.89
COG4814288 Uncharacterized protein with an alpha/beta hydrola 95.81
COG3204316 Uncharacterized protein conserved in bacteria [Fun 95.77
PF08386103 Abhydrolase_4: TAP-like protein; InterPro: IPR0135 95.75
COG2319466 FOG: WD40 repeat [General function prediction only 95.7
KOG0269839 consensus WD40 repeat-containing protein [Function 95.64
PF05694461 SBP56: 56kDa selenium binding protein (SBP56); Int 95.58
KOG2182 514 consensus Hydrolytic enzymes of the alpha/beta hyd 95.49
KOG4388 880 consensus Hormone-sensitive lipase HSL [Lipid tran 95.48
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 95.48
KOG2111346 consensus Uncharacterized conserved protein, conta 95.4
COG3204316 Uncharacterized protein conserved in bacteria [Fun 95.34
KOG0270463 consensus WD40 repeat-containing protein [Function 95.19
PF11187224 DUF2974: Protein of unknown function (DUF2974); In 95.05
KOG2111346 consensus Uncharacterized conserved protein, conta 94.99
KOG4532344 consensus WD40-like repeat containing protein [Gen 94.87
KOG2931326 consensus Differentiation-related gene 1 protein ( 94.85
PF13449326 Phytase-like: Esterase-like activity of phytase 94.69
COG3319257 Thioesterase domains of type I polyketide synthase 94.69
COG3490366 Uncharacterized protein conserved in bacteria [Fun 94.56
PF05990233 DUF900: Alpha/beta hydrolase of unknown function ( 94.27
PRK102521296 entF enterobactin synthase subunit F; Provisional 94.22
KOG2183 492 consensus Prolylcarboxypeptidase (angiotensinase C 94.22
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 94.15
KOG0267 825 consensus Microtubule severing protein katanin p80 94.08
COG3946456 VirJ Type IV secretory pathway, VirJ component [In 94.08
PRK13614573 lipoprotein LpqB; Provisional 94.06
KOG2100755 consensus Dipeptidyl aminopeptidase [Posttranslati 93.84
KOG1551371 consensus Uncharacterized conserved protein [Funct 93.66
PRK13614573 lipoprotein LpqB; Provisional 93.54
KOG2041 1189 consensus WD40 repeat protein [General function pr 93.48
KOG0301745 consensus Phospholipase A2-activating protein (con 93.43
COG4782377 Uncharacterized protein conserved in bacteria [Fun 93.39
KOG3975301 consensus Uncharacterized conserved protein [Funct 93.31
KOG2565469 consensus Predicted hydrolases or acyltransferases 93.17
KOG0276 794 consensus Vesicle coat complex COPI, beta' subunit 93.12
COG2319466 FOG: WD40 repeat [General function prediction only 92.95
PRK13615557 lipoprotein LpqB; Provisional 92.82
PLN02209437 serine carboxypeptidase 92.65
TIGR02604367 Piru_Ver_Nterm putative membrane-bound dehydrogena 92.59
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 92.56
TIGR02604367 Piru_Ver_Nterm putative membrane-bound dehydrogena 92.56
PRK13615557 lipoprotein LpqB; Provisional 92.52
PRK13613599 lipoprotein LpqB; Provisional 92.48
PF01764140 Lipase_3: Lipase (class 3); InterPro: IPR002921 Tr 92.46
cd00741153 Lipase Lipase. Lipases are esterases that can hydr 92.35
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 92.25
KOG1912 1062 consensus WD40 repeat protein [General function pr 92.13
KOG4547541 consensus WD40 repeat-containing protein [General 92.06
KOG4227609 consensus WD40 repeat protein [General function pr 92.02
KOG1282454 consensus Serine carboxypeptidases (lysosomal cath 91.65
TIGR03606454 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH 91.65
PF05057217 DUF676: Putative serine esterase (DUF676); InterPr 91.59
PRK13613599 lipoprotein LpqB; Provisional 91.5
PF02450389 LCAT: Lecithin:cholesterol acyltransferase; InterP 91.24
KOG4532344 consensus WD40-like repeat containing protein [Gen 91.23
PLN03016433 sinapoylglucose-malate O-sinapoyltransferase 91.06
KOG3621726 consensus WD40 repeat-containing protein [General 91.06
KOG1354433 consensus Serine/threonine protein phosphatase 2A, 90.79
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 90.57
KOG1587555 consensus Cytoplasmic dynein intermediate chain [C 90.52
PF07995331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 90.44
KOG4547541 consensus WD40 repeat-containing protein [General 90.42
KOG3914390 consensus WD repeat protein WDR4 [Function unknown 90.35
PF11768545 DUF3312: Protein of unknown function (DUF3312); In 90.27
PF03283361 PAE: Pectinacetylesterase 90.09
KOG0300481 consensus WD40 repeat-containing protein [Function 89.95
smart00824212 PKS_TE Thioesterase. Peptide synthetases are invol 89.85
PF06259177 Abhydrolase_8: Alpha/beta hydrolase; InterPro: IPR 89.78
KOG1520376 consensus Predicted alkaloid synthase/Surface muci 89.54
COG4287507 PqaA PhoPQ-activated pathogenicity-related protein 89.38
>COG1506 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism] Back     alignment and domain information 
Probab=100.00  E-value=4.4e-44  Score=419.67  Aligned_cols=599  Identities=18%  Similarity=0.230  Sum_probs=390.1

Q ss_pred             HHHhhcCCCCCCceecCCCCEEEEEecCCCCCchhcccccceeeceeecCCCCCccceeeEeceeEEEccCCCCCCceee
Q 002164          102 IREIVDAPPLPALSFSPQRDKILFLKRRALPPLEELARPEEKLAGLRIDGKCNTRSRMSFYTGIGIHQLFPDGKLGQEIE  181 (958)
Q Consensus       102 ~~~~~~~~~~~~~~~SPDG~~laf~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~i~~~~~dg~~~~~~~  181 (958)
                      ..+++....+..+.++|+|+.++|....                   ++.......     +.+|+.+..      ..+.
T Consensus         6 ~~~~~~~~~~~~~~~~~~~~~~~~i~~~-------------------~~~~~~~~~-----~~~~~~d~~------~~~~   55 (620)
T COG1506           6 AEDLLALARVSDPRVSPPGGRLAYILTG-------------------LDFLKPLYK-----SSLWVSDGK------TVRL   55 (620)
T ss_pred             HHHHHhhhcccCcccCCCCceeEEeecc-------------------ccccccccc-----cceEEEecc------cccc
Confidence            4466667788899999999999999874                   222222211     467775431      1112


Q ss_pred             eccCCCCCcccceeecCCCCeEEEEEeeccccCCCCCceEEEEEcCCCceeeccCCCCccccccccceEEecCCeEEEEE
Q 002164          182 IQGFPDGAKLNFVTWSQDGKHLAFSIRIDAEDSSSSKLRVWVADVDTGKARPLFQSPDIYLNAIFDNFVWVNNSTLLVCT  261 (958)
Q Consensus       182 lt~~~~~~~~~~~~wSPDG~~iaf~~~~~~~~~~~~~~~l~~~~~~~g~~~~lt~~~~~~~~~~~~~~~wspDG~~l~~~  261 (958)
                         .+.+..+..+.|||||+.++|...     .+....++|+++.+ |   .++.....     +....|+|+|+.+++.
T Consensus        56 ---~~~~~~~~~~~~spdg~~~~~~~~-----~~~~~~~l~l~~~~-g---~~~~~~~~-----v~~~~~~~~g~~~~~~  118 (620)
T COG1506          56 ---LTFGGGVSELRWSPDGSVLAFVST-----DGGRVAQLYLVDVG-G---LITKTAFG-----VSDARWSPDGDRIAFL  118 (620)
T ss_pred             ---cccCCcccccccCCCCCEEEEEec-----cCCCcceEEEEecC-C---ceeeeecc-----cccceeCCCCCeEEEE
Confidence               224457899999999999999762     12336899999987 4   22221221     5688999999999984


Q ss_pred             ecCCCCCCCCC-CCCCCCCceeeecCCcccccchhhhhccCchhhhHHHHhhcceEEEEEcCCeeeecCCC-cccccccc
Q 002164          262 IPLLRGDPPKK-PLVPLGPKMQSNEKRDIIQVRTFQDLLKDEYDEDLFDYYATTQLVLVSLDGTVKEIGPP-AVYTSLDP  339 (958)
Q Consensus       262 ~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~r~~~d~~~~~~~~~~~~~~~~~~l~~~~~~g~~~~l~~~-~~~~~~~~  339 (958)
                      ........... ...+....++.                 +.++      ....++|+++..+....+... ..+..+.+
T Consensus       119 ~~~~~~~~~~~~~~~~~~~~~~~-----------------~~~g------~~~~~l~~~d~~~~~~~~~~~~~~~~~~~~  175 (620)
T COG1506         119 TAEGASKRDGGDHLFVDRLPVWF-----------------DGRG------GERSDLYVVDIESKLIKLGLGNLDVVSFAT  175 (620)
T ss_pred             ecccccccCCceeeeecccceee-----------------cCCC------CcccceEEEccCcccccccCCCCceeeeee
Confidence            22211110000 00000000000                 0000      134678899884344444444 66677778


Q ss_pred             CCCCcEEEEEeecCCccccccCCCCCceeEEEeccCceEEEeccCCccccCcccccccccCcceeeeecCCCCceEEEEe
Q 002164          340 SPDEKYILISSIHRPYSFIVPCGRFPRQVGVWTTDGIFVRELCDLPLAEDIPIAFNSVRKGMRSINWRSDKPSTLYWAET  419 (958)
Q Consensus       340 SpDGk~l~~~~~~~~~~~~~~~~~~~~~i~l~d~~~~~~~~l~~~~~~~~~p~~~~~~~~~~~~~~~spDG~~l~~~~~~  419 (958)
                      ++|++.++.......      .........++....+....++..+             .+...+.|.+||+.+++....
T Consensus       176 ~~~~~~~~~~~~~~~------~~~~~~~~~~~~~~~~~~~~~~~~~-------------~~~~~~~~~~~gk~~~~~~~~  236 (620)
T COG1506         176 DGDGRLVASIRLDDD------ADPWVTNLYVLIEGNGELESLTPGE-------------GSISKLAFDADGKSIALLGTE  236 (620)
T ss_pred             CCCCceeEEeeeccc------cCCceEeeEEEecCCCceEEEcCCC-------------ceeeeeeeCCCCCeeEEeccC
Confidence            877888877764432      0111223444433344444444332             224567889999988775332


Q ss_pred             ccCCCcccccccCCeEEEEeCCCCCCCCceEEEeeccccCceeeecCCceEEEEEeccccceEEEEEcCCCCCCCcEEEe
Q 002164          420 QDGGDAKVEVTPRDIIYTQQAEPVQGEGPEILHKLDLRYGGISWCDDSLALVYESWYKTRRTRTWVISPGSKDVAPRILF  499 (958)
Q Consensus       420 ~~~~~~~~~~~~~~~l~~~~~~~~~g~~~~~l~~~~~~~~~~~~spDg~~l~~~~~~~~~~~~l~~~~~~~~~~~~~~~~  499 (958)
                      .+. ..    .....+++++.   +.+....                                    ++...  . . ..
T Consensus       237 ~~~-~~----~~~~~~~~~~~---~~~~~d~------------------------------------~~~~~--~-~-~~  268 (620)
T COG1506         237 SDR-GL----AEGDFILLLDG---ELGEVDG------------------------------------DLSSG--D-D-TR  268 (620)
T ss_pred             Ccc-Cc----cccceEEEEec---cccccce------------------------------------eeccC--C-c-cc
Confidence            211 00    11112222220   0000000                                    00000  0 0 00


Q ss_pred             ccCCccccCCCCCCceEeccCCceEEEEeeeccCCCcEEEEccCCCCCCCCCCeEEEEECCCCceEEEecCCccccccee
Q 002164          500 DRSSEDVYSDPGSPMMRRTSTGTYVIAKIKKENDEGTYILLNGNGATPEGNIPFLDLFDINTGSKERIWESDKEKYYETT  579 (958)
Q Consensus       500 ~~~~~~~~~~~~~~~~~~spdG~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~~~dl~~g~~~~l~~~~~~~~~~~~  579 (958)
                       . ...         ..+.-++..++|.....                 .....++..+...+. ..+...+..      
T Consensus       269 -~-~~~---------~~~~~~~~~~~~~~~~~-----------------~g~~~l~~~~~~~~~-~~~~~~~~~------  313 (620)
T COG1506         269 -G-AWA---------VEGGLDGDGLLFIATDG-----------------GGSSPLFRVDDLGGG-VEGLSGDDG------  313 (620)
T ss_pred             -C-cHH---------hccccCCCcEEEEEecC-----------------CCceEEEEEeccCCc-eeeecCCCc------
Confidence             0 000         00112333344443210                 001112222222222 222222211      


Q ss_pred             EeecCCCccccccccCCEEEEEEecCCCCceEEEEECCCCCeeEeecC-CCCCCCCCCCcEEEEEEEeCCCeEEEEEEEe
Q 002164          580 VALMSDQTEGDLYLNQLKILTSKESKTENTQYYIQSWPDKKSCQITDF-PHPYPQLASLQKELIKYQRKDGVQLSATLYL  658 (958)
Q Consensus       580 ~~~~~~~~~~~~s~dg~~l~~~~~s~~~p~~~~~~d~~~g~~~~Lt~~-~~~~~~~~~~~~~~~~~~~~dg~~l~~~l~~  658 (958)
                             .-..|+.+++.+++..+++..|+++|+++.  ++..+++.. +..+......++|.+++++.||.++++++++
T Consensus       314 -------~v~~f~~~~~~~~~~~s~~~~p~~i~~~~~--~~~~~~~~~~~~~~~~~~~~~~e~~~~~~~dG~~i~~~l~~  384 (620)
T COG1506         314 -------GVPGFDVDGRKLALAYSSPTEPPEIYLYDR--GEEAKLTSSNNSGLKKVKLAEPEPVTYKSNDGETIHGWLYK  384 (620)
T ss_pred             -------eEEEEeeCCCEEEEEecCCCCccceEEEcC--CCceEEeecccccccccccCCceEEEEEcCCCCEEEEEEec
Confidence                   012455689999999999999999999987  444555544 3444567778899999999999999999999


Q ss_pred             cCCCCCCCCCCceEEEEECCCCCcCcccCCcccCCCCCCCCcCcHHHHHHHHCCcEEEEcCCCCCCCCCCcccc---hhh
Q 002164          659 PPGYDPSKDGPLPCLFWSYPGEFKSKDAAGQVRGSPNEFPRIGSTSVLLWLARGFAILGGPTTPIIGEGDEEAN---DRF  735 (958)
Q Consensus       659 P~~~~~~~~~~~P~vv~~hGg~~~~~~~~~~~~~~~~~~~~~~~~~~~~la~~G~~vl~~~~~~~~G~G~~~~~---~~~  735 (958)
                      |+++++.++  +|+||++||||.....             .......+.|+++||+|+.++++|+.|||+++..   .++
T Consensus       385 P~~~~~~k~--yP~i~~~hGGP~~~~~-------------~~~~~~~q~~~~~G~~V~~~n~RGS~GyG~~F~~~~~~~~  449 (620)
T COG1506         385 PPGFDPRKK--YPLIVYIHGGPSAQVG-------------YSFNPEIQVLASAGYAVLAPNYRGSTGYGREFADAIRGDW  449 (620)
T ss_pred             CCCCCCCCC--CCEEEEeCCCCccccc-------------cccchhhHHHhcCCeEEEEeCCCCCCccHHHHHHhhhhcc
Confidence            999987765  9999999999843221             1122457789999999999999999999998764   355


Q ss_pred             HHHHHHHHHHHHHHHHHcCCCCCCcEEEEEeChHHHHHHHHHHhCCCceeEEEEeccCCCCCCCCCCcccc---------
Q 002164          736 VEQLVACAEAAVEEVVRRGVAHPSKIAVGGHSYGAFMTANLLAHAPHLFCCGIARSGAYNRTLTPFGFQNE---------  806 (958)
Q Consensus       736 ~~~~~~D~~~av~~l~~~~~~d~~~i~l~G~S~GG~~a~~~a~~~p~~~~a~v~~~~~~~~~~~~~~~~~~---------  806 (958)
                      +...++|++++++++.+++.+|++||+|+|+||||+|+++++++.| +|+|+++..+.+++..........         
T Consensus       450 g~~~~~D~~~~~~~l~~~~~~d~~ri~i~G~SyGGymtl~~~~~~~-~f~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  528 (620)
T COG1506         450 GGVDLEDLIAAVDALVKLPLVDPERIGITGGSYGGYMTLLAATKTP-RFKAAVAVAGGVDWLLYFGESTEGLRFDPEENG  528 (620)
T ss_pred             CCccHHHHHHHHHHHHhCCCcChHHeEEeccChHHHHHHHHHhcCc-hhheEEeccCcchhhhhccccchhhcCCHHHhC
Confidence            6678999999999999999999999999999999999999999996 899998888877755433222111         


Q ss_pred             cchhhhcHHHHHhcCcccccCCCCCCEEEEeeCCCCCCCCChHHHHHHHHHHHhCCCcEEEEEeCCCCccCCCcccHHHH
Q 002164          807 DRTLWEATSTYVEMSPFMSANKLKKPILLVHGEEDNNSGTLTMQSDRFFNALKGHGALCRLVILPFESHGYAARESIMHV  886 (958)
Q Consensus       807 ~~~~~~~~~~~~~~sp~~~~~~~~~P~Lii~G~~D~~v~~~~~~~~~~~~~l~~~g~~~~~~~~p~~~H~~~~~~~~~~~  886 (958)
                      ....+ +.+.|.+.||+.+++++++|+|||||++|.+||  .+|+++|+++|+..|+++++++||+++|++..+++....
T Consensus       529 ~~~~~-~~~~~~~~sp~~~~~~i~~P~LliHG~~D~~v~--~~q~~~~~~aL~~~g~~~~~~~~p~e~H~~~~~~~~~~~  605 (620)
T COG1506         529 GGPPE-DREKYEDRSPIFYADNIKTPLLLIHGEEDDRVP--IEQAEQLVDALKRKGKPVELVVFPDEGHGFSRPENRVKV  605 (620)
T ss_pred             CCccc-ChHHHHhcChhhhhcccCCCEEEEeecCCccCC--hHHHHHHHHHHHHcCceEEEEEeCCCCcCCCCchhHHHH
Confidence            11222 677899999999999999999999999999999  999999999999999999999999999999988889999


Q ss_pred             HHHHHHHHHHhhcc
Q 002164          887 LWETDRWLQKYCVS  900 (958)
Q Consensus       887 ~~~i~~fl~~~l~~  900 (958)
                      ++++++||.+|++.
T Consensus       606 ~~~~~~~~~~~~~~  619 (620)
T COG1506         606 LKEILDWFKRHLKQ  619 (620)
T ss_pred             HHHHHHHHHHHhcC
Confidence            99999999999863

>PRK10115 protease 2; Provisional Back     alignment and domain information
>KOG2100 consensus Dipeptidyl aminopeptidase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2281 consensus Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1770 PtrB Protease II [Amino acid transport and metabolism] Back     alignment and domain information
>PF00326 Peptidase_S9: Prolyl oligopeptidase family This family belongs to family S9 of the peptidase classification Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG1505 Serine proteases of the peptidase family S9A [Amino acid transport and metabolism] Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2237 consensus Predicted serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK10566 esterase; Provisional Back     alignment and domain information
>KOG1455 consensus Lysophospholipase [Lipid transport and metabolism] Back     alignment and domain information
>PLN02298 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK13604 luxD acyl transferase; Provisional Back     alignment and domain information
>PF05448 AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR008391 This family consists of several bacterial acetyl xylan esterase proteins Back     alignment and domain information
>PRK05077 frsA fermentation/respiration switch protein; Reviewed Back     alignment and domain information
>TIGR02821 fghA_ester_D S-formylglutathione hydrolase Back     alignment and domain information
>PF01738 DLH: Dienelactone hydrolase family; InterPro: IPR002925 Dienelactone hydrolases play a crucial role in chlorocatechol degradation via the modified ortho cleavage pathway Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PLN02385 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>PLN02442 S-formylglutathione hydrolase Back     alignment and domain information
>PHA02857 monoglyceride lipase; Provisional Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG4391 consensus Predicted alpha/beta hydrolase BEM46 [General function prediction only] Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PRK10749 lysophospholipase L2; Provisional Back     alignment and domain information
>COG0412 Dienelactone hydrolase and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>KOG1552 consensus Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PRK10162 acetyl esterase; Provisional Back     alignment and domain information
>PRK05371 x-prolyl-dipeptidyl aminopeptidase; Provisional Back     alignment and domain information
>PLN02652 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>COG3458 Acetyl esterase (deacetylase) [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>COG2267 PldB Lysophospholipase [Lipid metabolism] Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>PRK11460 putative hydrolase; Provisional Back     alignment and domain information
>COG1647 Esterase/lipase [General function prediction only] Back     alignment and domain information
>TIGR00976 /NonD putative hydrolase, CocE/NonD family Back     alignment and domain information
>PF12715 Abhydrolase_7: Abhydrolase family; PDB: 3NUZ_C 3G8Y_A Back     alignment and domain information
>KOG1515 consensus Arylacetamide deacetylase [Defense mechanisms] Back     alignment and domain information
>PF02129 Peptidase_S15: X-Pro dipeptidyl-peptidase (S15 family); InterPro: IPR000383 This entry represents a domain found peptidases Xaa-Pro dipeptidyl-peptidase and glutaryl-7-aminocephalosporanic-acid acylase, which belong to MEROPS peptidase families S15 and S45 respectively [] Back     alignment and domain information
>TIGR01840 esterase_phb esterase, PHB depolymerase family Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>COG0657 Aes Esterase/lipase [Lipid metabolism] Back     alignment and domain information
>PF06500 DUF1100: Alpha/beta hydrolase of unknown function (DUF1100); InterPro: IPR010520 Proteins in this entry display esterase activity toward pNP-butyrate [] Back     alignment and domain information
>TIGR03100 hydr1_PEP hydrolase, ortholog 1, exosortase system type 1 associated Back     alignment and domain information
>TIGR01607 PST-A Plasmodium subtelomeric family (PST-A) Back     alignment and domain information
>COG4099 Predicted peptidase [General function prediction only] Back     alignment and domain information
>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>PF07859 Abhydrolase_3: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>PF12695 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3D0K_B 2I3D_B 3DOH_B 3DOI_B 3PFB_A 3S2Z_B 3PFC_A 3QM1_A 3PF8_B 3PF9_A Back     alignment and domain information
>COG2945 Predicted hydrolase of the alpha/beta superfamily [General function prediction only] Back     alignment and domain information
>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>PLN02511 hydrolase Back     alignment and domain information
>PF02230 Abhydrolase_2: Phospholipase/Carboxylesterase; InterPro: IPR003140 This entry represents the alpha/beta hydrolase domain found in phospholipases [], carboxylesterases [] and thioesterases Back     alignment and domain information
>TIGR03343 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase Back     alignment and domain information
>TIGR03611 RutD pyrimidine utilization protein D Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>PF10503 Esterase_phd: Esterase PHB depolymerase Back     alignment and domain information
>PRK00870 haloalkane dehalogenase; Provisional Back     alignment and domain information
>KOG4178 consensus Soluble epoxide hydrolase [Lipid transport and metabolism] Back     alignment and domain information
>PRK10985 putative hydrolase; Provisional Back     alignment and domain information
>PLN00021 chlorophyllase Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>TIGR03056 bchO_mg_che_rel putative magnesium chelatase accessory protein Back     alignment and domain information
>PLN02872 triacylglycerol lipase Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>PLN03087 BODYGUARD 1 domain containing hydrolase; Provisional Back     alignment and domain information
>PRK10673 acyl-CoA esterase; Provisional Back     alignment and domain information
>TIGR02427 protocat_pcaD 3-oxoadipate enol-lactonase Back     alignment and domain information
>COG2936 Predicted acyl esterases [General function prediction only] Back     alignment and domain information
>PLN02824 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>TIGR02240 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymerase Back     alignment and domain information
>TIGR01249 pro_imino_pep_1 proline iminopeptidase, Neisseria-type subfamily Back     alignment and domain information
>PLN02965 Probable pheophorbidase Back     alignment and domain information
>PF08840 BAAT_C: BAAT / Acyl-CoA thioester hydrolase C terminal; InterPro: IPR014940 Acyl-CoA thioesterases are a group of enzymes that catalyse the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acids and CoASH Back     alignment and domain information
>TIGR01836 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synthase, class III, PhaC subunit Back     alignment and domain information
>COG0400 Predicted esterase [General function prediction only] Back     alignment and domain information
>PLN02894 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PRK03592 haloalkane dehalogenase; Provisional Back     alignment and domain information
>TIGR03695 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Back     alignment and domain information
>PRK11071 esterase YqiA; Provisional Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02679 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>TIGR01250 pro_imino_pep_2 proline-specific peptidases, Bacillus coagulans-type subfamily Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>TIGR01738 bioH putative pimeloyl-BioC--CoA transferase BioH Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>PRK03204 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PRK10439 enterobactin/ferric enterobactin esterase; Provisional Back     alignment and domain information
>COG3509 LpqC Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG0429 Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only] Back     alignment and domain information
>TIGR03101 hydr2_PEP hydrolase, ortholog 2, exosortase system type 1 associated Back     alignment and domain information
>PRK07581 hypothetical protein; Validated Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>PF12697 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3LLC_A 3A2N_E 3A2M_A 3A2L_A 3AFI_F 3C5V_A 3C5W_P 3E0X_A 2ZJF_A 3QYJ_A Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>PRK06489 hypothetical protein; Provisional Back     alignment and domain information
>PRK10349 carboxylesterase BioH; Provisional Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3043 consensus Predicted hydrolase related to dienelactone hydrolase [General function prediction only] Back     alignment and domain information
>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>PLN02578 hydrolase Back     alignment and domain information
>KOG3101 consensus Esterase D [General function prediction only] Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>PLN03084 alpha/beta hydrolase fold protein; Provisional Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK08775 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>KOG4667 consensus Predicted esterase [Lipid transport and metabolism] Back     alignment and domain information
>TIGR01392 homoserO_Ac_trn homoserine O-acetyltransferase Back     alignment and domain information
>PRK11126 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase; Provisional Back     alignment and domain information
>PF12740 Chlorophyllase2: Chlorophyllase enzyme; InterPro: IPR010821 This family consists of several chlorophyllase proteins (3 Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG4409 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>PRK00175 metX homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>PF00756 Esterase: Putative esterase; InterPro: IPR000801 This family contains several seemingly unrelated proteins, including human esterase D; mycobacterial antigen 85, which is responsible for the high affinity of mycobacteria to fibronectin; Corynebacterium glutamicum major secreted protein PS1; and hypothetical proteins from Escherichia coli, yeast, mycobacteria and Haemophilus influenzae Back     alignment and domain information
>PLN02211 methyl indole-3-acetate methyltransferase Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1838 consensus Alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG1454 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>KOG4627 consensus Kynurenine formamidase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2096 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] Back     alignment and domain information
>PF03403 PAF-AH_p_II: Platelet-activating factor acetylhydrolase, isoform II; PDB: 3F98_B 3F97_B 3D59_A 3F96_A 3D5E_B 3F9C_A Back     alignment and domain information
>PF03583 LIP: Secretory lipase ; InterPro: IPR005152 This entry represents a family of secreted lipases Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>PF08538 DUF1749: Protein of unknown function (DUF1749); InterPro: IPR013744 This is a plant and fungal family of unknown function Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PRK06765 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>KOG2984 consensus Predicted hydrolase [General function prediction only] Back     alignment and domain information
>PLN02980 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesium ion binding / thiamin pyrophosphate binding Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>KOG1273 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only] Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] Back     alignment and domain information
>COG0627 Predicted esterase [General function prediction only] Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>TIGR01838 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, class I Back     alignment and domain information
>KOG2096 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK07868 acyl-CoA synthetase; Validated Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>COG2382 Fes Enterochelin esterase and related enzymes [Inorganic ion transport and metabolism] Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>cd00312 Esterase_lipase Esterases and lipases (includes fungal lipases, cholinesterases, etc Back     alignment and domain information
>PF07224 Chlorophyllase: Chlorophyllase; InterPro: IPR010821 This family consists of several chlorophyllase proteins (3 Back     alignment and domain information
>PF09752 DUF2048: Uncharacterized conserved protein (DUF2048); InterPro: IPR019149 This family of proteins has no known function Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF05728 UPF0227: Uncharacterised protein family (UPF0227); InterPro: IPR008886 Despite being classed as uncharacterised proteins, the members of this family are almost certainly enzymes in that they contain a domain distantly related to IPR000073 from INTERPRO Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>PF00561 Abhydrolase_1: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] Back     alignment and domain information
>COG3571 Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only] Back     alignment and domain information
>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0645 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>TIGR01839 PHA_synth_II poly(R)-hydroxyalkanoic acid synthase, class II Back     alignment and domain information
>KOG0645 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG4188 Predicted dienelactone hydrolase [General function prediction only] Back     alignment and domain information
>KOG3847 consensus Phospholipase A2 (platelet-activating factor acetylhydrolase in humans) [Lipid transport and metabolism] Back     alignment and domain information
>KOG2112 consensus Lysophospholipase [Lipid transport and metabolism] Back     alignment and domain information
>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] Back     alignment and domain information
>KOG2139 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG2624 consensus Triglyceride lipase-cholesterol esterase [Lipid transport and metabolism] Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF02273 Acyl_transf_2: Acyl transferase; InterPro: IPR003157 LuxD proteins are bacterial acyl transferases Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>COG2272 PnbA Carboxylesterase type B [Lipid metabolism] Back     alignment and domain information
>KOG2382 consensus Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>KOG2139 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG2819 Predicted hydrolase of the alpha/beta superfamily [General function prediction only] Back     alignment and domain information
>PF00135 COesterase: Carboxylesterase family The prints entry is specific to acetylcholinesterase; InterPro: IPR002018 Higher eukaryotes have many distinct esterases Back     alignment and domain information
>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>PF06342 DUF1057: Alpha/beta hydrolase of unknown function (DUF1057); InterPro: IPR010463 This entry consists of proteins of unknown function which have an alpha/beta hydrolase fold Back     alignment and domain information
>PF06821 Ser_hydrolase: Serine hydrolase; InterPro: IPR010662 This family contains a number of hypothetical bacterial proteins of unknown function, which may be cytosolic Back     alignment and domain information
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG1273 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>COG4757 Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG1073 Hydrolases of the alpha/beta superfamily [General function prediction only] Back     alignment and domain information
>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair] Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>cd00707 Pancreat_lipase_like Pancreatic lipase-like enzymes Back     alignment and domain information
>COG3208 GrsT Predicted thioesterase involved in non-ribosomal peptide biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PF06057 VirJ: Bacterial virulence protein (VirJ); InterPro: IPR010333 This entry contains several bacterial VirJ virulence proteins Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only] Back     alignment and domain information
>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only] Back     alignment and domain information
>KOG2564 consensus Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair] Back     alignment and domain information
>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] Back     alignment and domain information
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG1553 consensus Predicted alpha/beta hydrolase BAT5 [General function prediction only] Back     alignment and domain information
>COG2021 MET2 Homoserine acetyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PF10340 DUF2424: Protein of unknown function (DUF2424); InterPro: IPR019436 Sterol homeostasis in eukaryotic cells relies on the reciprocal interconversion of free sterols and steryl esters Back     alignment and domain information
>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only] Back     alignment and domain information
>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>TIGR03230 lipo_lipase lipoprotein lipase Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PF10142 PhoPQ_related: PhoPQ-activated pathogenicity-related protein; InterPro: IPR009199 Proteins in this entry are believed to play a role in virulence/pathogenicity in Salmonella Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>COG0596 MhpC Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>COG3545 Predicted esterase of the alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] Back     alignment and domain information
>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG2551 consensus Phospholipase/carboxyhydrolase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>PF12146 Hydrolase_4: Putative lysophospholipase; InterPro: IPR022742 This domain is found in bacteria and eukaryotes and is approximately 110 amino acids in length Back     alignment and domain information
>PF03959 FSH1: Serine hydrolase (FSH1); InterPro: IPR005645 This entry represents proteins belonging to the AB hydrolase family Back     alignment and domain information
>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PF05677 DUF818: Chlamydia CHLPS protein (DUF818); InterPro: IPR008536 This family of unknown function includes several Chlamydia CHLPS proteins and Legionella SidB proteins Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only] Back     alignment and domain information
>TIGR01849 PHB_depoly_PhaZ polyhydroxyalkanoate depolymerase, intracellular Back     alignment and domain information
>KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton] Back     alignment and domain information
>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only] Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only] Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR03502 lipase_Pla1_cef extracellular lipase, Pla-1/cef family Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PF11339 DUF3141: Protein of unknown function (DUF3141); InterPro: IPR024501 This family of proteins appears to be predominantly expressed in Proteobacteria Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0641 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF10230 DUF2305: Uncharacterised conserved protein (DUF2305); InterPro: IPR019363 This entry contains proteins that have no known function Back     alignment and domain information
>KOG0641 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG3253 consensus Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>KOG1963 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] Back     alignment and domain information
>COG3243 PhaC Poly(3-hydroxyalkanoate) synthetase [Lipid metabolism] Back     alignment and domain information
>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown] Back     alignment and domain information
>KOG0294 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] Back     alignment and domain information
>COG4947 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK04940 hypothetical protein; Provisional Back     alignment and domain information
>KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription] Back     alignment and domain information
>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>PF06028 DUF915: Alpha/beta hydrolase of unknown function (DUF915); InterPro: IPR010315 This family consists of bacterial proteins of unknown function, which are hydrolase-like Back     alignment and domain information
>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR02171 Fb_sc_TIGR02171 Fibrobacter succinogenes paralogous family TIGR02171 Back     alignment and domain information
>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF11144 DUF2920: Protein of unknown function (DUF2920); InterPro: IPR022605 This bacterial family of proteins has no known function Back     alignment and domain information
>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] Back     alignment and domain information
>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1516 consensus Carboxylesterase and related proteins [General function prediction only] Back     alignment and domain information
>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF12048 DUF3530: Protein of unknown function (DUF3530); InterPro: IPR022529 This family of proteins is functionally uncharacterised Back     alignment and domain information
>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] Back     alignment and domain information
>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF07676 PD40: WD40-like Beta Propeller Repeat; InterPro: IPR011659 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>PF00975 Thioesterase: Thioesterase domain; InterPro: IPR001031 Thioesterase domains often occur integrated in or associated with peptide synthetases which are involved in the non-ribosomal synthesis of peptide antibiotics [] Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>TIGR02171 Fb_sc_TIGR02171 Fibrobacter succinogenes paralogous family TIGR02171 Back     alignment and domain information
>COG1770 PtrB Protease II [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton] Back     alignment and domain information
>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0269 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown] Back     alignment and domain information
>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] Back     alignment and domain information
>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>COG1506 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0294 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PF07819 PGAP1: PGAP1-like protein; InterPro: IPR012908 The sequences found in this family are similar to PGAP1 (Q765A7 from SWISSPROT) Back     alignment and domain information
>PLN02733 phosphatidylcholine-sterol O-acyltransferase Back     alignment and domain information
>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>PTZ00472 serine carboxypeptidase (CBP1); Provisional Back     alignment and domain information
>PF07082 DUF1350: Protein of unknown function (DUF1350); InterPro: IPR010765 This family consists of several hypothetical proteins from both cyanobacteria and plants Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF05577 Peptidase_S28: Serine carboxypeptidase S28; InterPro: IPR008758 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>COG3150 Predicted esterase [General function prediction only] Back     alignment and domain information
>PF07519 Tannase: Tannase and feruloyl esterase; InterPro: IPR011118 This family includes fungal tannase [] and feruloyl esterase [, ] Back     alignment and domain information
>PF05705 DUF829: Eukaryotic protein of unknown function (DUF829); InterPro: IPR008547 This signature identifies Transmembrane protein 53, that have no known function but are predicted to be integral membrane proteins Back     alignment and domain information
>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown] Back     alignment and domain information
>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG1408 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton] Back     alignment and domain information
>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>PF03096 Ndr: Ndr family; InterPro: IPR004142 This family consists of proteins from different gene families: Ndr1/RTP/Drg1, Ndr2, and Ndr3 Back     alignment and domain information
>KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown] Back     alignment and domain information
>KOG4328 consensus WD40 protein [Function unknown] Back     alignment and domain information
>PF07676 PD40: WD40-like Beta Propeller Repeat; InterPro: IPR011659 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>KOG1963 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton] Back     alignment and domain information
>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown] Back     alignment and domain information
>KOG0302 consensus Ribosome Assembly protein [General function prediction only] Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PF00151 Lipase: Lipase; InterPro: IPR013818 Triglyceride lipases (3 Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF01674 Lipase_2: Lipase (class 2); InterPro: IPR002918 Lipases or triacylglycerol acylhydrolases hydrolyse ester bonds in triacylglycerol giving diacylglycerol, monoacylglycerol, glycerol and free fatty acids [] Back     alignment and domain information
>KOG4389 consensus Acetylcholinesterase/Butyrylcholinesterase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>KOG0302 consensus Ribosome Assembly protein [General function prediction only] Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>KOG4328 consensus WD40 protein [Function unknown] Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4840 consensus Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription] Back     alignment and domain information
>KOG1408 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG3967 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PF00450 Peptidase_S10: Serine carboxypeptidase; InterPro: IPR001563 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG0300 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>COG4814 Uncharacterized protein with an alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF08386 Abhydrolase_4: TAP-like protein; InterPro: IPR013595 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG0269 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>KOG2182 consensus Hydrolytic enzymes of the alpha/beta hydrolase fold [Posttranslational modification, protein turnover, chaperones; General function prediction only] Back     alignment and domain information
>KOG4388 consensus Hormone-sensitive lipase HSL [Lipid transport and metabolism] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG0270 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PF11187 DUF2974: Protein of unknown function (DUF2974); InterPro: IPR024499 This family of proteins has no known function Back     alignment and domain information
>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG4532 consensus WD40-like repeat containing protein [General function prediction only] Back     alignment and domain information
>KOG2931 consensus Differentiation-related gene 1 protein (NDR1 protein), related proteins [Function unknown] Back     alignment and domain information
>PF13449 Phytase-like: Esterase-like activity of phytase Back     alignment and domain information
>COG3319 Thioesterase domains of type I polyketide synthases or non-ribosomal peptide synthetases [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF05990 DUF900: Alpha/beta hydrolase of unknown function (DUF900); InterPro: IPR010297 This domain is associated with proteins of unknown function, which are hydrolase-like Back     alignment and domain information
>PRK10252 entF enterobactin synthase subunit F; Provisional Back     alignment and domain information
>KOG2183 consensus Prolylcarboxypeptidase (angiotensinase C) [Posttranslational modification, protein turnover, chaperones; General function prediction only] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG3946 VirJ Type IV secretory pathway, VirJ component [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK13614 lipoprotein LpqB; Provisional Back     alignment and domain information
>KOG2100 consensus Dipeptidyl aminopeptidase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1551 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK13614 lipoprotein LpqB; Provisional Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] Back     alignment and domain information
>COG4782 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG3975 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2565 consensus Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>PRK13615 lipoprotein LpqB; Provisional Back     alignment and domain information
>PLN02209 serine carboxypeptidase Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>PRK13615 lipoprotein LpqB; Provisional Back     alignment and domain information
>PRK13613 lipoprotein LpqB; Provisional Back     alignment and domain information
>PF01764 Lipase_3: Lipase (class 3); InterPro: IPR002921 Triglyceride lipases are lipolytic enzymes that hydrolyse ester linkages of triglycerides [] Back     alignment and domain information
>cd00741 Lipase Lipase Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG1912 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4547 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4227 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1282 consensus Serine carboxypeptidases (lysosomal cathepsin A) [Posttranslational modification, protein turnover, chaperones; Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03606 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH family Back     alignment and domain information
>PF05057 DUF676: Putative serine esterase (DUF676); InterPro: IPR007751 This domain, whose function is unknown, is found within a group of putative lipases Back     alignment and domain information
>PRK13613 lipoprotein LpqB; Provisional Back     alignment and domain information
>PF02450 LCAT: Lecithin:cholesterol acyltransferase; InterPro: IPR003386 Lecithin:cholesterol acyltransferase (LACT), also known as phosphatidylcholine-sterol acyltransferase (2 Back     alignment and domain information
>KOG4532 consensus WD40-like repeat containing protein [General function prediction only] Back     alignment and domain information
>PLN03016 sinapoylglucose-malate O-sinapoyltransferase Back     alignment and domain information
>KOG3621 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1354 consensus Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton] Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>KOG4547 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3914 consensus WD repeat protein WDR4 [Function unknown] Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>PF03283 PAE: Pectinacetylesterase Back     alignment and domain information
>KOG0300 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>smart00824 PKS_TE Thioesterase Back     alignment and domain information
>PF06259 Abhydrolase_8: Alpha/beta hydrolase; InterPro: IPR010427 This is a family of uncharacterised proteins found in Actinobacteria Back     alignment and domain information
>KOG1520 consensus Predicted alkaloid synthase/Surface mucin Hemomucin [General function prediction only] Back     alignment and domain information
>COG4287 PqaA PhoPQ-activated pathogenicity-related protein [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query958
2ecf_A741 Crystal Structure Of Dipeptidyl Aminopeptidase Iv F 6e-08
2gbc_A730 Native Dpp-Iv (Cd26) From Rat Length = 730 1e-04
3o4j_A582 Structure And Catalysis Of Acylaminoacyl Peptidase 5e-04
>pdb|2ECF|A Chain A, Crystal Structure Of Dipeptidyl Aminopeptidase Iv From Stenotrophomonas Maltophilia Length = 741 Back     alignment and structure 
Iteration: 1

 Score = 56.6 bits (135), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 66/277 (23%), Positives = 102/277 (36%), Gaps = 38/277 (13%)
Query: 624 ITDFPHPYPQLASLQK--ELIKYQRKDG-VQLSATLYLPPGYDPSKDGPLPCLFWSYPGE 680
           + D  HPY +    Q+  E       DG   L+ ++  P G+DP+K  P+    +  P  
Sbjct: 470 LADPKHPYARYREAQRPVEFGTLTAADGKTPLNYSVIKPAGFDPAKRYPVAVYVYGGPAS 529
Query: 681 FKSKDAAGQVRGSPNEFPRIGSTSVLLWLAR-GFAILGGPTTPIIGEGDEEANDRFXXXX 739
               D+          +P  G      +LA+ G+ +       +   G       F    
Sbjct: 530 QTVTDS----------WPGRGDHLFNQYLAQQGYVVFS-----LDNRGTPRRGRDFGGAL 574
Query: 740 XXXXXXXXXXXXRRGVA--------HPSKIAVGGHSYGAFMTANLLAHAPHLFCCGIARS 791
                        RGVA         P++I V G S G +MT  LLA A   + CG+A +
Sbjct: 575 YGKQGTVEVADQLRGVAWLKQQPWVDPARIGVQGWSNGGYMTLMLLAKASDSYACGVAGA 634
Query: 792 -----GAYNRTLTPFGFQNEDRTLWEATSTYVEMSPFMSANKLKKPILLVHGEEDNNSGT 846
                G Y+   T        R      + Y E         L+ P+LL+HG  D+N   
Sbjct: 635 PVTDWGLYDSHYTERYMDLPARN----DAGYREARVLTHIEGLRSPLLLIHGMADDN--V 688
Query: 847 LTMQSDRFFNALKGHGALCRLVILPFESHGYAARESI 883
           L   S    +AL+  G    L+  P   HG +  +++
Sbjct: 689 LFTNSTSLMSALQKRGQPFELMTYPGAKHGLSGADAL 725
>pdb|2GBC|A Chain A, Native Dpp-Iv (Cd26) From Rat Length = 730 Back     alignment and structure
>pdb|3O4J|A Chain A, Structure And Catalysis Of Acylaminoacyl Peptidase Length = 582 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query958
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 4e-32
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 3e-31
3ksr_A290 Putative serine hydrolase; catalytic triad, struct 1e-25
1l7a_A318 Cephalosporin C deacetylase; structural genomics, 4e-24
4a5s_A740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 1e-20
1vlq_A337 Acetyl xylan esterase; TM0077, structural genomics 2e-20
3fcy_A346 Xylan esterase 1; alpha/beta hydrolase, carbohydra 9e-20
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 2e-19
1z68_A719 Fibroblast activation protein, alpha subunit; sepr 1e-18
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 2e-18
1xfd_A723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 3e-17
3doh_A380 Esterase; alpha-beta hydrolase, beta sheet; 2.60A 6e-14
1ufo_A238 Hypothetical protein TT1662; alpha-beta fold, hydr 1e-12
2wtm_A251 EST1E; hydrolase; 1.60A {Clostridium proteoclastic 4e-12
3fnb_A405 Acylaminoacyl peptidase SMU_737; alpha-beta-alpha 2e-11
2jbw_A386 Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine 3e-11
3k2i_A422 Acyl-coenzyme A thioesterase 4; alpha/beta hydrola 2e-10
3g8y_A391 SUSD/RAGB-associated esterase-like protein; struct 2e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-04
4e15_A303 Kynurenine formamidase; alpha/beta hydrolase fold, 8e-10
3nuz_A398 Putative acetyl xylan esterase; structural genomic 1e-09
2pbl_A262 Putative esterase/lipase/thioesterase; alpha/beta- 1e-09
3hlk_A446 Acyl-coenzyme A thioesterase 2, mitochondrial; alp 4e-09
3mve_A415 FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/ 8e-08
1vkh_A273 Putative serine hydrolase; structural genomics, jo 1e-07
3hxk_A276 Sugar hydrolase; alpha-beta protein., structural g 2e-07
1jjf_A268 Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-x 2e-07
3bxp_A277 Putative lipase/esterase; putative carboxylesteras 2e-07
3bjr_A283 Putative carboxylesterase; structural genomics, jo 3e-07
3c8d_A403 Enterochelin esterase; alpha-beta-alpha sandwich, 2e-06
1gkl_A297 Endo-1,4-beta-xylanase Y; hydrolase, esterase fami 2e-06
3b5e_A223 MLL8374 protein; NP_108484.1, carboxylesterase, st 3e-06
2gzs_A278 IROE protein; enterobactin, salmochelin, DFP, hydr 6e-06
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 7e-06
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 7e-04
2hdw_A367 Hypothetical protein PA2218; alpha/beta hydrolase 2e-05
2h1i_A226 Carboxylesterase; structural genomics, PSI-2, prot 2e-05
3pfb_A270 Cinnamoyl esterase; alpha/beta hydrolase fold, hyd 2e-05
3dkr_A251 Esterase D; alpha beta hydrolase, mechanism, catal 5e-05
3og9_A209 Protein YAHD A copper inducible hydrolase; alpha/b 8e-05
1tht_A305 Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1. 1e-04
2fx5_A258 Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pse 1e-04
2o2g_A223 Dienelactone hydrolase; YP_324580.1, structural ge 2e-04
2d81_A318 PHB depolymerase; alpha/beta hydrolase fold, circu 3e-04
3fcx_A282 FGH, esterase D, S-formylglutathione hydrolase; re 3e-04
3h2g_A397 Esterase; xanthomonas oryzae PV. oryzae, cell WALL 6e-04
3vis_A306 Esterase; alpha/beta-hydrolase fold, polyethylene 7e-04
1mpx_A 615 Alpha-amino acid ester hydrolase; alpha/beta hydro 8e-04
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Length = 662 Back     alignment and structure
 Score =  132 bits (334), Expect = 4e-32
 Identities = 58/315 (18%), Positives = 100/315 (31%), Gaps = 47/315 (14%)

Query: 606 TENTQYYIQSWPDKKSCQITDFPHPYPQLASLQK-ELIKYQRKDGVQLSATLYLPPG--Y 662
               +         ++  I          A   + ++  +   DG ++ A +Y P    +
Sbjct: 357 RTAYEVVELDTVTGRARTIGARHTDPVDPAYYPEPQIRTFTAPDGREIHAHIYPPHSPDF 416

Query: 663 DPSKDGPLPCLFWSYPGEFKSKDAAGQVRGSPNEFPRIGSTSVLLWLARGFAIL----GG 718
               D   P +  ++ G           R        +       + +RG  +     GG
Sbjct: 417 TGPADELPPYVVMAHGG--------PTSRVPAVLDLDV-----AYFTSRGIGVADVNYGG 463

Query: 719 PTTPIIGEGDE--EANDRF-----VEQLVACAEAAVEEVVRRGVAHPSKIAVGGHSYGAF 771
            T    G G    E          VE   A A A  E     G A  +++AV G S G +
Sbjct: 464 ST----GYGRAYRERLRGRWGVVDVEDCAAVATALAE----EGTADRARLAVRGGSAGGW 515

Query: 772 MTANLLAHAPHLFCCGIARSGAYN---------RTLTPFGFQNEDRTLWEATSTYVEMSP 822
             A+ L     ++ CG       +                      +  E    Y + +P
Sbjct: 516 TAASSLVS-TDVYACGTVLYPVLDLLGWADGGTHDFESRYLDFLIGSFEEFPERYRDRAP 574

Query: 823 FMSANKLKKPILLVHGEEDNNSGTLTMQSDRFFNALKGHGALCRLVILPFESHGYAARES 882
              A++++ P LL+ G ED        Q DRF  A+ G G     +    E HG+  +E+
Sbjct: 575 LTRADRVRVPFLLLQGLEDPV--CPPEQCDRFLEAVAGCGVPHAYLSFEGEGHGFRRKET 632

Query: 883 IMHVLWETDRWLQKY 897
           ++  L        + 
Sbjct: 633 MVRALEAELSLYAQV 647
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Length = 582 Back     alignment and structure
>3ksr_A Putative serine hydrolase; catalytic triad, structural genomics, JOIN for structural genomics, JCSG; 2.69A {Xanthomonas campestris PV} Length = 290 Back     alignment and structure
>1l7a_A Cephalosporin C deacetylase; structural genomics, alpha-beta-alpha sandwich, PSI, protein structure initiative; 1.50A {Bacillus subtilis} SCOP: c.69.1.25 PDB: 1odt_C 1ods_A 3fvt_A 3fvr_A 3fyu_A* 2xlb_A 2xlc_A 3fyt_A* 3fyu_B* Length = 318 Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Length = 740 Back     alignment and structure
>1vlq_A Acetyl xylan esterase; TM0077, structural genomics, JCSG, PR structure initiative, PSI, joint center for structural GENO hydrolase; 2.10A {Thermotoga maritima} SCOP: c.69.1.25 PDB: 3m81_A 3m83_A* 3m82_A* Length = 337 Back     alignment and structure
>3fcy_A Xylan esterase 1; alpha/beta hydrolase, carbohydrate esterase, CE7; 2.10A {Thermoanaerobacterium SP} Length = 346 Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Length = 741 Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Length = 719 Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Length = 706 Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Length = 723 Back     alignment and structure
>3doh_A Esterase; alpha-beta hydrolase, beta sheet; 2.60A {Thermotoga maritima} PDB: 3doi_A Length = 380 Back     alignment and structure
>1ufo_A Hypothetical protein TT1662; alpha-beta fold, hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.60A {Thermus thermophilus} SCOP: c.69.1.27 Length = 238 Back     alignment and structure
>2wtm_A EST1E; hydrolase; 1.60A {Clostridium proteoclasticum} PDB: 2wtn_A* Length = 251 Back     alignment and structure
>3fnb_A Acylaminoacyl peptidase SMU_737; alpha-beta-alpha sandwich, helix bundle, structural genomics protein structure initiative; HET: PGE; 2.12A {Streptococcus mutans} Length = 405 Back     alignment and structure
>2jbw_A Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine hydrolase; alpha/beta hydrolase, META-cleavage pathway; 2.1A {Arthrobacter nicotinovorans} SCOP: c.69.1.41 Length = 386 Back     alignment and structure
>3k2i_A Acyl-coenzyme A thioesterase 4; alpha/beta hydrolase fold seven-stranded beta-sandwich, structural genomics, structural genomics consortium, SGC; 2.40A {Homo sapiens} Length = 422 Back     alignment and structure
>3g8y_A SUSD/RAGB-associated esterase-like protein; structural genom joint center for structural genomics, JCSG; HET: MSE; 1.90A {Bacteroides vulgatus atcc 8482} Length = 391 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>4e15_A Kynurenine formamidase; alpha/beta hydrolase fold, hydrolase-hydrolase inhibitor COM; HET: SEB; 1.50A {Drosophila melanogaster} PDB: 4e14_A* 4e11_A Length = 303 Back     alignment and structure
>3nuz_A Putative acetyl xylan esterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology; 2.30A {Bacteroides fragilis} Length = 398 Back     alignment and structure
>2pbl_A Putative esterase/lipase/thioesterase; alpha/beta-hydrolases fold, structural genomics, joint cente structural genomics, JCSG; 1.79A {Silicibacter SP} SCOP: c.69.1.2 Length = 262 Back     alignment and structure
>3hlk_A Acyl-coenzyme A thioesterase 2, mitochondrial; alpha/beta hydrolase, alternative splicing, hydrolase, mitochondrion, polymorphism, serine esterase; 2.10A {Homo sapiens} Length = 446 Back     alignment and structure
>3mve_A FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/respiration switch protein, hydrolase ACTI lyase; 2.20A {Vibrio vulnificus} PDB: 3our_A Length = 415 Back     alignment and structure
>1vkh_A Putative serine hydrolase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.85A {Saccharomyces cerevisiae} SCOP: c.69.1.32 Length = 273 Back     alignment and structure
>3hxk_A Sugar hydrolase; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.20A {Lactococcus lactis subsp} Length = 276 Back     alignment and structure
>1jjf_A Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-xylan; feruloyl esterase, ferulic acid esterase, FAE_XYNZ, XYNZ, structural genomics; 1.75A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1jt2_A* Length = 268 Back     alignment and structure
>3bxp_A Putative lipase/esterase; putative carboxylesterase, structural genomics, joint center structural genomics, JCSG; HET: EPE; 1.70A {Lactobacillus plantarum WCFS1} PDB: 3d3n_A* Length = 277 Back     alignment and structure
>3bjr_A Putative carboxylesterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.09A {Lactobacillus plantarum WCFS1} Length = 283 Back     alignment and structure
>3c8d_A Enterochelin esterase; alpha-beta-alpha sandwich, IROD, iron aquisition, structural genomics, PSI-2, protein structure initiative; HET: CIT; 1.80A {Shigella flexneri 2a str} SCOP: b.1.18.20 c.69.1.2 PDB: 2b20_A 3c87_A* 3c8h_A 3mga_A* Length = 403 Back     alignment and structure
>1gkl_A Endo-1,4-beta-xylanase Y; hydrolase, esterase family 1, inactive mutant; HET: FER; 1.4A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1wb4_A* 1wb5_A* 1wb6_A* 1gkk_A* Length = 297 Back     alignment and structure
>3b5e_A MLL8374 protein; NP_108484.1, carboxylesterase, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; 1.75A {Mesorhizobium loti} SCOP: c.69.1.14 Length = 223 Back     alignment and structure
>2gzs_A IROE protein; enterobactin, salmochelin, DFP, hydrolase, catalytic DYAD; HET: DFP; 1.40A {Escherichia coli} SCOP: c.69.1.38 PDB: 2gzr_A* Length = 278 Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Length = 347 Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Length = 347 Back     alignment and structure
>2hdw_A Hypothetical protein PA2218; alpha/beta hydrolase fold, structural genomics, PSI, structure initiative; 2.00A {Pseudomonas aeruginosa} Length = 367 Back     alignment and structure
>2h1i_A Carboxylesterase; structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics, MCSG, H; HET: MSE; 2.80A {Bacillus cereus} SCOP: c.69.1.14 Length = 226 Back     alignment and structure
>3pfb_A Cinnamoyl esterase; alpha/beta hydrolase fold, hydrolase, cinnamoyl/Fe esterase, hydroxycinammates, extracellular; HET: ZYC; 1.58A {Lactobacillus johnsonii} PDB: 3pf9_A* 3pfc_A* 3s2z_A* 3pf8_A 3qm1_A* Length = 270 Back     alignment and structure
>3dkr_A Esterase D; alpha beta hydrolase, mechanism, catalytic triad, rotation; 1.60A {Lactobacillus rhamnosus} PDB: 3dlt_A 3dyi_A 3dyv_A 3e1g_A Length = 251 Back     alignment and structure
>3og9_A Protein YAHD A copper inducible hydrolase; alpha/beta hydrolase, copper homeostasis, malic acid; 1.88A {Lactococcus lactis subsp} Length = 209 Back     alignment and structure
>1tht_A Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.13 Length = 305 Back     alignment and structure
>2fx5_A Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pseudomonas mendocina} Length = 258 Back     alignment and structure
>2o2g_A Dienelactone hydrolase; YP_324580.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.92A {Anabaena variabilis} Length = 223 Back     alignment and structure
>2d81_A PHB depolymerase; alpha/beta hydrolase fold, circular permutation, hydrolase; HET: NAG RB3; 1.66A {Penicillium funiculosum} SCOP: c.69.1.37 PDB: 2d80_A* Length = 318 Back     alignment and structure
>3fcx_A FGH, esterase D, S-formylglutathione hydrolase; retinoblastoma, genetic marker, cytoplasm, cytoplasmic vesicle, polymorphism, serine esterase; 1.50A {Homo sapiens} Length = 282 Back     alignment and structure
>3h2g_A Esterase; xanthomonas oryzae PV. oryzae, cell WALL degrading enzyme, RICE, virulence, innate immune responses, pathogenesis; 1.86A {Xanthomonas oryzae PV} PDB: 3h2j_A 3h2k_A* 3h2h_A 3h2i_A Length = 397 Back     alignment and structure
>3vis_A Esterase; alpha/beta-hydrolase fold, polyethylene terephthal hydrolase; HET: PE4; 1.76A {Thermobifida alba} Length = 306 Back     alignment and structure
>1mpx_A Alpha-amino acid ester hydrolase; alpha/beta hydrolase, jellyroll, selenomethionine; 1.90A {Xanthomonas citri} SCOP: b.18.1.13 c.69.1.21 Length = 615 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query958
4a5s_A740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 100.0
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 100.0
1xfd_A723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 100.0
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 100.0
1z68_A719 Fibroblast activation protein, alpha subunit; sepr 100.0
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 100.0
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 100.0
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 100.0
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 100.0
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 100.0
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 100.0
2xe4_A751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 100.0
4hvt_A711 Ritya.17583.B, post-proline cleaving enzyme; ssgci 100.0
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 99.92
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 99.92
4a5s_A740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.91
1k32_A 1045 Tricorn protease; protein degradation, substrate g 99.91
1xfd_A723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.9
3f67_A241 Putative dienelactone hydrolase; alpha-beta-alpha 99.9
4ao6_A259 Esterase; hydrolase, thermo label; 1.60A {Unidenti 99.89
2jbw_A386 Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine 99.89
3hxk_A276 Sugar hydrolase; alpha-beta protein., structural g 99.89
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.88
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 99.88
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 99.88
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.88
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.88
1z68_A719 Fibroblast activation protein, alpha subunit; sepr 99.88
3ebl_A365 Gibberellin receptor GID1; alpha/beta hydrolase, l 99.88
3bxp_A277 Putative lipase/esterase; putative carboxylesteras 99.88
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.87
2i3d_A249 AGR_C_3351P, hypothetical protein ATU1826; structu 99.87
3ksr_A290 Putative serine hydrolase; catalytic triad, struct 99.87
1k32_A 1045 Tricorn protease; protein degradation, substrate g 99.87
3k2i_A422 Acyl-coenzyme A thioesterase 4; alpha/beta hydrola 99.86
3hlk_A446 Acyl-coenzyme A thioesterase 2, mitochondrial; alp 99.86
1vlq_A337 Acetyl xylan esterase; TM0077, structural genomics 99.86
3ga7_A326 Acetyl esterase; phosphoserine, IDP00896, hydrolas 99.86
3doh_A380 Esterase; alpha-beta hydrolase, beta sheet; 2.60A 99.85
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.85
3fcx_A282 FGH, esterase D, S-formylglutathione hydrolase; re 99.85
1zi8_A236 Carboxymethylenebutenolidase; alpha and beta prote 99.85
3i6y_A280 Esterase APC40077; lipase, structural genomics, PS 99.85
3fcy_A346 Xylan esterase 1; alpha/beta hydrolase, carbohydra 99.85
1l7a_A318 Cephalosporin C deacetylase; structural genomics, 99.85
2o2g_A223 Dienelactone hydrolase; YP_324580.1, structural ge 99.85
3fak_A322 Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Unc 99.85
3bjr_A283 Putative carboxylesterase; structural genomics, jo 99.85
2wtm_A251 EST1E; hydrolase; 1.60A {Clostridium proteoclastic 99.85
1mpx_A 615 Alpha-amino acid ester hydrolase; alpha/beta hydro 99.84
3ls2_A280 S-formylglutathione hydrolase; psychrophilic organ 99.84
3trd_A208 Alpha/beta hydrolase; cellular processes; 1.50A {C 99.84
3e4d_A278 Esterase D; S-formylglutathione hydrolase, hydrola 99.84
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.84
2b9v_A 652 Alpha-amino acid ester hydrolase; catalytic triad, 99.84
2hdw_A367 Hypothetical protein PA2218; alpha/beta hydrolase 99.83
2fuk_A220 XC6422 protein; A/B hydrolase, structural genomics 99.83
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 99.83
2ymu_A577 WD-40 repeat protein; unknown function, two domain 99.82
4fbl_A281 LIPS lipolytic enzyme; thermostable, structural ge 99.82
3qh4_A317 Esterase LIPW; structural genomics, ssgcid, seattl 99.82
2o7r_A338 CXE carboxylesterase; alpha/beta hydrolase; 1.40A 99.82
2hm7_A310 Carboxylesterase; alpha/beta hydrolase fold, hydro 99.82
3ain_A323 303AA long hypothetical esterase; carboxylesterase 99.82
2zsh_A351 Probable gibberellin receptor GID1L1; plant hormon 99.81
4b6g_A283 Putative esterase; hydrolase, formaldehyde detoxif 99.81
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.81
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 99.81
1lzl_A323 Heroin esterase; alpha/beta hydrolase; 1.30A {Rhod 99.81
2ymu_A577 WD-40 repeat protein; unknown function, two domain 99.81
2wir_A313 Pesta, alpha/beta hydrolase fold-3 domain protein; 99.81
3hju_A342 Monoglyceride lipase; alpha/beta hydrolase, hydrol 99.8
4e15_A303 Kynurenine formamidase; alpha/beta hydrolase fold, 99.8
3h04_A275 Uncharacterized protein; protein with unknown func 99.8
3pfb_A270 Cinnamoyl esterase; alpha/beta hydrolase fold, hyd 99.8
3k6k_A322 Esterase/lipase; alpha/beta hydrolase fold; 2.20A 99.8
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 99.8
1jjf_A268 Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-x 99.8
1lns_A 763 X-prolyl dipeptidyl aminopetidase; alpha beta hydr 99.8
1jfr_A262 Lipase; serine hydrolase; 1.90A {Streptomyces exfo 99.8
2c7b_A311 Carboxylesterase, ESTE1; carboxyesterase, thermoph 99.8
2uz0_A263 Esterase, tributyrin esterase; alpha/beta hydrolas 99.79
1jkm_A361 Brefeldin A esterase; serine hydrolase, degradatio 99.79
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.79
3pe6_A303 Monoglyceride lipase; alpha-beta hydrolase fold, 2 99.78
3vis_A306 Esterase; alpha/beta-hydrolase fold, polyethylene 99.78
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.78
4h0c_A210 Phospholipase/carboxylesterase; PSI-biology, midwe 99.78
1auo_A218 Carboxylesterase; hydrolase; 1.80A {Pseudomonas fl 99.78
1ufo_A238 Hypothetical protein TT1662; alpha-beta fold, hydr 99.78
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 99.78
2pbl_A262 Putative esterase/lipase/thioesterase; alpha/beta- 99.77
1k8q_A377 Triacylglycerol lipase, gastric; APHA beta hydrola 99.77
3fnb_A405 Acylaminoacyl peptidase SMU_737; alpha-beta-alpha 99.77
4fhz_A285 Phospholipase/carboxylesterase; alpha/beta hydrola 99.77
3llc_A270 Putative hydrolase; structural genomics, joint cen 99.77
3og9_A209 Protein YAHD A copper inducible hydrolase; alpha/b 99.77
1fj2_A232 Protein (acyl protein thioesterase 1); alpha/beta 99.77
3i2k_A 587 Cocaine esterase; alpha/beta hydrolase, hydrolase; 99.76
3mve_A415 FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/ 99.76
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 99.76
1jji_A311 Carboxylesterase; alpha-beta hydrolase fold, hydro 99.76
3dkr_A251 Esterase D; alpha beta hydrolase, mechanism, catal 99.76
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 99.75
3cn9_A226 Carboxylesterase; alpha/beta hydrolase fold super- 99.74
2h1i_A226 Carboxylesterase; structural genomics, PSI-2, prot 99.74
3iii_A 560 COCE/NOND family hydrolase; structural genomics, c 99.74
3d0k_A304 Putative poly(3-hydroxybutyrate) depolymerase LPQ; 99.74
3bdi_A207 Uncharacterized protein TA0194; NP_393672.1, predi 99.74
3ow8_A321 WD repeat-containing protein 61; structural genomi 99.74
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 99.74
3u0v_A239 Lysophospholipase-like protein 1; alpha, beta hydr 99.74
1vkh_A273 Putative serine hydrolase; structural genomics, jo 99.73
3d7r_A326 Esterase; alpha/beta fold, hydrolase; 2.01A {Staph 99.73
3rm3_A270 MGLP, thermostable monoacylglycerol lipase; alpha/ 99.73
4g56_B357 MGC81050 protein; protein arginine methyltransfera 99.73
3b5e_A223 MLL8374 protein; NP_108484.1, carboxylesterase, st 99.72
4f0j_A315 Probable hydrolytic enzyme; alpha/beta hydrolase f 99.72
2r8b_A251 AGR_C_4453P, uncharacterized protein ATU2452; APC6 99.72
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 99.72
1sfr_A304 Antigen 85-A; alpha/beta hydrolase, structural gen 99.72
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 99.71
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 99.71
1gkl_A297 Endo-1,4-beta-xylanase Y; hydrolase, esterase fami 99.71
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.71
4ezi_A377 Uncharacterized protein; alpha-beta hydrolases fol 99.71
3nuz_A398 Putative acetyl xylan esterase; structural genomic 99.71
1tht_A305 Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1. 99.71
1r88_A280 MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBP 99.7
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.7
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 99.7
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.7
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.7
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 99.69
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 99.69
2qru_A274 Uncharacterized protein; alpha/beta-hydrolase, str 99.69
2qm0_A275 BES; alpha-beta structure, structural genomics, PS 99.69
3g8y_A391 SUSD/RAGB-associated esterase-like protein; struct 99.69
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 99.69
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 99.69
2fx5_A258 Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pse 99.68
2qjw_A176 Uncharacterized protein XCC1541; putative hydrolas 99.68
1qlw_A328 Esterase; anisotropic refinement, atomic resolutio 99.68
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.68
2j04_A588 TAU60, YPL007P, hypothetical protein YPL007C; beta 99.68
3ia2_A271 Arylesterase; alpha-beta hydrolase fold, transitio 99.68
3d59_A383 Platelet-activating factor acetylhydrolase; secret 99.68
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 99.67
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.67
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 99.67
1a88_A275 Chloroperoxidase L; haloperoxidase, oxidoreductase 99.67
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.67
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 99.66
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 99.66
4g56_B357 MGC81050 protein; protein arginine methyltransfera 99.66
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 99.66
1zoi_A276 Esterase; alpha/beta hydrolase fold; 1.60A {Pseudo 99.66
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 99.66
2y6u_A398 Peroxisomal membrane protein LPX1; hydrolase, puta 99.66
3vdx_A 456 Designed 16NM tetrahedral protein CAGE containing 99.66
1tqh_A247 Carboxylesterase precursor; tetrahedral intermedia 99.65
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.65
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.65
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 99.65
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 99.65
2ocg_A254 Valacyclovir hydrolase; alpha beta hydrolase fold; 99.65
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 99.65
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 99.65
3ow8_A321 WD repeat-containing protein 61; structural genomi 99.64
4fle_A202 Esterase; structural genomics, PSI-biology, northe 99.64
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.64
1a8s_A273 Chloroperoxidase F; haloperoxidase, oxidoreductase 99.64
3r0v_A262 Alpha/beta hydrolase fold protein; structural geno 99.64
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 99.64
1imj_A210 CIB, CCG1-interacting factor B; alpha/beta hydrola 99.64
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 99.64
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 99.64
2yys_A286 Proline iminopeptidase-related protein; TTHA1809, 99.64
1dqz_A280 85C, protein (antigen 85-C); fibronectin, structur 99.64
3u1t_A309 DMMA haloalkane dehalogenase; alpha/beta-hydrolase 99.64
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 99.64
4f21_A246 Carboxylesterase/phospholipase family protein; str 99.64
3qit_A286 CURM TE, polyketide synthase; thioesterase, alpha/ 99.63
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 99.63
3fob_A281 Bromoperoxidase; structural genomics, IDP00046, ba 99.63
1a8q_A274 Bromoperoxidase A1; haloperoxidase, oxidoreductase 99.63
3om8_A266 Probable hydrolase; structural genomics, PSI-2, pr 99.63
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 99.63
1mtz_A293 Proline iminopeptidase; alpha-beta hydrolase, CAP 99.63
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 99.63
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 99.63
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.63
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.62
3c8d_A403 Enterochelin esterase; alpha-beta-alpha sandwich, 99.62
3oos_A278 Alpha/beta hydrolase family protein; APC67239.0, p 99.62
1q0r_A298 RDMC, aclacinomycin methylesterase; anthracycline, 99.62
3dqz_A258 Alpha-hydroxynitrIle lyase-like protein; A/B-hydrl 99.61
3e0x_A245 Lipase-esterase related protein; APC60309, clostri 99.61
1brt_A277 Bromoperoxidase A2; haloperoxidase, oxidoreductase 99.61
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 99.61
4e54_B435 DNA damage-binding protein 2; beta barrel, double 99.61
2r11_A306 Carboxylesterase NP; 2632844, putative hydrolase, 99.61
3v48_A268 Aminohydrolase, putative aminoacrylate hydrolase R 99.61
4dnp_A269 DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petu 99.61
2gzs_A278 IROE protein; enterobactin, salmochelin, DFP, hydr 99.61
2pl5_A366 Homoserine O-acetyltransferase; alpha/beta hydrola 99.61
3qvm_A282 OLEI00960; structural genomics, PSI-biology, midwe 99.61
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 99.61
3i28_A555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 99.6
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 99.6
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 99.6
2xe4_A751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 99.6
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 99.6
3hss_A293 Putative bromoperoxidase; alpha beta hydrolase, ox 99.6
3guu_A462 Lipase A; protein structure, hydrolase; HET: 1PE; 99.6
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.6
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 99.6
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 99.6
3sty_A267 Methylketone synthase 1; alpha/beta hydrolase, dec 99.59
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 99.59
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 99.59
3kxp_A314 Alpha-(N-acetylaminomethylene)succinic acid hydrol 99.59
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.59
2xua_A266 PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, cate 99.58
3h2g_A397 Esterase; xanthomonas oryzae PV. oryzae, cell WALL 99.58
3nwo_A330 PIP, proline iminopeptidase; structural genomics, 99.58
3fsg_A272 Alpha/beta superfamily hydrolase; PF00561, MCSG, P 99.58
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 99.58
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 99.58
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 99.58
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 99.58
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 99.57
1hkh_A279 Gamma lactamase; hydrolase, alpha/beta hydrolase, 99.57
3i1i_A377 Homoserine O-acetyltransferase; structural genomic 99.57
1wm1_A317 Proline iminopeptidase; complex with inhibitor, hy 99.57
1c4x_A285 BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-di 99.57
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 99.57
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 99.56
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.56
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 99.56
2puj_A286 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; 99.56
2qs9_A194 Retinoblastoma-binding protein 9; B5T overexpresse 99.56
4g9e_A279 AHL-lactonase, alpha/beta hydrolase fold protein; 99.56
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 99.56
1azw_A313 Proline iminopeptidase; aminopeptidase, serine pro 99.55
2e3j_A356 Epoxide hydrolase EPHB; epoxide hydrolase B, struc 99.55
2b61_A377 Homoserine O-acetyltransferase; acyl-enzyme, aspar 99.55
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 99.54
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 99.54
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 99.54
2cjp_A328 Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tu 99.54
2rau_A354 Putative esterase; NP_343859.1, putative lipase, s 99.54
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 99.54
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 99.54
3g9x_A299 Haloalkane dehalogenase; alpha/beta hydrolase, hel 99.54
1iup_A282 META-cleavage product hydrolase; aromatic compound 99.54
2wue_A291 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolas 99.53
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 99.53
1j1i_A296 META cleavage compound hydrolase; carbazole degrad 99.53
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 99.53
2oaj_A902 Protein SNI1; WD40 repeat, beta propeller, endocyt 99.52
1uxo_A192 YDEN protein; hydrolase, A/B hydrolase, esterase, 99.52
1wom_A271 RSBQ, sigma factor SIGB regulation protein RSBQ; a 99.52
3bf7_A255 Esterase YBFF; thioesterase, helical CAP, hydrolas 99.52
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 99.52
2xmz_A269 Hydrolase, alpha/beta hydrolase fold family; menaq 99.52
2d81_A318 PHB depolymerase; alpha/beta hydrolase fold, circu 99.52
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.52
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 99.51
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.51
1xkl_A273 SABP2, salicylic acid-binding protein 2; alpha-bet 99.51
2xt0_A297 Haloalkane dehalogenase; hydrolase, alpha-beta hyd 99.51
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 99.51
1b6g_A310 Haloalkane dehalogenase; hydrolase, alpha/beta-hyd 99.51
3p2m_A330 Possible hydrolase; alpha/beta hydrolase superfami 99.51
2qvb_A297 Haloalkane dehalogenase 3; RV2579, alpha-beta hydr 99.51
3r40_A306 Fluoroacetate dehalogenase; FACD, defluorinase, al 99.51
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 99.5
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 99.5
2wfl_A264 Polyneuridine-aldehyde esterase; alkaloid metaboli 99.5
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 99.5
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 99.5
3bwx_A285 Alpha/beta hydrolase; YP_496220.1, joint center fo 99.5
1u2e_A289 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase 99.49
3gff_A331 IROE-like serine hydrolase; NP_718593.1, structura 99.49
1ycd_A243 Hypothetical 27.3 kDa protein in AAP1-SMF2 interge 99.49
2q0x_A335 Protein DUF1749, uncharacterized protein; alpha/be 99.49
1mj5_A302 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; 99.49
4e54_B435 DNA damage-binding protein 2; beta barrel, double 99.49
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 99.48
1m33_A258 BIOH protein; alpha-betta-alpha sandwich, structur 99.48
3pic_A375 CIP2; alpha/beta hydrolase fold, glucuronoyl ester 99.48
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 99.48
3fla_A267 RIFR; alpha-beta hydrolase thioesterase, hydrolase 99.48
3c6x_A257 Hydroxynitrilase; atomic resolution, hydroxynitril 99.48
4g4g_A433 4-O-methyl-glucuronoyl methylesterase; alpha/beta 99.48
3bdv_A191 Uncharacterized protein DUF1234; DUF1234 family pr 99.48
2vat_A444 Acetyl-COA--deacetylcephalosporin C acetyltransfer 99.47
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 99.46
1isp_A181 Lipase; alpha/beta hydrolase fold, hydrolase; 1.30 99.46
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 99.46
4fol_A299 FGH, S-formylglutathione hydrolase; D-type esteras 99.46
3kda_A301 CFTR inhibitory factor (CIF); alpha/beta hydrolase 99.46
1pja_A302 Palmitoyl-protein thioesterase 2 precursor; hydrol 99.45
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.45
3afi_E316 Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 99.45
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 99.45
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.45
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 99.44
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 99.44
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 99.44
1ehy_A294 Protein (soluble epoxide hydrolase); alpha/beta hy 99.44
2pm7_B297 Protein transport protein SEC13, protein transport 99.44
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 99.43
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 99.43
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.43
3ibt_A264 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, 99.43
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 99.43
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 99.41
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.41
2qmq_A286 Protein NDRG2, protein NDR2; alpha/beta-hydrolases 99.4
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 99.4
2j04_A588 TAU60, YPL007P, hypothetical protein YPL007C; beta 99.39
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 99.39
1qe3_A489 PNB esterase, para-nitrobenzyl esterase; alpha-bet 99.39
3qmv_A280 Thioesterase, REDJ; alpha/beta hydrolase fold, hyd 99.38
3jrp_A379 Fusion protein of protein transport protein SEC13 99.38
2psd_A318 Renilla-luciferin 2-monooxygenase; alpha/beta-hydr 99.38
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 99.38
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.37
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 99.37
1r3d_A264 Conserved hypothetical protein VC1974; structural 99.37
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 99.37
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 99.36
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 99.36
3b12_A304 Fluoroacetate dehalogenase; dehalogease, hydrolase 99.03
3jrp_A379 Fusion protein of protein transport protein SEC13 99.34
2pm7_B297 Protein transport protein SEC13, protein transport 99.34
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 99.33
3l80_A292 Putative uncharacterized protein SMU.1393C; alpha/ 99.33
2oaj_A902 Protein SNI1; WD40 repeat, beta propeller, endocyt 99.33
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 99.32
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 99.3
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 99.3
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 99.28
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 99.27
2xyi_A430 Probable histone-binding protein CAF1; transcripti 99.25
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 99.25
4i19_A388 Epoxide hydrolase; structural genomics, PSI-biolog 99.25
2wj6_A276 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxid 99.25
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 99.24
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 99.23
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 99.23
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 99.23
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 99.23
3lcr_A319 Tautomycetin biosynthetic PKS; alpha-beta hydrolas 99.2
3qyj_A291 ALR0039 protein; alpha/beta fold, hydrolase; 1.78A 99.2
3jro_A753 Fusion protein of protein transport protein SEC13 99.19
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 99.19
3c5v_A316 PME-1, protein phosphatase methylesterase 1; demet 99.19
3fle_A249 SE_1780 protein; structural genomics, APC61035.1, 99.19
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 99.18
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 99.17
2xyi_A430 Probable histone-binding protein CAF1; transcripti 99.17
3jro_A753 Fusion protein of protein transport protein SEC13 99.16
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.16
3ds8_A254 LIN2722 protein; unkonwn function, structural geno 99.16
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.16
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 99.15
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 99.14
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 99.14
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 99.14
1kez_A300 Erythronolide synthase; polyketide synthase, modul 99.13
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.13
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 99.11
3lp5_A250 Putative cell surface hydrolase; structural genom 99.11
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 99.11
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 99.11
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.11
1ukc_A 522 ESTA, esterase; fungi, A/B hydrolase fold, acetylc 99.11
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 99.1
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 99.09
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 99.09
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.08
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 99.06
3ils_A265 PKS, aflatoxin biosynthesis polyketide synthase; A 99.05
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.04
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 99.03
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 99.03
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 99.03
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 99.02
3g02_A408 Epoxide hydrolase; alpha/beta hydrolase fold, enan 99.0
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.0
1tca_A317 Lipase; hydrolase(carboxylic esterase); HET: NAG; 98.98
2h7c_A 542 Liver carboxylesterase 1; enzyme, cholesteryl este 98.98
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 98.93
2ogt_A 498 Thermostable carboxylesterase EST50; alpha/beta hy 98.91
2ha2_A 543 ACHE, acetylcholinesterase; hydrolase fold, serine 98.89
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 98.87
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 98.87
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 98.86
1ei9_A279 Palmitoyl protein thioesterase 1; alpha/beta hydro 98.84
2k2q_B242 Surfactin synthetase thioesterase subunit; A/B-hyd 98.84
1p0i_A 529 Cholinesterase; serine hydrolase, butyrate, hydrol 98.83
2fj0_A 551 JuvenIle hormone esterase; manduca sexta, alpha-be 98.82
1gpl_A 432 RP2 lipase; serine esterase, hydrolase, lipid degr 98.82
1ea5_A 537 ACHE, acetylcholinesterase; hydrolase, serine hydr 98.8
2ece_A462 462AA long hypothetical selenium-binding protein; 98.75
1llf_A 534 Lipase 3; candida cylindracea cholesterol esterase 98.73
2ece_A462 462AA long hypothetical selenium-binding protein; 98.72
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 98.71
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 98.7
1thg_A 544 Lipase; hydrolase(carboxylic esterase); HET: NAG N 98.7
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 98.69
2bce_A 579 Cholesterol esterase; hydrolase, serine esterase, 98.69
1dx4_A 585 ACHE, acetylcholinesterase; hydrolase, serine este 98.68
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 98.67
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 98.67
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 98.66
2hfk_A319 Pikromycin, type I polyketide synthase pikaiv; alp 98.65
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 98.63
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 98.62
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 98.6
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 98.59
3bix_A 574 Neuroligin-1, neuroligin I; esterase domain, alpha 98.59
2cb9_A244 Fengycin synthetase; thioesterase, non-ribosomal p 98.55
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 98.54
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 98.54
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 98.54
3tej_A329 Enterobactin synthase component F; nonribosomal pe 98.53
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 98.52
3n2z_B 446 Lysosomal Pro-X carboxypeptidase; alpha/beta hydro 98.52
1ys1_X320 Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor h 98.52
1jmk_C230 SRFTE, surfactin synthetase; thioesterase, non-rib 98.51
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 98.49
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 98.49
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 98.48
3v65_B386 Low-density lipoprotein receptor-related protein; 98.48
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 98.47
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 98.47
3icv_A316 Lipase B, CALB; circular permutation, cleavage on 98.46
3v65_B386 Low-density lipoprotein receptor-related protein; 98.46
1bu8_A 452 Protein (pancreatic lipase related protein 2); hyd 98.45
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 98.43
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 98.42
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 98.41
1w52_X 452 Pancreatic lipase related protein 2; detergent, cl 98.41
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 98.39
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 98.39
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 98.39
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 98.37
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 98.37
1ex9_A285 Lactonizing lipase; alpha-beta hydrolase fold, pho 98.36
3p5b_L400 Low density lipoprotein receptor variant; B-propel 98.34
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 98.33
3p5b_L400 Low density lipoprotein receptor variant; B-propel 98.32
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 98.29
1hpl_A 449 Lipase; hydrolase(carboxylic esterase); 2.30A {Equ 98.27
2x5x_A342 PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE 98.27
2zyr_A 484 Lipase, putative; fatty acid, hydrolase; HET: 1PE; 98.22
1rp1_A 450 Pancreatic lipase related protein 1; hydrolase, li 98.19
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 98.18
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 98.17
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 98.16
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 98.15
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 98.15
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 98.14
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 98.13
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 98.13
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 98.12
2dst_A131 Hypothetical protein TTHA1544; conserved hypotheti 98.11
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 98.09
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 98.07
2p4o_A306 Hypothetical protein; putative lactonase, structur 98.02
4a0p_A628 LRP6, LRP-6, low-density lipoprotein receptor-rela 98.01
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 97.97
2qe8_A343 Uncharacterized protein; structural genomics, join 97.95
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 97.95
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 97.95
4a0p_A628 LRP6, LRP-6, low-density lipoprotein receptor-rela 97.9
2qe8_A343 Uncharacterized protein; structural genomics, join 97.9
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 97.86
3tjm_A283 Fatty acid synthase; thioesterase domain, fatty ac 97.86
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 97.82
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 97.79
2p4o_A306 Hypothetical protein; putative lactonase, structur 97.78
2fp8_A322 Strictosidine synthase; six bladed beta propeller 97.78
2fp8_A322 Strictosidine synthase; six bladed beta propeller 97.69
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 97.67
2hih_A431 Lipase 46 kDa form; A1 phospholipase, phospholipid 97.51
2dsn_A387 Thermostable lipase; T1 lipase, hydrolase; 1.50A { 97.47
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 97.46
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 97.37
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 97.15
1whs_A255 Serine carboxypeptidase II; HET: NAG FUC; 2.00A {T 97.1
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 97.09
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 97.06
1xip_A388 Nucleoporin NUP159; beta-propeller, transport prot 97.02
3kya_A496 Putative phosphatase; structural genomics, joint c 97.02
1kb0_A677 Quinohemoprotein alcohol dehydrogenase; beta-prope 96.99
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
Probab=100.00  E-value=1.3e-55  Score=540.59  Aligned_cols=629  Identities=14%  Similarity=0.090  Sum_probs=441.9

Q ss_pred             CCCCceecCCCCEEEEEecCCCCCchhcccccceeeceeecCCCCCccceeeEeceeEEEccCCCCCCceeee-ccCCCC
Q 002164          110 PLPALSFSPQRDKILFLKRRALPPLEELARPEEKLAGLRIDGKCNTRSRMSFYTGIGIHQLFPDGKLGQEIEI-QGFPDG  188 (958)
Q Consensus       110 ~~~~~~~SPDG~~laf~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~i~~~~~dg~~~~~~~l-t~~~~~  188 (958)
                      ....++|||||++|+.. .                                  ++|++|++.+    +..+.+ ++....
T Consensus        18 ~~~~~~w~~dg~~~~~~-~----------------------------------~~i~~~~~~~----~~~~~~~~~~~~~   58 (740)
T 4a5s_A           18 KLYSLRWISDHEYLYKQ-E----------------------------------NNILVFNAEY----GNSSVFLENSTFD   58 (740)
T ss_dssp             CCCCEEECSSSEEEEEE-T----------------------------------TEEEEEETTT----CCEEEEECTTTTT
T ss_pred             cccccEECCCCcEEEEc-C----------------------------------CcEEEEECCC----CceEEEEechhhh
Confidence            46689999999877764 3                                  3799999865    444444 322111


Q ss_pred             C-cc--cceeecCCCCeEEEEEeeccccCCCCCceEEEEEcCCCceeeccCCCCccccccccceEEecCCeEEEEEecCC
Q 002164          189 A-KL--NFVTWSQDGKHLAFSIRIDAEDSSSSKLRVWVADVDTGKARPLFQSPDIYLNAIFDNFVWVNNSTLLVCTIPLL  265 (958)
Q Consensus       189 ~-~~--~~~~wSPDG~~iaf~~~~~~~~~~~~~~~l~~~~~~~g~~~~lt~~~~~~~~~~~~~~~wspDG~~l~~~~~~~  265 (958)
                      . .+  ..++|||||++|+|..........+...++|++|+++|+.++|+..+..     +..++|||||+.|+|+    
T Consensus        59 ~~~~~~~~~~~Spdg~~l~~~~~~~~~~r~~~~~~~~~~d~~~~~~~~l~~~~~~-----~~~~~~SPdG~~la~~----  129 (740)
T 4a5s_A           59 EFGHSINDYSISPDGQFILLEYNYVKQWRHSYTASYDIYDLNKRQLITEERIPNN-----TQWVTWSPVGHKLAYV----  129 (740)
T ss_dssp             TCCSCCCEEEECTTSSEEEEEEEEEECSSSCEEEEEEEEETTTTEECCSSCCCTT-----EEEEEECSSTTCEEEE----
T ss_pred             hhcccccceEECCCCCEEEEEECCeeeEEEccceEEEEEECCCCcEEEcccCCCc-----ceeeEECCCCCEEEEE----
Confidence            1 22  2389999999999987533222234457899999999999988765543     6689999999999998    


Q ss_pred             CCCCCCCCCCCCCCceeeecCCcccccchhhhhccCchhhhHHHHhhcceEEEEEc-CCeeeecCCCcc---c-------
Q 002164          266 RGDPPKKPLVPLGPKMQSNEKRDIIQVRTFQDLLKDEYDEDLFDYYATTQLVLVSL-DGTVKEIGPPAV---Y-------  334 (958)
Q Consensus       266 ~~~~~~~~~~~~~~~~~~~~~~~~~~~r~~~d~~~~~~~~~~~~~~~~~~l~~~~~-~g~~~~l~~~~~---~-------  334 (958)
                                                                    ...+||++++ +|+.++|+..+.   +       
T Consensus       130 ----------------------------------------------~~~~i~~~~~~~~~~~~lt~~g~~~~~~~g~~~~  163 (740)
T 4a5s_A          130 ----------------------------------------------WNNDIYVKIEPNLPSYRITWTGKEDIIYNGITDW  163 (740)
T ss_dssp             ----------------------------------------------ETTEEEEESSTTSCCEECCSCCBTTTEEESBCCH
T ss_pred             ----------------------------------------------ECCeEEEEECCCCceEEEcCCCCccceecCcccc
Confidence                                                          2346999999 888888875411   1       


Q ss_pred             ----------cccccCCCCcEEEEEeecCCcccc--c-------------------cCCC--CCceeEEEeccC---c--
Q 002164          335 ----------TSLDPSPDEKYILISSIHRPYSFI--V-------------------PCGR--FPRQVGVWTTDG---I--  376 (958)
Q Consensus       335 ----------~~~~~SpDGk~l~~~~~~~~~~~~--~-------------------~~~~--~~~~i~l~d~~~---~--  376 (958)
                                ..+.|||||++|+|.+.+......  .                   +.+.  ...+|++||+++   +  
T Consensus       164 v~~ee~~~~~~~~~wSpDg~~la~~~~d~~~v~~~~~~~~~~~~~~~~~~~~~~yp~~G~~~~~~~l~v~d~~~~~~~~~  243 (740)
T 4a5s_A          164 VYEEEVFSAYSALWWSPNGTFLAYAQFNDTEVPLIEYSFYSDESLQYPKTVRVPYPKAGAVNPTVKFFVVNTDSLSSVTN  243 (740)
T ss_dssp             HHHHHTSSSSBCEEECTTSSEEEEEEEECTTCCEEEEEECCSTTCSSCEEEEEECCBTTSCCCEEEEEEEETTSCCSSSC
T ss_pred             cccchhcCCCcceEECCCCCEEEEEEEcccCCceEEEEeecCCCCCCCcceeecCCCCcCcCCeeEEEEEECCCCCCCCc
Confidence                      247899999999999755331100  0                   0011  112688999988   6  


Q ss_pred             -eEEEeccCCccccCcccccccccCcceeeeecCCCCceEEEEeccCCCcccccccCCeEEEEeCCCCCCCC-------c
Q 002164          377 -FVRELCDLPLAEDIPIAFNSVRKGMRSINWRSDKPSTLYWAETQDGGDAKVEVTPRDIIYTQQAEPVQGEG-------P  448 (958)
Q Consensus       377 -~~~~l~~~~~~~~~p~~~~~~~~~~~~~~~spDG~~l~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~g~~-------~  448 (958)
                       ..+.+.....       ..+....+..++|||||+.++++.+..         .....|+++++   ++++       .
T Consensus       244 ~~~~~l~~~~~-------~~~~~~~~~~~~wspdg~~~~~~~~r~---------~~~~~i~~~d~---~tg~~~~~~~~~  304 (740)
T 4a5s_A          244 ATSIQITAPAS-------MLIGDHYLCDVTWATQERISLQWLRRI---------QNYSVMDICDY---DESSGRWNCLVA  304 (740)
T ss_dssp             CCEEEECCCHH-------HHTSCEEEEEEEEEETTEEEEEEEESS---------TTEEEEEEEEE---ETTTTEEEECGG
T ss_pred             ceEEEecCCcc-------CCCCCeEEEEEEEeCCCeEEEEEeCCC---------CCEEEEEEEEC---CCCccccceeEE
Confidence             4555542100       000112346789999999777764432         22346899996   4544       3


Q ss_pred             eEE-Ee-ecccc-----CceeeecCCceEE-EEEeccccceEEEEEcCCCCCCCcEEEeccCCccccCCCCCCceEeccC
Q 002164          449 EIL-HK-LDLRY-----GGISWCDDSLALV-YESWYKTRRTRTWVISPGSKDVAPRILFDRSSEDVYSDPGSPMMRRTST  520 (958)
Q Consensus       449 ~~l-~~-~~~~~-----~~~~~spDg~~l~-~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~spd  520 (958)
                      +++ .. ....+     ..+.|||||+.|+ +.++.++ ..+||+++++++  ..+.++...... .       ..+++|
T Consensus       305 ~~l~~~~~~~~v~~~~~~~p~fspDG~~l~~~~s~~~G-~~~l~~~~~~~~--~~~~lT~g~~~v-~-------~~~~~d  373 (740)
T 4a5s_A          305 RQHIEMSTTGWVGRFRPSEPHFTLDGNSFYKIISNEEG-YRHICYFQIDKK--DCTFITKGTWEV-I-------GIEALT  373 (740)
T ss_dssp             GCEEEECSSSCSSSSSCCCCEECTTSSEEEEEEECTTS-CEEEEEEETTCS--SCEESCCSSSCE-E-------EEEEEC
T ss_pred             EEeeeccCCceEccCcCCCceEcCCCCEEEEEEEcCCC-ceEEEEEECCCC--ceEecccCCEEE-E-------EEEEEe
Confidence            334 22 22222     3799999999998 6655554 488999999884  556666543322 1       113467


Q ss_pred             CceEEEEeeeccCCCcEEEEccCCCCCCCCCCeEEEEECCCCceE-EEecCC-cccccceeEeecCCCccccccccCCEE
Q 002164          521 GTYVIAKIKKENDEGTYILLNGNGATPEGNIPFLDLFDINTGSKE-RIWESD-KEKYYETTVALMSDQTEGDLYLNQLKI  598 (958)
Q Consensus       521 G~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~~~dl~~g~~~-~l~~~~-~~~~~~~~~~~~~~~~~~~~s~dg~~l  598 (958)
                      |+.|+|.....            ..  .....+||.+++++++.+ +|+... ..    .     .....++||+||+.+
T Consensus       374 ~~~i~f~~~~~------------~~--~~~~~~ly~v~~~g~~~~~~lt~~~~~~----~-----~~~~~~~~S~dg~~~  430 (740)
T 4a5s_A          374 SDYLYYISNEY------------KG--MPGGRNLYKIQLIDYTKVTCLSCELNPE----R-----CQYYSVSFSKEAKYY  430 (740)
T ss_dssp             SSEEEEEESCG------------GG--CTTCBEEEEEETTEEEEEEESSTTTSTT----T-----BCBEEEEECTTSSEE
T ss_pred             CCEEEEEEecC------------CC--CCceeEEEEEECCCCCcceeeccccCCC----C-----CceEEEEECCCCCEE
Confidence            88999887320            00  112458999999887665 565321 00    0     011236899999999


Q ss_pred             EEEEecCCCCceEEEEECCCCCeeEeecCCCCC----CCCCCCcEEEEEEEeCCCeEEEEEEEecCCCCCCCCCCceEEE
Q 002164          599 LTSKESKTENTQYYIQSWPDKKSCQITDFPHPY----PQLASLQKELIKYQRKDGVQLSATLYLPPGYDPSKDGPLPCLF  674 (958)
Q Consensus       599 ~~~~~s~~~p~~~~~~d~~~g~~~~Lt~~~~~~----~~~~~~~~~~~~~~~~dg~~l~~~l~~P~~~~~~~~~~~P~vv  674 (958)
                      ++.++++. |+.+++++..+++..++...+..+    ........+.+++ ..||..+++++++|+++++.+  ++|+||
T Consensus       431 ~~~~s~~~-~p~~~l~~~~~~~~~~~l~~n~~~~~~~~~~~~~~~~~~~~-~~dg~~l~~~~~~P~~~~~~~--~~P~vv  506 (740)
T 4a5s_A          431 QLRCSGPG-LPLYTLHSSVNDKGLRVLEDNSALDKMLQNVQMPSKKLDFI-ILNETKFWYQMILPPHFDKSK--KYPLLL  506 (740)
T ss_dssp             EEEECSBS-SCEEEEEETTTTEEEEEEECCHHHHHHHTTEECCEEEEEEE-EETTEEEEEEEEECTTCCTTS--CEEEEE
T ss_pred             EEEeCCCC-CCEEEEEECCCCcEEEEeccChhhhhhhhhccCCccEEEEE-ccCCeEEEEEEEeCCCCCCCC--CccEEE
Confidence            99999887 788999998888776766554322    2333345677777 679999999999999886544  599999


Q ss_pred             EECCCCCcCcccCCcccCCCCCCCCcCcHHHHHHH-HCCcEEEEcCCCCCCCCCCcccc---hhhHHHHHHHHHHHHHHH
Q 002164          675 WSYPGEFKSKDAAGQVRGSPNEFPRIGSTSVLLWL-ARGFAILGGPTTPIIGEGDEEAN---DRFVEQLVACAEAAVEEV  750 (958)
Q Consensus       675 ~~hGg~~~~~~~~~~~~~~~~~~~~~~~~~~~~la-~~G~~vl~~~~~~~~G~G~~~~~---~~~~~~~~~D~~~av~~l  750 (958)
                      ++||++.....        ...|   ...+...++ ++||+|+++++++..++|..+..   ..+....++|+.+++++|
T Consensus       507 ~~HGg~~~~~~--------~~~~---~~~~~~~l~~~~G~~Vv~~D~rG~g~~g~~~~~~~~~~~~~~~~~D~~~~i~~l  575 (740)
T 4a5s_A          507 DVYAGPCSQKA--------DTVF---RLNWATYLASTENIIVASFDGRGSGYQGDKIMHAINRRLGTFEVEDQIEAARQF  575 (740)
T ss_dssp             ECCCCTTCCCC--------CCCC---CCSHHHHHHHTTCCEEEEECCTTCSSSCHHHHGGGTTCTTSHHHHHHHHHHHHH
T ss_pred             EECCCCccccc--------cccc---CcCHHHHHHhcCCeEEEEEcCCCCCcCChhHHHHHHhhhCcccHHHHHHHHHHH
Confidence            99998643210        0111   112344566 49999999888766555544321   233446789999999999


Q ss_pred             HHcCCCCCCcEEEEEeChHHHHHHHHHHhCCCceeEEEEeccCCCCCCCCCCcccc-cc--hhhhcHHHHHhcCcccccC
Q 002164          751 VRRGVAHPSKIAVGGHSYGAFMTANLLAHAPHLFCCGIARSGAYNRTLTPFGFQNE-DR--TLWEATSTYVEMSPFMSAN  827 (958)
Q Consensus       751 ~~~~~~d~~~i~l~G~S~GG~~a~~~a~~~p~~~~a~v~~~~~~~~~~~~~~~~~~-~~--~~~~~~~~~~~~sp~~~~~  827 (958)
                      .+++.+|++||+|+||||||++|+.++.++|++|+++|+.+|+.++......+... .+  ..+.+++.|...+|+..+.
T Consensus       576 ~~~~~~d~~ri~i~G~S~GG~~a~~~a~~~p~~~~~~v~~~p~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~  655 (740)
T 4a5s_A          576 SKMGFVDNKRIAIWGWSYGGYVTSMVLGSGSGVFKCGIAVAPVSRWEYYDSVYTERYMGLPTPEDNLDHYRNSTVMSRAE  655 (740)
T ss_dssp             HTSTTEEEEEEEEEEETHHHHHHHHHHTTTCSCCSEEEEESCCCCGGGSBHHHHHHHHCCSSTTTTHHHHHHSCSGGGGG
T ss_pred             HhcCCcCCccEEEEEECHHHHHHHHHHHhCCCceeEEEEcCCccchHHhhhHHHHHHcCCCCccccHHHHHhCCHHHHHh
Confidence            99898999999999999999999999999999999999999998754322111100 11  1256677888999999999


Q ss_pred             CCCC-CEEEEeeCCCCCCCCChHHHHHHHHHHHhCCCcEEEEEeCCCCccCCCcccHHHHHHHHHHHHHHhhccCC
Q 002164          828 KLKK-PILLVHGEEDNNSGTLTMQSDRFFNALKGHGALCRLVILPFESHGYAARESIMHVLWETDRWLQKYCVSNT  902 (958)
Q Consensus       828 ~~~~-P~Lii~G~~D~~v~~~~~~~~~~~~~l~~~g~~~~~~~~p~~~H~~~~~~~~~~~~~~i~~fl~~~l~~~~  902 (958)
                      ++++ |+||+||++|.+||  +.++.+++++|+..++++++++||+++|.+...+...++++.+.+||.++|....
T Consensus       656 ~i~~~P~Lii~G~~D~~v~--~~~~~~l~~~l~~~g~~~~~~~~~~~~H~~~~~~~~~~~~~~i~~fl~~~l~~~~  729 (740)
T 4a5s_A          656 NFKQVEYLLIHGTADDNVH--FQQSAQISKALVDVGVDFQAMWYTDEDHGIASSTAHQHIYTHMSHFIKQCFSLPA  729 (740)
T ss_dssp             GGGGSEEEEEEETTCSSSC--THHHHHHHHHHHHTTCCCEEEEETTCCTTCCSHHHHHHHHHHHHHHHHHHTTCC-
T ss_pred             cCCCCcEEEEEcCCCCccC--HHHHHHHHHHHHHCCCCeEEEEECCCCCcCCCCccHHHHHHHHHHHHHHHcCCCC
Confidence            9987 99999999999999  9999999999999999999999999999997677788899999999999997543
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>4hvt_A Ritya.17583.B, post-proline cleaving enzyme; ssgcid, structural genomics, S structural genomics center for infectious disease; 1.70A {Rickettsia typhi} Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>3f67_A Putative dienelactone hydrolase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 1.74A {Klebsiella pneumoniae subsp} Back     alignment and structure
>4ao6_A Esterase; hydrolase, thermo label; 1.60A {Unidentified} PDB: 4ao7_A 4ao8_A Back     alignment and structure
>2jbw_A Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine hydrolase; alpha/beta hydrolase, META-cleavage pathway; 2.1A {Arthrobacter nicotinovorans} SCOP: c.69.1.41 Back     alignment and structure
>3hxk_A Sugar hydrolase; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.20A {Lactococcus lactis subsp} Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>3ebl_A Gibberellin receptor GID1; alpha/beta hydrolase, lipase, gibberellin signaling pathway, hydrolase, nucleus, hydrolase receptor; HET: GA4; 1.90A {Oryza sativa subsp} PDB: 3ed1_A* Back     alignment and structure
>3bxp_A Putative lipase/esterase; putative carboxylesterase, structural genomics, joint center structural genomics, JCSG; HET: EPE; 1.70A {Lactobacillus plantarum WCFS1} PDB: 3d3n_A* Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>2i3d_A AGR_C_3351P, hypothetical protein ATU1826; structural genomics, APC5865, hydrolase, PSI-2, protein STRU initiative; HET: MSE; 1.50A {Agrobacterium tumefaciens str} SCOP: c.69.1.36 Back     alignment and structure
>3ksr_A Putative serine hydrolase; catalytic triad, structural genomics, JOIN for structural genomics, JCSG; 2.69A {Xanthomonas campestris PV} Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>3k2i_A Acyl-coenzyme A thioesterase 4; alpha/beta hydrolase fold seven-stranded beta-sandwich, structural genomics, structural genomics consortium, SGC; 2.40A {Homo sapiens} Back     alignment and structure
>3hlk_A Acyl-coenzyme A thioesterase 2, mitochondrial; alpha/beta hydrolase, alternative splicing, hydrolase, mitochondrion, polymorphism, serine esterase; 2.10A {Homo sapiens} Back     alignment and structure
>1vlq_A Acetyl xylan esterase; TM0077, structural genomics, JCSG, PR structure initiative, PSI, joint center for structural GENO hydrolase; 2.10A {Thermotoga maritima} SCOP: c.69.1.25 PDB: 3m81_A 3m83_A* 3m82_A* Back     alignment and structure
>3ga7_A Acetyl esterase; phosphoserine, IDP00896, hydrolase, serine structural genomics, center for structural genomics of INFE diseases, csgid; HET: SEP MSE; 1.55A {Salmonella typhimurium} Back     alignment and structure
>3doh_A Esterase; alpha-beta hydrolase, beta sheet; 2.60A {Thermotoga maritima} PDB: 3doi_A Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3fcx_A FGH, esterase D, S-formylglutathione hydrolase; retinoblastoma, genetic marker, cytoplasm, cytoplasmic vesicle, polymorphism, serine esterase; 1.50A {Homo sapiens} SCOP: c.69.1.0 Back     alignment and structure
>1zi8_A Carboxymethylenebutenolidase; alpha and beta proteins, 3-D structure, serine esterase, HYD aromatic hydrocarbons, catabolism; 1.40A {Pseudomonas putida} PDB: 1zj5_A* 1zi9_A 1zi6_A 1zj4_A* 1din_A 1ziy_A* 1zic_A 1zix_A 1ggv_A* Back     alignment and structure
>3i6y_A Esterase APC40077; lipase, structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic hydrolase; HET: MSE; 1.75A {Oleispira antarctica} PDB: 3s8y_A Back     alignment and structure
>3fcy_A Xylan esterase 1; alpha/beta hydrolase, carbohydrate esterase, CE7; 2.10A {Thermoanaerobacterium SP} Back     alignment and structure
>1l7a_A Cephalosporin C deacetylase; structural genomics, alpha-beta-alpha sandwich, PSI, protein structure initiative; 1.50A {Bacillus subtilis} SCOP: c.69.1.25 PDB: 1odt_C 1ods_A 3fvt_A 3fvr_A 3fyu_A* 2xlb_A 2xlc_A 3fyt_A* 3fyu_B* Back     alignment and structure
>2o2g_A Dienelactone hydrolase; YP_324580.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.92A {Anabaena variabilis} Back     alignment and structure
>3fak_A Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Uncultured bacterium} PDB: 3g9t_A 3g9u_A 3g9z_A 3h17_A* 3h18_A* 3h19_A 3h1a_A 3h1b_A 3l1h_A 3l1i_A 3l1j_A 3v9a_A Back     alignment and structure
>3bjr_A Putative carboxylesterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.09A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>2wtm_A EST1E; hydrolase; 1.60A {Clostridium proteoclasticum} PDB: 2wtn_A* Back     alignment and structure
>1mpx_A Alpha-amino acid ester hydrolase; alpha/beta hydrolase, jellyroll, selenomethionine; 1.90A {Xanthomonas citri} SCOP: b.18.1.13 c.69.1.21 Back     alignment and structure
>3ls2_A S-formylglutathione hydrolase; psychrophilic organism; 2.20A {Pseudoalteromonas haloplanktis} SCOP: c.69.1.0 Back     alignment and structure
>3trd_A Alpha/beta hydrolase; cellular processes; 1.50A {Coxiella burnetii} Back     alignment and structure
>3e4d_A Esterase D; S-formylglutathione hydrolase, hydrolase fold family, catalytic triad, kinetics, proposed reaction mechanism; HET: MSE; 2.01A {Agrobacterium tumefaciens} SCOP: c.69.1.0 Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>2b9v_A Alpha-amino acid ester hydrolase; catalytic triad, alpha/beta-hydrolase; 2.00A {Acetobacter pasteurianus} SCOP: b.18.1.13 c.69.1.21 PDB: 2b4k_A 1nx9_A* 1ryy_A Back     alignment and structure
>2hdw_A Hypothetical protein PA2218; alpha/beta hydrolase fold, structural genomics, PSI, structure initiative; 2.00A {Pseudomonas aeruginosa} Back     alignment and structure
>2fuk_A XC6422 protein; A/B hydrolase, structural genomics, X-RAY diffraction; 1.60A {Xanthomonas campestris} SCOP: c.69.1.36 Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>4fbl_A LIPS lipolytic enzyme; thermostable, structural genomics, enzyme function initiativ structural proteomics in europe, spine; HET: SPD; 1.99A {Unidentified} PDB: 4fbm_A Back     alignment and structure
>3qh4_A Esterase LIPW; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, tuberculosis, O LIPW, heroin esterase; 1.75A {Mycobacterium marinum} Back     alignment and structure
>2o7r_A CXE carboxylesterase; alpha/beta hydrolase; 1.40A {Actinidia eriantha} PDB: 2o7v_A Back     alignment and structure
>2hm7_A Carboxylesterase; alpha/beta hydrolase fold, hydrolase; 2.00A {Alicyclobacillus acidocaldarius} PDB: 1evq_A* 1u4n_A 1qz3_A Back     alignment and structure
>3ain_A 303AA long hypothetical esterase; carboxylesterase, thermophilic, dimer, archaea, R267G, hydro; 1.65A {Sulfolobus tokodaii} PDB: 3aio_A 3ail_A 3aik_A 3aim_A Back     alignment and structure
>2zsh_A Probable gibberellin receptor GID1L1; plant hormone receptor, gibberellin, gibberellin signaling pathway, hydrolase, nucleus, receptor, developmental protein; HET: GA3; 1.80A {Arabidopsis thaliana} PDB: 2zsi_A* Back     alignment and structure
>4b6g_A Putative esterase; hydrolase, formaldehyde detoxification, alpha/beta serine HY; 1.40A {Neisseria meningitidis MC58} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>1lzl_A Heroin esterase; alpha/beta hydrolase; 1.30A {Rhodococcus SP} SCOP: c.69.1.2 PDB: 1lzk_A Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>3hju_A Monoglyceride lipase; alpha/beta hydrolase, hydrolase, serine esterase; 2.20A {Homo sapiens} Back     alignment and structure
>4e15_A Kynurenine formamidase; alpha/beta hydrolase fold, hydrolase-hydrolase inhibitor COM; HET: SEB; 1.50A {Drosophila melanogaster} PDB: 4e14_A* 4e11_A Back     alignment and structure
>3h04_A Uncharacterized protein; protein with unknown function, structural genomics, MCSG, PS protein structure initiative; 1.90A {Staphylococcus aureus subsp} Back     alignment and structure
>3pfb_A Cinnamoyl esterase; alpha/beta hydrolase fold, hydrolase, cinnamoyl/Fe esterase, hydroxycinammates, extracellular; HET: ZYC; 1.58A {Lactobacillus johnsonii} PDB: 3pf9_A* 3pfc_A* 3s2z_A* 3pf8_A 3qm1_A* Back     alignment and structure
>3k6k_A Esterase/lipase; alpha/beta hydrolase fold; 2.20A {Uncultured bacterium} PDB: 3dnm_A Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>1jjf_A Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-xylan; feruloyl esterase, ferulic acid esterase, FAE_XYNZ, XYNZ, structural genomics; 1.75A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1jt2_A* Back     alignment and structure
>1lns_A X-prolyl dipeptidyl aminopetidase; alpha beta hydrolase fold; 2.20A {Lactococcus lactis} SCOP: a.40.2.1 b.18.1.13 c.69.1.21 Back     alignment and structure
>1jfr_A Lipase; serine hydrolase; 1.90A {Streptomyces exfoliatus} SCOP: c.69.1.16 Back     alignment and structure
>2c7b_A Carboxylesterase, ESTE1; carboxyesterase, thermophilic enzyme, hydrolase, HSL, alpha/beta hydrolase fold; 2.3A {Uncultured archaeon} Back     alignment and structure
>2uz0_A Esterase, tributyrin esterase; alpha/beta hydrolase, hydrolase, A virulence facto LUNG infection; HET: MSE; 1.7A {Streptococcus pneumoniae} Back     alignment and structure
>1jkm_A Brefeldin A esterase; serine hydrolase, degradation of brefeldin A, alpha/beta hydrolase family; 1.85A {Bacillus subtilis} SCOP: c.69.1.2 Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3pe6_A Monoglyceride lipase; alpha-beta hydrolase fold, 2-arachidonyl-glycerol, M associated, hydrolase, hydrolase-hydrolase inhibitor comple; HET: ZYH; 1.35A {Homo sapiens} PDB: 3jw8_A 3jwe_A* Back     alignment and structure
>3vis_A Esterase; alpha/beta-hydrolase fold, polyethylene terephthal hydrolase; HET: PE4; 1.76A {Thermobifida alba} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>4h0c_A Phospholipase/carboxylesterase; PSI-biology, midwest center for structural genomics, MCSG, hydrolase; HET: CIT; 1.62A {Dyadobacter fermentans} Back     alignment and structure
>1auo_A Carboxylesterase; hydrolase; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.14 PDB: 1aur_A* Back     alignment and structure
>1ufo_A Hypothetical protein TT1662; alpha-beta fold, hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.60A {Thermus thermophilus} SCOP: c.69.1.27 Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>2pbl_A Putative esterase/lipase/thioesterase; alpha/beta-hydrolases fold, structural genomics, joint cente structural genomics, JCSG; 1.79A {Silicibacter SP} SCOP: c.69.1.2 Back     alignment and structure
>1k8q_A Triacylglycerol lipase, gastric; APHA beta hydrolase fold, hydrolase; HET: NAG BOG C11; 2.70A {Canis lupus familiaris} SCOP: c.69.1.6 PDB: 1hlg_A* Back     alignment and structure
>3fnb_A Acylaminoacyl peptidase SMU_737; alpha-beta-alpha sandwich, helix bundle, structural genomics protein structure initiative; HET: PGE; 2.12A {Streptococcus mutans} Back     alignment and structure
>4fhz_A Phospholipase/carboxylesterase; alpha/beta hydrolase superfamily, central beta-STR sheet, flanked alpha helices, hydrolase; 2.01A {Rhodobacter sphaeroides} PDB: 4ftw_A* Back     alignment and structure
>3llc_A Putative hydrolase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE PG4; 1.80A {Agrobacterium vitis} Back     alignment and structure
>3og9_A Protein YAHD A copper inducible hydrolase; alpha/beta hydrolase, copper homeostasis, malic acid; 1.88A {Lactococcus lactis subsp} SCOP: c.69.1.0 Back     alignment and structure
>1fj2_A Protein (acyl protein thioesterase 1); alpha/beta hydrolase, serine hydrolase, SAD, anomalous diffr hydrolase; 1.50A {Homo sapiens} SCOP: c.69.1.14 Back     alignment and structure
>3i2k_A Cocaine esterase; alpha/beta hydrolase, hydrolase; HET: DBC GOL; 1.51A {Rhodococcus SP} PDB: 3i2j_A* 3puh_A 3i2h_A* 3i2i_A* 3i2g_A* 3ida_A* 3i2f_A* 3pui_A 1ju3_A 1ju4_A 1l7q_A 1l7r_A Back     alignment and structure
>3mve_A FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/respiration switch protein, hydrolase ACTI lyase; 2.20A {Vibrio vulnificus} PDB: 3our_A Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>1jji_A Carboxylesterase; alpha-beta hydrolase fold, hydrolase; HET: EPE; 2.20A {Archaeoglobus fulgidus} SCOP: c.69.1.2 Back     alignment and structure
>3dkr_A Esterase D; alpha beta hydrolase, mechanism, catalytic triad, rotation; 1.60A {Lactobacillus rhamnosus} SCOP: c.69.1.0 PDB: 3dlt_A 3dyi_A 3dyv_A 3e1g_A Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>3cn9_A Carboxylesterase; alpha/beta hydrolase fold super-family, hydrolase; HET: 2PE; 2.09A {Pseudomonas aeruginosa} PDB: 3cn7_A* Back     alignment and structure
>2h1i_A Carboxylesterase; structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics, MCSG, H; HET: MSE; 2.80A {Bacillus cereus} SCOP: c.69.1.14 Back     alignment and structure
>3iii_A COCE/NOND family hydrolase; structural genomics, center for structural genomi infectious diseases, csgid; HET: MSE PLM; 1.95A {Staphylococcus aureus subsp} PDB: 3ib3_A* Back     alignment and structure
>3d0k_A Putative poly(3-hydroxybutyrate) depolymerase LPQ; alpha-beta-alpha sandwich, structural genomics, PSI-2; 1.83A {Bordetella parapertussis 12822} Back     alignment and structure
>3bdi_A Uncharacterized protein TA0194; NP_393672.1, predicted CIB-like hydrolase, structural genomi center for structural genomics; HET: MSE; 1.45A {Thermoplasma acidophilum dsm 1728} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>3u0v_A Lysophospholipase-like protein 1; alpha, beta hydrolase fold, hydrolase; 1.72A {Homo sapiens} Back     alignment and structure
>1vkh_A Putative serine hydrolase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.85A {Saccharomyces cerevisiae} SCOP: c.69.1.32 Back     alignment and structure
>3d7r_A Esterase; alpha/beta fold, hydrolase; 2.01A {Staphylococcus aureus subsp} Back     alignment and structure
>3rm3_A MGLP, thermostable monoacylglycerol lipase; alpha/beta hydrolase fold, hydrolase; 1.20A {Bacillus SP} PDB: 3rli_A Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>3b5e_A MLL8374 protein; NP_108484.1, carboxylesterase, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; 1.75A {Mesorhizobium loti} SCOP: c.69.1.14 Back     alignment and structure
>4f0j_A Probable hydrolytic enzyme; alpha/beta hydrolase fold, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>2r8b_A AGR_C_4453P, uncharacterized protein ATU2452; APC6088, agrobacterium tumefaciens STR. C58 structural genomics, PSI-2; 2.56A {Agrobacterium tumefaciens str} SCOP: c.69.1.14 Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1sfr_A Antigen 85-A; alpha/beta hydrolase, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 2.70A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>1gkl_A Endo-1,4-beta-xylanase Y; hydrolase, esterase family 1, inactive mutant; HET: FER; 1.4A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1wb4_A* 1wb5_A* 1wb6_A* 1gkk_A* Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>4ezi_A Uncharacterized protein; alpha-beta hydrolases fold, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.15A {Legionella pneumophila subsp} Back     alignment and structure
>3nuz_A Putative acetyl xylan esterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology; 2.30A {Bacteroides fragilis} Back     alignment and structure
>1tht_A Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.13 Back     alignment and structure
>1r88_A MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBPC1, immune system; 1.71A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>2qru_A Uncharacterized protein; alpha/beta-hydrolase, structural GENO PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.65A {Enterococcus faecalis} Back     alignment and structure
>2qm0_A BES; alpha-beta structure, structural genomics, PSI-2, protein ST initiative, midwest center for structural genomics, MCSG; HET: SVY; 1.84A {Bacillus cereus atcc 14579} Back     alignment and structure
>3g8y_A SUSD/RAGB-associated esterase-like protein; structural genom joint center for structural genomics, JCSG; HET: MSE; 1.90A {Bacteroides vulgatus atcc 8482} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>2fx5_A Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pseudomonas mendocina} Back     alignment and structure
>2qjw_A Uncharacterized protein XCC1541; putative hydrolase of the alpha/beta superfamily, structural genomics; HET: MSE TLA P6G; 1.35A {Xanthomonas campestris PV} Back     alignment and structure
>1qlw_A Esterase; anisotropic refinement, atomic resolution, alpha/beta hydrolase; 1.09A {Alcaligenes SP} SCOP: c.69.1.15 PDB: 2wkw_A* Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3ia2_A Arylesterase; alpha-beta hydrolase fold, transition state analog, hydrolas oxidoreductase, peroxidase; 1.65A {Pseudomonas fluorescens} SCOP: c.69.1.12 PDB: 1va4_A 3t52_A* 3t4u_A* 3hi4_A 3hea_A Back     alignment and structure
>3d59_A Platelet-activating factor acetylhydrolase; secreted protein, alpha/beta-hydrolase-fold, LDL-bound, lipoprotein associated phospholipase A2, LP-PLA2; 1.50A {Homo sapiens} PDB: 3d5e_A 3f97_A* 3f98_A 3f9c_A* 3f96_A* Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1a88_A Chloroperoxidase L; haloperoxidase, oxidoreductase; 1.90A {Streptomyces lividans} SCOP: c.69.1.12 Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1zoi_A Esterase; alpha/beta hydrolase fold; 1.60A {Pseudomonas putida} PDB: 4dgq_A Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>2y6u_A Peroxisomal membrane protein LPX1; hydrolase, putative esterase, putative lipase; HET: CME CSO; 1.90A {Saccharomyces cerevisiae} PDB: 2y6v_A* Back     alignment and structure
>3vdx_A Designed 16NM tetrahedral protein CAGE containing bromoperoxidase BPO-A2 and matrix...; protein design, bionanotechnology; 3.00A {Streptomyces aureofaciens} PDB: 4d9j_A Back     alignment and structure
>1tqh_A Carboxylesterase precursor; tetrahedral intermediate, alpha/beta hydrolase; 1.63A {Geobacillus stearothermophilus} SCOP: c.69.1.29 PDB: 1r1d_A* 4diu_A Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2ocg_A Valacyclovir hydrolase; alpha beta hydrolase fold; 1.75A {Homo sapiens} PDB: 2oci_A* 2ock_A 2ocl_A Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>4fle_A Esterase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, alpha-beta protein, rossmann fold, HY; 2.10A {Yersinia enterocolitica subsp} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>1a8s_A Chloroperoxidase F; haloperoxidase, oxidoreductase, propionate complex; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.12 Back     alignment and structure
>3r0v_A Alpha/beta hydrolase fold protein; structural genomics, PSI-biology, protein structure initiati alpha/beta hydrolase; HET: MSE; 1.38A {Sphaerobacter thermophilus} Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>1imj_A CIB, CCG1-interacting factor B; alpha/beta hydrolase, CCG1 interactor; 2.20A {Homo sapiens} SCOP: c.69.1.23 Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>2yys_A Proline iminopeptidase-related protein; TTHA1809, structural genomics, unknown function; 2.20A {Thermus thermophilus} Back     alignment and structure
>1dqz_A 85C, protein (antigen 85-C); fibronectin, structural genomics, PSI, protein structure initiative, TB structural genomics consortium; 1.50A {Mycobacterium tuberculosis} SCOP: c.69.1.3 PDB: 3hrh_A 1dqy_A 1va5_A* 1f0n_A* 1f0p_A* Back     alignment and structure
>3u1t_A DMMA haloalkane dehalogenase; alpha/beta-hydrolase, hydrolase; 2.20A {Unidentified} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>4f21_A Carboxylesterase/phospholipase family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Francisella tularensis subsp} Back     alignment and structure
>3qit_A CURM TE, polyketide synthase; thioesterase, alpha/beta hydrolase, decarboxylase, sulfate elimination, terminal alkene production; 1.68A {Lyngbya majuscula 19L} Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>3fob_A Bromoperoxidase; structural genomics, IDP00046, bacillus ANT peroxidase, oxidoreductase; 1.74A {Bacillus anthracis str} SCOP: c.69.1.0 Back     alignment and structure
>1a8q_A Bromoperoxidase A1; haloperoxidase, oxidoreductase; 1.75A {Streptomyces aureofaciens} SCOP: c.69.1.12 Back     alignment and structure
>3om8_A Probable hydrolase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MES; 2.25A {Pseudomonas aeruginosa} SCOP: c.69.1.0 Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>1mtz_A Proline iminopeptidase; alpha-beta hydrolase, CAP domain, caged active site, prolyl peptidase; 1.80A {Thermoplasma acidophilum} SCOP: c.69.1.7 PDB: 1mt3_A 1mu0_A* 1xrr_A 1xrq_A 1xro_A 1xrn_A 1xrm_A 1xrp_A 1xrl_A* 1xqw_A* 1xqx_A* 1xqy_A 1xqv_A Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>3c8d_A Enterochelin esterase; alpha-beta-alpha sandwich, IROD, iron aquisition, structural genomics, PSI-2, protein structure initiative; HET: CIT; 1.80A {Shigella flexneri 2a str} SCOP: b.1.18.20 c.69.1.2 PDB: 2b20_A 3c87_A* 3c8h_A 3mga_A* Back     alignment and structure
>3oos_A Alpha/beta hydrolase family protein; APC67239.0, protein structure initiative, PSI-2, structural midwest center for structural genomics, MCSG; HET: MSE PG4; 1.65A {Bacillus anthracis} Back     alignment and structure
>1q0r_A RDMC, aclacinomycin methylesterase; anthracycline, hydrolase, polyketide, tailoring enzyme, structural proteomics in europe, spine; HET: AKT 1PE; 1.45A {Streptomyces purpurascens} SCOP: c.69.1.28 PDB: 1q0z_A* Back     alignment and structure
>3dqz_A Alpha-hydroxynitrIle lyase-like protein; A/B-hydrloase fold, cyanogenesis; 2.50A {Arabidopsis thaliana} SCOP: c.69.1.0 Back     alignment and structure
>3e0x_A Lipase-esterase related protein; APC60309, clostridium acetobutylicum ATCC 824, structural genomics, PSI-2; HET: MSE; 1.45A {Clostridium acetobutylicum} Back     alignment and structure
>1brt_A Bromoperoxidase A2; haloperoxidase, oxidoreductase, alpha/beta hydrolase fold, mutant M99T; 1.50A {Streptomyces aureofaciens} SCOP: c.69.1.12 PDB: 1bro_A 1a8u_A 1a7u_A Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>2r11_A Carboxylesterase NP; 2632844, putative hydrolase, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE; 1.96A {Bacillus subtilis} Back     alignment and structure
>3v48_A Aminohydrolase, putative aminoacrylate hydrolase RUTD; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.10A {Escherichia coli SE11} Back     alignment and structure
>4dnp_A DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petunia hybrida} PDB: 4dnq_A Back     alignment and structure
>2gzs_A IROE protein; enterobactin, salmochelin, DFP, hydrolase, catalytic DYAD; HET: DFP; 1.40A {Escherichia coli} SCOP: c.69.1.38 PDB: 2gzr_A* Back     alignment and structure
>2pl5_A Homoserine O-acetyltransferase; alpha/beta hydrolase superfa transferase; 2.20A {Leptospira interrogans} SCOP: c.69.1.40 Back     alignment and structure
>3qvm_A OLEI00960; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase fold, hydrolase; 2.00A {Oleispira antarctica} Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>3hss_A Putative bromoperoxidase; alpha beta hydrolase, oxidoreductase, hydrolase; 1.90A {Mycobacterium tuberculosis} PDB: 3e3a_A 3hys_A 3hzo_A Back     alignment and structure
>3guu_A Lipase A; protein structure, hydrolase; HET: 1PE; 2.10A {Candida antarctica} PDB: 2veo_A* Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3sty_A Methylketone synthase 1; alpha/beta hydrolase, decarboxylase, hydrolase; HET: DKA; 1.70A {Lycopersicon hirsutum F} PDB: 3stu_A* 3stt_A* 3stv_A* 3stw_A* 3stx_A* Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>3kxp_A Alpha-(N-acetylaminomethylene)succinic acid hydrolase; alpha/beta hydrolase, PLP degradation, E-2- (acetamidomethylene)succinate; 2.26A {Mesorhizobium loti} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>2xua_A PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, catechol metabolism; 1.90A {Burkholderia xenovorans} Back     alignment and structure
>3h2g_A Esterase; xanthomonas oryzae PV. oryzae, cell WALL degrading enzyme, RICE, virulence, innate immune responses, pathogenesis; 1.86A {Xanthomonas oryzae PV} PDB: 3h2j_A 3h2k_A* 3h2h_A 3h2i_A Back     alignment and structure
>3nwo_A PIP, proline iminopeptidase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, mycobac smegmatis; 1.90A {Mycobacterium smegmatis} Back     alignment and structure
>3fsg_A Alpha/beta superfamily hydrolase; PF00561, MCSG, PSI, PSI-2, structural genomics, protein structure initiative, midwest for structural genomics; 2.00A {Oenococcus oeni} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>1hkh_A Gamma lactamase; hydrolase, alpha/beta hydrolase, CO-factor free haloperoxidase,; 1.73A {Microbacterium} SCOP: c.69.1.12 PDB: 1hl7_A* Back     alignment and structure
>3i1i_A Homoserine O-acetyltransferase; structural genomics, IDP01610, O-acetyltransfera bacillus anthracis; HET: MSE; 2.44A {Bacillus anthracis str} Back     alignment and structure
>1wm1_A Proline iminopeptidase; complex with inhibitor, hydrolase; HET: PTB; 2.10A {Serratia marcescens} SCOP: c.69.1.7 PDB: 1qtr_A* 1x2b_A* 1x2e_A* Back     alignment and structure
>1c4x_A BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoat hydrolase); PCB degradation; 2.40A {Rhodococcus SP} SCOP: c.69.1.10 Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>2puj_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; C-C bond hydrolase, hydrolase; HET: HPZ; 1.57A {Burkholderia xenovorans} PDB: 2pu7_A* 3v1m_A* 3v1l_A* 2puh_A* 3v1n_A* 3v1k_A* 2og1_A 2pu5_A 2rhw_A* 2rht_A* 2ri6_A Back     alignment and structure
>2qs9_A Retinoblastoma-binding protein 9; B5T overexpressed gene protein, BOG, RBBP9, RBBP10, HR2978, NESG, structural genomics, PSI-2; 1.72A {Homo sapiens} Back     alignment and structure
>4g9e_A AHL-lactonase, alpha/beta hydrolase fold protein; AHL-binding; HET: C4L; 1.09A {Ochrobactrum} PDB: 4g5x_A* 4g8b_A* 4g8d_A 4g8c_A* 4g9g_A Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>1azw_A Proline iminopeptidase; aminopeptidase, serine protease, xanthomonas campestris; 2.70A {Xanthomonas citri} SCOP: c.69.1.7 Back     alignment and structure
>2e3j_A Epoxide hydrolase EPHB; epoxide hydrolase B, structural mycobacterium tuberculosis structural proteomics project, X hydrolase; 2.10A {Mycobacterium tuberculosis} PDB: 2zjf_A* Back     alignment and structure
>2b61_A Homoserine O-acetyltransferase; acyl-enzyme, aspartate pathway, coenzyme A, structure-functi studies, alpha-beta hydrolase fold; 1.65A {Haemophilus influenzae} SCOP: c.69.1.40 Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>2cjp_A Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tuberosum} PDB: 3cxu_A* Back     alignment and structure
>2rau_A Putative esterase; NP_343859.1, putative lipase, structural genomics, joint CEN structural genomics, JCSG; HET: PG4 UNL; 1.85A {Sulfolobus solfataricus P2} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3g9x_A Haloalkane dehalogenase; alpha/beta hydrolase, helical CAP domain, catalytic triad (A His272, Glu130), mutant, I135F, haloalkanes; 0.95A {Rhodococcus SP} SCOP: c.69.1.8 PDB: 3fwh_A 3fbw_A 3rlt_A 3rk4_A 1bn6_A 1bn7_A 4fwb_A 1cqw_A 3sk0_A 2v9z_A Back     alignment and structure
>1iup_A META-cleavage product hydrolase; aromatic compounds, cumene, isopropylbenzene, META-cleavage compound hydrolase; 1.60A {Pseudomonas fluorescens} SCOP: c.69.1.10 PDB: 1iun_A 1iuo_A 1uk6_A 1uk7_A 1uk8_A 1uk9_A 1uka_A 1ukb_A 2d0d_A Back     alignment and structure
>2wue_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolase BPHD; HET: KEK; 1.80A {Mycobacterium tuberculosis} PDB: 2wud_A* 2wuf_A* 2wug_A* 2vf2_A Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>1j1i_A META cleavage compound hydrolase; carbazole degradation, META cleavage product hydrolase, histidine tagged protein, alpha/beta-hydrolase; 1.86A {Janthinobacterium} SCOP: c.69.1.10 Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1uxo_A YDEN protein; hydrolase, A/B hydrolase, esterase, PSI, protein structure initiative, MCSG, midwest center for structural genomics; 1.8A {Bacillus subtilis} SCOP: c.69.1.31 Back     alignment and structure
>1wom_A RSBQ, sigma factor SIGB regulation protein RSBQ; alpha/beta hydrolase, signaling protein; 2.50A {Bacillus subtilis} PDB: 1wpr_A* Back     alignment and structure
>3bf7_A Esterase YBFF; thioesterase, helical CAP, hydrolase; 1.10A {Escherichia coli} PDB: 3bf8_A Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>2xmz_A Hydrolase, alpha/beta hydrolase fold family; menaquinone biosynthesis, lyase; 1.94A {Staphylococcus aureus} Back     alignment and structure
>2d81_A PHB depolymerase; alpha/beta hydrolase fold, circular permutation, hydrolase; HET: NAG RB3; 1.66A {Penicillium funiculosum} SCOP: c.69.1.37 PDB: 2d80_A* Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>1xkl_A SABP2, salicylic acid-binding protein 2; alpha-beta protein, structural genomics, protein structure initiative, PSI; HET: STH; 2.00A {Nicotiana tabacum} SCOP: c.69.1.20 PDB: 1y7i_A* 1y7h_A* Back     alignment and structure
>2xt0_A Haloalkane dehalogenase; hydrolase, alpha-beta hydrolase fold; 1.90A {Plesiocystis pacifica} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>1b6g_A Haloalkane dehalogenase; hydrolase, alpha/beta-hydrolase; 1.15A {Xanthobacter autotrophicus} SCOP: c.69.1.8 PDB: 1be0_A 1cij_A 2yxp_X 1edd_A 1edb_A 2dhc_A 2dhe_A 2eda_A 2edc_A 2had_A 1ede_A 2pky_X 1bez_A 1bee_A 2dhd_A* 1hde_A Back     alignment and structure
>3p2m_A Possible hydrolase; alpha/beta hydrolase superfamily; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>2qvb_A Haloalkane dehalogenase 3; RV2579, alpha-beta hydrolase protei structural genomics consortium, TBSGC, hydrolase; 1.19A {Mycobacterium tuberculosis} PDB: 2o2i_A 2o2h_A Back     alignment and structure
>3r40_A Fluoroacetate dehalogenase; FACD, defluorinase, alpha/beta hydrolase, hydrolase; 1.05A {Rhodopseudomonas palustris} PDB: 3r3w_A 3r3x_A 3r3v_A 3r3u_A 3r3z_A 3r41_A 3r3y_A Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>2wfl_A Polyneuridine-aldehyde esterase; alkaloid metabolism, monoterpenoid indole alkaloids, PNAE, hydrolase, serine esterase; HET: CME; 2.10A {Rauvolfia serpentina} PDB: 2wfm_A 3gzj_A* Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3bwx_A Alpha/beta hydrolase; YP_496220.1, joint center for structural genomics, protein structure initiative, PSI-2; HET: MSE; 1.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>1u2e_A 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase; alpha/beta hydrolase fold; 2.10A {Escherichia coli} Back     alignment and structure
>3gff_A IROE-like serine hydrolase; NP_718593.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; 2.12A {Shewanella oneidensis} Back     alignment and structure
>1ycd_A Hypothetical 27.3 kDa protein in AAP1-SMF2 intergenic region; esterase, lipase, serine hydrolase, structural genomics; HET: LI5; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2q0x_A Protein DUF1749, uncharacterized protein; alpha/beta hydrolase fold, structural genomics, structural G of pathogenic protozoa consortium; 2.20A {Trypanosoma brucei} Back     alignment and structure
>1mj5_A 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; LINB, haloalkane dehalogenase, 1, 3, 4, 4-cyclohexadiene dehalogenase; 0.95A {Sphingomonas paucimobilis} SCOP: c.69.1.8 PDB: 1cv2_A 1d07_A 2bfn_A 1g42_A* 1g4h_A* 1g5f_A* 1iz7_A 1iz8_A* 1k5p_A 1k63_A 1k6e_A Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>1m33_A BIOH protein; alpha-betta-alpha sandwich, structural genomics, PSI, protei structure initiative; HET: MSE 3OH; 1.70A {Escherichia coli} SCOP: c.69.1.26 Back     alignment and structure
>3pic_A CIP2; alpha/beta hydrolase fold, glucuronoyl esterase, carbohydrat esterase family 15 (CE-15), N-linked glycosylation, secrete hydrolase; HET: NAG; 1.90A {Hypocrea jecorina} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3fla_A RIFR; alpha-beta hydrolase thioesterase, hydrolase; HET: MSE; 1.80A {Amycolatopsis mediterranei} PDB: 3flb_A* Back     alignment and structure
>3c6x_A Hydroxynitrilase; atomic resolution, hydroxynitril lyase, catalysis, protonation state, AB initio calculations, substrate bindin; 1.05A {Hevea brasiliensis} SCOP: c.69.1.20 PDB: 1sc9_A 1yas_A* 2g4l_A* 2yas_A 1qj4_A 3c6y_A 3c6z_A 3c70_A 3yas_A 4yas_A 5yas_A* 6yas_A 7yas_A* 1yb6_A* 1yb7_A 1sck_A 1sci_A 1scq_A 1dwo_A 1dwp_A ... Back     alignment and structure
>4g4g_A 4-O-methyl-glucuronoyl methylesterase; alpha/beta hydrolase, 3-layer alpha/beta/alpha sandwich, ROS fold, glucuronoyl esterase; 1.55A {Myceliophthora thermophila} PDB: 4g4i_A 4g4j_A* Back     alignment and structure
>3bdv_A Uncharacterized protein DUF1234; DUF1234 family protein, alpha/beta-hydrolases fold, structur genomics; HET: MSE; 1.66A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>2vat_A Acetyl-COA--deacetylcephalosporin C acetyltransferase; A/B- hydrolase fold, acyltransferase, acetyl coenzyme A, antibiotic biosynthesis; HET: COA; 2.2A {Acremonium chrysogenum} SCOP: c.69.1.40 PDB: 2vav_A* 2vax_A* Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>1isp_A Lipase; alpha/beta hydrolase fold, hydrolase; 1.30A {Bacillus subtilis} SCOP: c.69.1.18 PDB: 1i6w_A 1r4z_A* 1r50_A* 2qxu_A 2qxt_A 1t4m_A 1t2n_A 3d2a_A 3qzu_A 3d2b_A 3d2c_A 3qmm_A Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>4fol_A FGH, S-formylglutathione hydrolase; D-type esterase, oxidation sensor motif, esterase activity activation, esterase activity inhibition; 2.07A {Saccharomyces cerevisiae} PDB: 1pv1_A 3c6b_A* 4flm_A* Back     alignment and structure
>3kda_A CFTR inhibitory factor (CIF); alpha/beta hydrolase, hydrolase; 1.50A {Pseudomonas aeruginosa ucbpp-pa14} PDB: 3kd2_A 3pi6_A Back     alignment and structure
>1pja_A Palmitoyl-protein thioesterase 2 precursor; hydrolase, glycoprotein, lysosome; HET: NAG; 2.70A {Homo sapiens} SCOP: c.69.1.13 Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>3afi_E Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 1.75A {Bradyrhizobium japonicum} PDB: 3a2m_A* 3a2n_A 3a2l_A* Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>1ehy_A Protein (soluble epoxide hydrolase); alpha/beta hydrolase fold, epoxide degradation, epichlorohydrin; 2.10A {Agrobacterium tumefaciens} SCOP: c.69.1.11 Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3ibt_A 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, oxidoreductase; 2.60A {Pseudomonas putida} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>2qmq_A Protein NDRG2, protein NDR2; alpha/beta-hydrolases fold, NDR family, developmental protei differentiation, neurogenesis, phosphorylation; HET: 2PE; 1.70A {Mus musculus} PDB: 2xmq_A 2xmr_A 2xms_A Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>1qe3_A PNB esterase, para-nitrobenzyl esterase; alpha-beta hydrolase directed evolution; 1.50A {Bacillus subtilis} SCOP: c.69.1.1 PDB: 1c7j_A 1c7i_A Back     alignment and structure
>3qmv_A Thioesterase, REDJ; alpha/beta hydrolase fold, hydrolase; 2.12A {Streptomyces coelicolor} PDB: 3qmw_A* Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2psd_A Renilla-luciferin 2-monooxygenase; alpha/beta-hydrolase, luciferase, oxidoreductase; 1.40A {Renilla reniformis} PDB: 2pse_A 2psj_A* 2psh_A 2psf_A Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>1r3d_A Conserved hypothetical protein VC1974; structural genomics, hydrolase, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI; 1.90A {Vibrio cholerae} SCOP: c.69.1.35 Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3b12_A Fluoroacetate dehalogenase; dehalogease, hydrolase; 1.20A {Burkholderia SP} PDB: 1y37_A Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>3l80_A Putative uncharacterized protein SMU.1393C; alpha/beta hydrolase fold, carboxylesterase, Ser- hydrolase; 2.00A {Streptococcus mutans} Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>4i19_A Epoxide hydrolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.15A {Streptomyces carzinostaticus subsp} Back     alignment and structure
>2wj6_A 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxidoreductase, alpha/beta hydrolase; HET: ZZ8 SRT; 2.00A {Arthrobacter nitroguajacolicus} PDB: 2wj4_A* 2wj3_A* 2wm2_A* Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>3lcr_A Tautomycetin biosynthetic PKS; alpha-beta hydrolase, thioesterase, polyketide synthase, phosphopantetheine, transferase, hydrolase; 2.00A {Streptomyces SP} Back     alignment and structure
>3qyj_A ALR0039 protein; alpha/beta fold, hydrolase; 1.78A {Nostoc SP} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>3c5v_A PME-1, protein phosphatase methylesterase 1; demethylase, PP2A, alternative splicing, hydrolase, phosphoprotein, serine esterase; 2.00A {Homo sapiens} PDB: 3c5w_P Back     alignment and structure
>3fle_A SE_1780 protein; structural genomics, APC61035.1, PSI-2, protein structure in midwest center for structural genomics, MCSG; 2.01A {Staphylococcus epidermidis} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3ds8_A LIN2722 protein; unkonwn function, structural genomics, PSI, MCSG, P structure initiative; 1.80A {Listeria innocua} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>1kez_A Erythronolide synthase; polyketide synthase, modular polyketide synthase, thioesterase, 6-DEB, TE, DEBS, alpha, beta-hydrolase; 2.80A {Saccharopolyspora erythraea} SCOP: c.69.1.22 PDB: 1mo2_A Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3lp5_A Putative cell surface hydrolase; structural genom PSI2, MCSG, protein structure initiative, midwest center FO structural genomics; 2.00A {Lactobacillus plantarum} Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1ukc_A ESTA, esterase; fungi, A/B hydrolase fold, acetylcholinesterase, H; HET: NAG MAN; 2.10A {Aspergillus niger} SCOP: c.69.1.17 Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>3ils_A PKS, aflatoxin biosynthesis polyketide synthase; A/B hydrolase, thioesterase, norsolorinic acid, P polyketide, acyltransferase; 1.70A {Aspergillus parasiticus} Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>3g02_A Epoxide hydrolase; alpha/beta hydrolase fold, enantioselective, mutant, directed evolution; 1.50A {Aspergillus niger} SCOP: c.69.1.11 PDB: 1qo7_A 3g0i_A* Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1tca_A Lipase; hydrolase(carboxylic esterase); HET: NAG; 1.55A {Candida antarctica} SCOP: c.69.1.17 PDB: 1lbs_A* 1lbt_A* 1tcb_A* 1tcc_A* Back     alignment and structure
>2h7c_A Liver carboxylesterase 1; enzyme, cholesteryl esterase, hydrolase; HET: NAG NDG SIA COA; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 2dqy_A* 2dr0_A* 2dqz_A* 1mx1_A* 1mx5_A* 1mx9_A* 4ab1_A* 1ya4_A* 1yah_A* 1yaj_A* 1ya8_A* 2hrr_A* 2hrq_A* 3k9b_A* 1k4y_A* Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>2ogt_A Thermostable carboxylesterase EST50; alpha/beta hydrolase, hydrolase; 1.58A {Geobacillus stearothermophilus} PDB: 2ogs_A Back     alignment and structure
>2ha2_A ACHE, acetylcholinesterase; hydrolase fold, serine esterase, homod glycosylated protein, hydrolase; HET: NAG FUC SCK SCU P6G; 2.05A {Mus musculus} SCOP: c.69.1.1 PDB: 1j07_A* 1mah_A* 1j06_A* 1n5r_A* 2gyv_A* 2gyw_A* 2h9y_A* 2ha0_A* 2gyu_A* 2ha3_A* 2wls_A* 4a23_A* 2c0q_A* 2jey_A* 2jgm_A* 2whr_A* 2c0p_A* 1ku6_A* 1q84_A* 1q83_A* ... Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>1ei9_A Palmitoyl protein thioesterase 1; alpha/beta hydrolase, glycoprotein, hydrolase; HET: NDG NAG; 2.25A {Bos taurus} SCOP: c.69.1.13 PDB: 1eh5_A* 1exw_A* 3gro_A Back     alignment and structure
>2k2q_B Surfactin synthetase thioesterase subunit; A/B-hydrolase, NRPS, non-ribosomal peptide synthetase, type II thioesterase, antibiotic biosynthesis; NMR {Bacillus subtilis} PDB: 2ron_A Back     alignment and structure
>1p0i_A Cholinesterase; serine hydrolase, butyrate, hydrolase; HET: NAG FUC MES; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 1p0m_A* 1p0p_A* 1p0q_A* 1xlu_A* 1xlv_A* 1xlw_A* 2wsl_A* 2pm8_A* 3djy_A* 3dkk_A* 2wij_A* 2wif_A* 2wik_A* 2y1k_A* 2j4c_A* 2xmb_A* 2xmc_A* 2xmd_A* 2xmg_A* 2wig_A* ... Back     alignment and structure
>2fj0_A JuvenIle hormone esterase; manduca sexta, alpha-beta hydrolase; HET: TFC; 2.70A {Trichoplusia NI} Back     alignment and structure
>1gpl_A RP2 lipase; serine esterase, hydrolase, lipid degradation, pancreas, glycoprotein, chimeric; 2.01A {Cavia porcellus} SCOP: b.12.1.2 c.69.1.19 PDB: 1lpb_B* 1lpa_B* 1n8s_A Back     alignment and structure
>1ea5_A ACHE, acetylcholinesterase; hydrolase, serine hydrolase, neurotransmitter cleavage, catalytic triad, alpha/beta hydrolase; HET: NAG; 1.80A {Torpedo californica} SCOP: c.69.1.1 PDB: 1ax9_A* 1amn_A* 1cfj_A* 1fss_A* 1gpk_A* 1gpn_A* 1oce_A* 1qid_A 1qie_A 1qif_A 1qig_A 1qih_A 1qii_A 1qij_A 1qik_A 1qim_A 1qti_A* 1vot_A* 1vxo_A* 1vxr_A* ... Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>1llf_A Lipase 3; candida cylindracea cholesterol esterase, sterol ester acylh hydrolase; HET: NAG F23; 1.40A {Candida cylindracea} SCOP: c.69.1.17 PDB: 1cle_A* 1lpm_A* 1lpn_A* 1lpo_A* 1lpp_A* 1lps_A* 1crl_A* 1trh_A* 3rar_A* 1gz7_A* Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>1thg_A Lipase; hydrolase(carboxylic esterase); HET: NAG NDG; 1.80A {Galactomyces geotrichum} SCOP: c.69.1.17 Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>2bce_A Cholesterol esterase; hydrolase, serine esterase, lipase; 1.60A {Bos taurus} SCOP: c.69.1.1 PDB: 1akn_A* 1aql_A* 1f6w_A 1jmy_A Back     alignment and structure
>1dx4_A ACHE, acetylcholinesterase; hydrolase, serine esterase, synapse, membrane, nerve, muscle neurotransmitter degradation, glycoprotein; HET: NAG MAN BMA 760; 2.70A {Drosophila melanogaster} SCOP: c.69.1.1 PDB: 1qo9_A* 1qon_A* Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>2hfk_A Pikromycin, type I polyketide synthase pikaiv; alpha/beta hydrolase, thioesterase; HET: E4H; 1.79A {Streptomyces venezuelae} PDB: 2h7x_A* 2h7y_A* 2hfj_A* 1mna_A 1mn6_A 1mnq_A Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3bix_A Neuroligin-1, neuroligin I; esterase domain, alpha-beta hydrolase, cell adhesion, cell J glycoprotein, membrane, postsynaptic cell membrane; HET: NAG; 1.80A {Rattus norvegicus} PDB: 3biw_A* 3b3q_A* 3be8_A* 2wqz_A* 2xb6_A* 2vh8_A 3bl8_A* Back     alignment and structure
>2cb9_A Fengycin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha/beta- hydrolases, catalytic triade, hydrolase; 1.8A {Bacillus subtilis} PDB: 2cbg_A* Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>3tej_A Enterobactin synthase component F; nonribosomal peptide, thioesterase, carrier domain, ATP- BIN enterobactin biosynthesis, ION transport, iron; HET: UF0; 1.90A {Escherichia coli} PDB: 2roq_A Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>3n2z_B Lysosomal Pro-X carboxypeptidase; alpha/beta hydrolase, PRCP, serine carboxypeptidase, hydrola; HET: NAG; 2.79A {Homo sapiens} Back     alignment and structure
>1ys1_X Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor hexylphosphonic acid (R) 2-methyl-3-phenylpropyl ester, hydrolase; HET: 2HR; 1.10A {Burkholderia cepacia} PDB: 1ys2_X* 4lip_D 1hqd_A 2lip_A 1oil_A* 3lip_A 2nw6_A 5lip_A* 1cvl_A 2es4_A 1tah_B 1qge_D 1qge_E Back     alignment and structure
>1jmk_C SRFTE, surfactin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha-beta hydrolase, cyclic peptide; 1.71A {Bacillus subtilis} SCOP: c.69.1.22 Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3icv_A Lipase B, CALB; circular permutation, cleavage on PAIR of basic residues, glycoprotein, hydrolase, lipid degradation, zymogen, disulf; HET: NAG BTB; 1.49A {Candida antarctica} PDB: 3icw_A* Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>1bu8_A Protein (pancreatic lipase related protein 2); hydrolase, lipid degradation; HET: NAG; 1.80A {Rattus norvegicus} SCOP: b.12.1.2 c.69.1.19 PDB: 2oxe_A* 2pvs_A 1eth_A* Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>1w52_X Pancreatic lipase related protein 2; detergent, cleaved flap; HET: DDQ; 2.99A {Equus caballus} Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>1ex9_A Lactonizing lipase; alpha-beta hydrolase fold, phosphonate inhibitor; HET: OCP; 2.54A {Pseudomonas aeruginosa} SCOP: c.69.1.18 Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>1hpl_A Lipase; hydrolase(carboxylic esterase); 2.30A {Equus caballus} SCOP: b.12.1.2 c.69.1.19 Back     alignment and structure
>2x5x_A PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE, hydrolase, biodegradation, catal; HET: PG4; 1.20A {Paucimonas lemoignei} PDB: 2vtv_A* 2x76_A Back     alignment and structure
>2zyr_A Lipase, putative; fatty acid, hydrolase; HET: 1PE; 1.77A {Archaeoglobus fulgidus} PDB: 2zys_A* 2zyi_A* 2zyh_A* Back     alignment and structure
>1rp1_A Pancreatic lipase related protein 1; hydrolase, lipid degradation; HET: NAG; 2.10A {Canis lupus familiaris} SCOP: b.12.1.2 c.69.1.19 PDB: 2ppl_A Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>2dst_A Hypothetical protein TTHA1544; conserved hypothetical protein, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} SCOP: c.69.1.39 Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>3tjm_A Fatty acid synthase; thioesterase domain, fatty acid synthesis, hydrolase-hydrola inhibitor complex; HET: 7FA; 1.48A {Homo sapiens} PDB: 1xkt_A Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2hih_A Lipase 46 kDa form; A1 phospholipase, phospholipid binding, hydrolase; 2.86A {Staphylococcus hyicus} Back     alignment and structure
>2dsn_A Thermostable lipase; T1 lipase, hydrolase; 1.50A {Geobacillus zalihae} PDB: 3umj_A 2z5g_A 1ji3_A 3auk_A 2w22_A* 1ku0_A Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>1whs_A Serine carboxypeptidase II; HET: NAG FUC; 2.00A {Triticum aestivum} SCOP: c.69.1.5 PDB: 1bcs_A* 1bcr_A* 1wht_A* 3sc2_A* Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 958
d1xfda2258 c.69.1.24 (A:592-849) Dipeptidyl aminopeptidase-li 9e-20
d2bgra2258 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26 8e-18
d2gzsa1265 c.69.1.38 (A:41-305) Enterobactin and salmochelin 9e-18
d1vlqa_322 c.69.1.25 (A:) Acetyl xylan esterase TM0077 {Therm 4e-17
d1qfma2280 c.69.1.4 (A:431-710) Prolyl oligopeptidase, C-term 6e-14
d1wb4a1273 c.69.1.2 (A:803-1075) Feruloyl esterase domain of 4e-13
d1l7aa_318 c.69.1.25 (A:) Cephalosporin C deacetylase {Bacill 2e-12
d2hu7a2260 c.69.1.33 (A:322-581) Acylamino-acid-releasing enz 6e-12
d2d81a1318 c.69.1.37 (A:21-338) Polyhydroxybutyrate depolymer 7e-12
d1jjfa_255 c.69.1.2 (A:) Feruloyl esterase domain of the cell 8e-11
d3c8da2246 c.69.1.2 (A:151-396) Enterochelin esterase, cataly 1e-10
d1mpxa2381 c.69.1.21 (A:24-404) Alpha-amino acid ester hydrol 2e-10
d2b9va2385 c.69.1.21 (A:50-434) Alpha-amino acid ester hydrol 2e-10
d1pv1a_299 c.69.1.34 (A:) Hypothetical esterase YJL068C {Bake 5e-10
d1lnsa3405 c.69.1.21 (A:146-550) X-Prolyl dipeptidyl aminopep 1e-09
d2jbwa1360 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine h 1e-07
d1sfra_288 c.69.1.3 (A:) Antigen 85a {Mycobacterium tuberculo 2e-06
d1r88a_267 c.69.1.3 (A:) Antigen pt51/mpb51 {Mycobacterium tu 7e-05
d1ju3a2347 c.69.1.21 (A:5-351) Bacterial cocaine esterase N-t 2e-04
d1jjia_311 c.69.1.2 (A:) Carboxylesterase {Archaeon Archaeogl 3e-04
d1dina_233 c.69.1.9 (A:) Dienelactone hydrolase {Pseudomonas 8e-04
d1dqza_280 c.69.1.3 (A:) Antigen 85c {Mycobacterium tuberculo 0.001
d1thta_302 c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase 0.002
d1k32a2281 b.68.7.1 (A:39-319) Tricorn protease N-terminal do 0.002
d1vkha_263 c.69.1.32 (A:) Putative serine hydrolase Ydr428c { 0.003
>d1xfda2 c.69.1.24 (A:592-849) Dipeptidyl aminopeptidase-like protein 6, DPP6, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 258 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: DPP6 catalytic domain-like
domain: Dipeptidyl aminopeptidase-like protein 6, DPP6, C-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 87.9 bits (216), Expect = 9e-20
 Identities = 38/257 (14%), Positives = 72/257 (28%), Gaps = 19/257 (7%)

Query: 648 DGVQLSATLYLPPGYDPSKDGPLPCLFWSYPGEFKSKDAAGQVRGSPNEFPRIGSTSVLL 707
           D   L   +  P  +  +     P L                 +    +F    S   ++
Sbjct: 11  DDYNLPMQILKPATFTDTT--HYPLLLVVDGT--------PGSQSVAEKFE--VSWETVM 58

Query: 708 WLARGFAILGGPTTPIIGEGDE---EANDRFVEQLVACAEAAVEEVVRRGVAHPSKIAVG 764
             + G  ++         +G +   E   R           AV  +++      +++AV 
Sbjct: 59  VSSHGAVVVKCDGRGSGFQGTKLLHEVRRRLGLLEEKDQMEAVRTMLKEQYIDRTRVAVF 118

Query: 765 GHSYGAFMTANLLAHAP----HLFCCGIARSGAYNRTLTPFGFQNEDRTLWEATSTYVEM 820
           G  YG +++  +L          F CG A S   +  L    F      L    +   EM
Sbjct: 119 GKDYGGYLSTYILPAKGENQGQTFTCGSALSPITDFKLYASAFSERYLGLHGLDNRAYEM 178

Query: 821 SPFMSANKLKKPILLVHGEEDNNSGTLTMQSDRFFNALKGHGALCRLVILPFESHGYAAR 880
           +         +    +      +       +      L    A   L I P ESH + + 
Sbjct: 179 TKVAHRVSALEEQQFLIIHPTADEKIHFQHTAELITQLIRGKANYSLQIYPDESHYFTSS 238

Query: 881 ESIMHVLWETDRWLQKY 897
               H+      +  + 
Sbjct: 239 SLKQHLYRSIINFFVEC 255
>d2bgra2 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Length = 258 Back     information, alignment and structure
>d2gzsa1 c.69.1.38 (A:41-305) Enterobactin and salmochelin hydrolase IroE {Escherichia coli [TaxId: 562]} Length = 265 Back     information, alignment and structure
>d1vlqa_ c.69.1.25 (A:) Acetyl xylan esterase TM0077 {Thermotoga maritima [TaxId: 2336]} Length = 322 Back     information, alignment and structure
>d1qfma2 c.69.1.4 (A:431-710) Prolyl oligopeptidase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Length = 280 Back     information, alignment and structure
>d1wb4a1 c.69.1.2 (A:803-1075) Feruloyl esterase domain of the cellulosomal xylanase y {Clostridium thermocellum [TaxId: 1515]} Length = 273 Back     information, alignment and structure
>d1l7aa_ c.69.1.25 (A:) Cephalosporin C deacetylase {Bacillus subtilis [TaxId: 1423]} Length = 318 Back     information, alignment and structure
>d2hu7a2 c.69.1.33 (A:322-581) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix [TaxId: 56636]} Length = 260 Back     information, alignment and structure
>d2d81a1 c.69.1.37 (A:21-338) Polyhydroxybutyrate depolymerase {Penicillium funiculosum [TaxId: 28572]} Length = 318 Back     information, alignment and structure
>d1jjfa_ c.69.1.2 (A:) Feruloyl esterase domain of the cellulosomal xylanase z {Clostridium thermocellum [TaxId: 1515]} Length = 255 Back     information, alignment and structure
>d3c8da2 c.69.1.2 (A:151-396) Enterochelin esterase, catalytic domain {Shigella flexneri 2a str. 2457T [TaxId: 198215]} Length = 246 Back     information, alignment and structure
>d1mpxa2 c.69.1.21 (A:24-404) Alpha-amino acid ester hydrolase {Xanthomonas citri [TaxId: 346]} Length = 381 Back     information, alignment and structure
>d2b9va2 c.69.1.21 (A:50-434) Alpha-amino acid ester hydrolase {Acetobacter pasteurianus [TaxId: 438]} Length = 385 Back     information, alignment and structure
>d1pv1a_ c.69.1.34 (A:) Hypothetical esterase YJL068C {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 299 Back     information, alignment and structure
>d1lnsa3 c.69.1.21 (A:146-550) X-Prolyl dipeptidyl aminopeptidase PepX, middle domain {Lactococcus lactis [TaxId: 1358]} Length = 405 Back     information, alignment and structure
>d2jbwa1 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine hydrolase {Arthrobacter nicotinovorans [TaxId: 29320]} Length = 360 Back     information, alignment and structure
>d1sfra_ c.69.1.3 (A:) Antigen 85a {Mycobacterium tuberculosis [TaxId: 1773]} Length = 288 Back     information, alignment and structure
>d1r88a_ c.69.1.3 (A:) Antigen pt51/mpb51 {Mycobacterium tuberculosis [TaxId: 1773]} Length = 267 Back     information, alignment and structure
>d1ju3a2 c.69.1.21 (A:5-351) Bacterial cocaine esterase N-terminal domain {Rhodococcus sp. mb1 [TaxId: 51612]} Length = 347 Back     information, alignment and structure
>d1jjia_ c.69.1.2 (A:) Carboxylesterase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 311 Back     information, alignment and structure
>d1dina_ c.69.1.9 (A:) Dienelactone hydrolase {Pseudomonas sp., B13 [TaxId: 306]} Length = 233 Back     information, alignment and structure
>d1dqza_ c.69.1.3 (A:) Antigen 85c {Mycobacterium tuberculosis [TaxId: 1773]} Length = 280 Back     information, alignment and structure
>d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]} Length = 302 Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 281 Back     information, alignment and structure
>d1vkha_ c.69.1.32 (A:) Putative serine hydrolase Ydr428c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 263 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query958
d2hu7a2260 Acylamino-acid-releasing enzyme, C-terminal donain 99.96
d2bgra2258 Dipeptidyl peptidase IV/CD26, C-terminal domain {P 99.96
d1xfda2258 Dipeptidyl aminopeptidase-like protein 6, DPP6, C- 99.96
d1qfma2280 Prolyl oligopeptidase, C-terminal domain {Pig (Sus 99.91
d2jbwa1360 2,6-dihydropseudooxynicotine hydrolase {Arthrobact 99.9
d1vlqa_322 Acetyl xylan esterase TM0077 {Thermotoga maritima 99.89
d1l7aa_318 Cephalosporin C deacetylase {Bacillus subtilis [Ta 99.89
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.89
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 99.87
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 99.86
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 99.86
d2fuka1218 XC6422 protein {Xanthomonas campestris [TaxId: 339 99.86
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.85
d1dina_233 Dienelactone hydrolase {Pseudomonas sp., B13 [TaxI 99.84
d1ju3a2347 Bacterial cocaine esterase N-terminal domain {Rhod 99.84
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.84
d1jfra_260 Lipase {Streptomyces exfoliatus [TaxId: 1905]} 99.83
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 99.83
d1thta_302 Myristoyl-ACP-specific thioesterase {Vibrio harvey 99.82
d1jkma_358 Carboxylesterase {Bacillus subtilis, brefeldin A e 99.82
d1lzla_317 Heroin esterase {Rhodococcus sp. [TaxId: 1831]} 99.81
d1mpxa2381 Alpha-amino acid ester hydrolase {Xanthomonas citr 99.81
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 99.81
d2i3da1218 Hypothetical protein Atu1826 {Agrobacterium tumefa 99.8
d1lnsa3405 X-Prolyl dipeptidyl aminopeptidase PepX, middle do 99.8
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 99.79
d2pbla1261 Uncharacterized protein TM1040_2492 {Silicibacter 99.79
d1jjia_311 Carboxylesterase {Archaeon Archaeoglobus fulgidus 99.79
d1ufoa_238 Hypothetical protein TT1662 {Thermus thermophilus 99.79
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.77
d2h1ia1202 Carboxylesterase {Bacillus cereus [TaxId: 1396]} 99.77
d1jjfa_255 Feruloyl esterase domain of the cellulosomal xylan 99.76
d1u4na_308 Carboxylesterase {Alicyclobacillus acidocaldarius 99.76
d1k8qa_377 Gastric lipase {Dog (Canis familiaris) [TaxId: 961 99.74
d2b9va2385 Alpha-amino acid ester hydrolase {Acetobacter past 99.74
d3c8da2246 Enterochelin esterase, catalytic domain {Shigella 99.71
d1imja_208 Ccg1/TafII250-interacting factor B (Cib) {Human (H 99.71
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 99.71
d1vkha_263 Putative serine hydrolase Ydr428c {Baker's yeast ( 99.7
d2gzsa1265 Enterobactin and salmochelin hydrolase IroE {Esche 99.7
d1fj2a_229 Acyl protein thioesterase 1 {Human (Homo sapiens) 99.69
d3b5ea1209 Uncharacterized protein Mll8374 {Mesorhizobium lot 99.68
d1sfra_288 Antigen 85a {Mycobacterium tuberculosis [TaxId: 17 99.67
d1mtza_290 Tricorn interacting factor F1 {Archaeon Thermoplas 99.67
d1q0ra_297 Aclacinomycin methylesterase RdmC {Streptomyces pu 99.67
d1a8qa_274 Bromoperoxidase A1 {Streptomyces aureofaciens [Tax 99.66
d1a88a_275 Chloroperoxidase L {Streptomyces lividans [TaxId: 99.66
d2r8ba1203 Uncharacterized protein Atu2452 {Agrobacterium tum 99.63
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 99.63
d1zd3a2322 Mammalian epoxide hydrolase, C-terminal domain {Hu 99.63
d2rhwa1283 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 99.63
d1tqha_242 Carboxylesterase Est {Bacillus stearothermophilus 99.62
d1c4xa_281 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 99.62
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 99.61
d1j1ia_268 Meta cleavage compound hydrolase CarC {Janthinobac 99.6
d1va4a_271 Arylesterase {Pseudomonas fluorescens [TaxId: 294] 99.6
d1a8sa_273 Chloroperoxidase F {Pseudomonas fluorescens [TaxId 99.6
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 99.6
d1xkla_258 Salicylic acid-binding protein 2 (SABP2) {Common t 99.6
d1uxoa_186 Hypothetical protein YdeN {Bacillus subtilis [TaxI 99.59
d1azwa_313 Proline iminopeptidase {Xanthomonas campestris, pv 99.59
d1b6ga_310 Haloalkane dehalogenase {Xanthobacter autotrophicu 99.59
d1brta_277 Bromoperoxidase A2 {Streptomyces aureofaciens [Tax 99.58
d1uk8a_271 Meta-cleavage product hydrolase CumD {Pseudomonas 99.58
d1auoa_218 Carboxylesterase {Pseudomonas fluorescens [TaxId: 99.56
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.56
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 99.55
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.55
d3c70a1256 Hydroxynitrile lyase {Rubber tree (Hevea brasilien 99.55
d1pv1a_299 Hypothetical esterase YJL068C {Baker's yeast (Sacc 99.55
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.53
d1wb4a1273 Feruloyl esterase domain of the cellulosomal xylan 99.53
d1bn7a_291 Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1 99.51
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 99.51
d1hkha_279 Gamma-lactamase {Aureobacterium sp. [TaxId: 51671] 99.51
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 99.51
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.51
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 99.51
d1wm1a_313 Proline aminopeptidase {Serratia marcescens [TaxId 99.5
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.49
d1r88a_267 Antigen pt51/mpb51 {Mycobacterium tuberculosis [Ta 99.49
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.49
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 99.49
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.49
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.48
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.47
d1ehya_293 Bacterial epoxide hydrolase {Agrobacterium radioba 99.47
d1m33a_256 Biotin biosynthesis protein BioH {Escherichia coli 99.46
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.46
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.45
d2d81a1318 Polyhydroxybutyrate depolymerase {Penicillium funi 99.45
d1dqza_280 Antigen 85c {Mycobacterium tuberculosis [TaxId: 17 99.41
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 99.39
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 99.38
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 99.37
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.35
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.35
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.35
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.34
d1qlwa_318 A novel bacterial esterase {Alcaligenes sp. [TaxId 99.34
d1tbga_340 beta1-subunit of the signal-transducing G protein 99.34
d1r3da_264 Hypothetical protein VC1974 {Vibrio cholerae [TaxI 99.33
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.3
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.29
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.27
d1mj5a_298 Haloalkane dehalogenase {Sphingomonas paucimobilis 99.26
d1tbga_340 beta1-subunit of the signal-transducing G protein 99.21
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.19
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.1
d1qo7a_394 Bacterial epoxide hydrolase {Aspergillus niger [Ta 99.1
d1pjaa_268 Palmitoyl protein thioesterase 2 {Human (Homo sapi 99.04
d1ispa_179 Lipase A {Bacillus subtilis [TaxId: 1423]} 99.02
d1qfma1430 Prolyl oligopeptidase, N-terminal domain {Pig (Sus 98.94
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 98.91
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 98.89
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 98.88
d1jmkc_230 Surfactin synthetase, SrfA {Bacillus subtilis [Tax 98.88
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 98.82
d2h7xa1283 Picromycin polyketide synthase {Streptomyces venez 98.8
d2b61a1357 Homoserine O-acetyltransferase {Haemophilus influe 98.8
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 98.79
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 98.76
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 98.75
d2pl5a1362 Homoserine O-acetyltransferase {Leptospira interro 98.7
d1qfma1430 Prolyl oligopeptidase, N-terminal domain {Pig (Sus 98.68
d1tcaa_317 Triacylglycerol lipase {Yeast (Candida antarctica) 98.65
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 98.6
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 98.59
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 98.56
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 98.55
d1cvla_319 Lipase {Chromobacterium viscosum [TaxId: 42739]} 98.55
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 98.55
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 98.51
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 98.5
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 98.49
d2h7ca1 532 Mammalian carboxylesterase (liver carboxylesterase 98.48
d1llfa_ 534 Type-B carboxylesterase/lipase {Candida cylindrace 98.48
d2vata1376 Acetyl-CoA:deacetylcephalosporin C acetyltransfera 98.48
d1thga_ 544 Type-B carboxylesterase/lipase {Fungus (Geotrichum 98.45
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 98.42
d1qe3a_ 483 Thermophilic para-nitrobenzyl esterase (PNB estera 98.4
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 98.39
d2ha2a1 542 Acetylcholinesterase {Mouse (Mus musculus) [TaxId: 98.39
d1ukca_ 517 Esterase EstA {Aspergillus niger [TaxId: 5061]} 98.37
d1ex9a_285 Lipase {Pseudomonas aeruginosa [TaxId: 287]} 98.37
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 98.36
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 98.35
d1ea5a_ 532 Acetylcholinesterase {Pacific electric ray (Torped 98.34
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 98.34
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 98.33
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 98.3
d2bcea_ 579 Bile-salt activated lipase (cholesterol esterase) 98.29
d1p0ia_ 526 Butyryl cholinesterase {Human (Homo sapiens) [TaxI 98.26
d1mo2a_255 Erythromycin polyketide synthase {Saccharopolyspor 98.23
d2hu7a1313 Acylamino-acid-releasing enzyme, N-terminal donain 98.23
d1dx4a_ 571 Acetylcholinesterase {Fruit fly (Drosophila melano 98.22
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 98.15
d1xkta_286 Fatty acid synthase {Human (Homo sapiens) [TaxId: 98.14
d2dsta1122 Hypothetical protein TTHA1544 {Thermus thermophilu 98.13
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 98.03
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 98.01
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 97.96
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 97.73
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 97.71
d1ei9a_279 Palmitoyl protein thioesterase 1 {Cow (Bos taurus) 97.58
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 97.5
d1rp1a2337 Pancreatic lipase, N-terminal domain {Dog (Canis f 97.41
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 97.38
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 97.23
d1bu8a2338 Pancreatic lipase, N-terminal domain {Rat (Rattus 97.21
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 97.2
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 97.09
g1wht.1409 Serine carboxypeptidase II {Wheat (Triticum vulgar 96.9
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 96.57
d1ivya_ 452 Human 'protective protein', HPP {Human (Homo sapie 95.46
d2hu7a1313 Acylamino-acid-releasing enzyme, N-terminal donain 95.23
g1gxs.1425 Hydroxynitrile lyase {Sorghum (Sorghum bicolor) [T 95.18
d1crua_450 Soluble quinoprotein glucose dehydrogenase {Acinet 94.71
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 94.67
d1ku0a_388 Lipase L1 {Bacillus stearothermophilus [TaxId: 142 94.62
d1utca2327 Clathrin heavy-chain terminal domain {Rat (Rattus 92.18
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 91.39
d1wpxa1421 Serine carboxypeptidase II {Baker's yeast (Sacchar 90.52
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 90.41
d1lgya_265 Triacylglycerol lipase {Rhizopus niveus [TaxId: 48 89.25
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 89.17
d1uwca_261 Feruloyl esterase A {Aspergillus niger [TaxId: 506 88.06
d1tiaa_271 Triacylglycerol lipase {Penicillium camembertii [T 87.48
d3tgla_265 Triacylglycerol lipase {Rhizomucor miehei [TaxId: 87.44
d1tiba_269 Triacylglycerol lipase {Thermomyces lanuginosus, f 87.4
d1ac5a_ 483 Serine carboxypeptidase II {Baker's yeast (Sacchar 86.97
d1cexa_197 Cutinase {Fungus (Fusarium solani), subsp. pisi [T 84.19
d1crua_450 Soluble quinoprotein glucose dehydrogenase {Acinet 82.02
>d2hu7a2 c.69.1.33 (A:322-581) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Acylamino-acid-releasing enzyme, C-terminal donain
domain: Acylamino-acid-releasing enzyme, C-terminal donain
species: Aeropyrum pernix [TaxId: 56636]

Probab=99.96  E-value=3.7e-29  Score=262.03  Aligned_cols=242  Identities=19%  Similarity=0.230  Sum_probs=196.9

Q ss_pred             CcEEEEEEEeCCCeEEEEEEEecCCCCCCCCCCceEEEEECCCCCcCcccCCcccCCCCCCCCcCcHHHHHHHHCCcEEE
Q 002164          637 LQKELIKYQRKDGVQLSATLYLPPGYDPSKDGPLPCLFWSYPGEFKSKDAAGQVRGSPNEFPRIGSTSVLLWLARGFAIL  716 (958)
Q Consensus       637 ~~~~~~~~~~~dg~~l~~~l~~P~~~~~~~~~~~P~vv~~hGg~~~~~~~~~~~~~~~~~~~~~~~~~~~~la~~G~~vl  716 (958)
                      ...+.++|++.||.+|++++|.|++.    +++.|+||++|||++....         ..|    ...++.|+++||+|+
T Consensus        10 ~~~~~v~~~s~dG~~i~~~l~~p~~~----~~~~Pviv~~HGG~~~~~~---------~~~----~~~~~~la~~G~~v~   72 (260)
T d2hu7a2          10 AGSRLVWVESFDGSRVPTYVLESGRA----PTPGPTVVLVHGGPFAEDS---------DSW----DTFAASLAAAGFHVV   72 (260)
T ss_dssp             EEEEEEEEECTTSCEEEEEEEEETTS----CSSEEEEEEECSSSSCCCC---------SSC----CHHHHHHHHHTCEEE
T ss_pred             CceEEEEEECCCCCEEEEEEEeCCCC----CCCceEEEEECCCCccCCC---------ccc----cHHHHHHHhhccccc
Confidence            45788999999999999999999762    3458999999997643211         112    245678999999999


Q ss_pred             EcCCCCCCCCCCcccc---hhhHHHHHHHHHHHHHHHHHcCCCCCCcEEEEEeChHHHHHHHHHHhCCCceeEEEEeccC
Q 002164          717 GGPTTPIIGEGDEEAN---DRFVEQLVACAEAAVEEVVRRGVAHPSKIAVGGHSYGAFMTANLLAHAPHLFCCGIARSGA  793 (958)
Q Consensus       717 ~~~~~~~~G~G~~~~~---~~~~~~~~~D~~~av~~l~~~~~~d~~~i~l~G~S~GG~~a~~~a~~~p~~~~a~v~~~~~  793 (958)
                      .+++++..|+|.....   ..+....+.|+.++++|+.++.  ++++++|+|+|+||.+++.++..+|+.++++++.+|+
T Consensus        73 ~~d~r~~~~~g~~~~~~~~~~~~~~~~~D~~~~~~~l~~~~--~~~~~~i~g~s~gg~~~~~~~~~~~~~~~a~i~~~~~  150 (260)
T d2hu7a2          73 MPNYRGSTGYGEEWRLKIIGDPCGGELEDVSAAARWARESG--LASELYIMGYSYGGYMTLCALTMKPGLFKAGVAGASV  150 (260)
T ss_dssp             EECCTTCSSSCHHHHHTTTTCTTTHHHHHHHHHHHHHHHTT--CEEEEEEEEETHHHHHHHHHHHHSTTSSSEEEEESCC
T ss_pred             cceeeeccccccccccccccccchhhhhhhccccccccccc--ccceeeccccccccccccchhccCCcccccccccccc
Confidence            9888877777765432   2334567889999999999975  5689999999999999999999999999999999998


Q ss_pred             CCCCCC----CCCc-ccccchhhhcHHHHHhcCcccccCCCCCCEEEEeeCCCCCCCCChHHHHHHHHHHHhCCCcEEEE
Q 002164          794 YNRTLT----PFGF-QNEDRTLWEATSTYVEMSPFMSANKLKKPILLVHGEEDNNSGTLTMQSDRFFNALKGHGALCRLV  868 (958)
Q Consensus       794 ~~~~~~----~~~~-~~~~~~~~~~~~~~~~~sp~~~~~~~~~P~Lii~G~~D~~v~~~~~~~~~~~~~l~~~g~~~~~~  868 (958)
                      .+....    ...+ .......+.+.+.+...+|+..++++++|+||+||++|.+||  +.++.+++++|+..|++++++
T Consensus       151 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~P~liihG~~D~~vp--~~~~~~~~~~l~~~~~~~~~~  228 (260)
T d2hu7a2         151 VDWEEMYELSDAAFRNFIEQLTGGSREIMRSRSPINHVDRIKEPLALIHPQNDSRTP--LKPLLRLMGELLARGKTFEAH  228 (260)
T ss_dssp             CCHHHHHHTCCHHHHHHHHHHHCSCHHHHHHTCGGGCGGGCCSCEEEEEETTCSSSC--SHHHHHHHHHHHHTTCCEEEE
T ss_pred             hhhhhhhcccccccccccccccccccccccccchhhcccccCCCceeeecccCceec--HHHHHHHHHHHHHCCCCeEEE
Confidence            763210    0000 001122345667788899999999999999999999999999  999999999999999999999


Q ss_pred             EeCCCCccCCCcccHHHHHHHHHHHHHHhhc
Q 002164          869 ILPFESHGYAARESIMHVLWETDRWLQKYCV  899 (958)
Q Consensus       869 ~~p~~~H~~~~~~~~~~~~~~i~~fl~~~l~  899 (958)
                      +||+++|++...++..++++.+++||.+||+
T Consensus       229 ~~~g~~H~~~~~e~~~~~~~~~~~fl~~hl~  259 (260)
T d2hu7a2         229 IIPDAGHAINTMEDAVKILLPAVFFLATQRE  259 (260)
T ss_dssp             EETTCCSSCCBHHHHHHHHHHHHHHHHHHHH
T ss_pred             EECcCCCCCCChHhHHHHHHHHHHHHHHHhc
Confidence            9999999998888888999999999999985
>d2bgra2 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1xfda2 c.69.1.24 (A:592-849) Dipeptidyl aminopeptidase-like protein 6, DPP6, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qfma2 c.69.1.4 (A:431-710) Prolyl oligopeptidase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2jbwa1 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine hydrolase {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1vlqa_ c.69.1.25 (A:) Acetyl xylan esterase TM0077 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1l7aa_ c.69.1.25 (A:) Cephalosporin C deacetylase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fuka1 c.69.1.36 (A:3-220) XC6422 protein {Xanthomonas campestris [TaxId: 339]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1dina_ c.69.1.9 (A:) Dienelactone hydrolase {Pseudomonas sp., B13 [TaxId: 306]} Back     information, alignment and structure
>d1ju3a2 c.69.1.21 (A:5-351) Bacterial cocaine esterase N-terminal domain {Rhodococcus sp. mb1 [TaxId: 51612]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1jfra_ c.69.1.16 (A:) Lipase {Streptomyces exfoliatus [TaxId: 1905]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]} Back     information, alignment and structure
>d1jkma_ c.69.1.2 (A:) Carboxylesterase {Bacillus subtilis, brefeldin A esterase [TaxId: 1423]} Back     information, alignment and structure
>d1lzla_ c.69.1.2 (A:) Heroin esterase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d1mpxa2 c.69.1.21 (A:24-404) Alpha-amino acid ester hydrolase {Xanthomonas citri [TaxId: 346]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2i3da1 c.69.1.36 (A:2-219) Hypothetical protein Atu1826 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1lnsa3 c.69.1.21 (A:146-550) X-Prolyl dipeptidyl aminopeptidase PepX, middle domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2pbla1 c.69.1.2 (A:1-261) Uncharacterized protein TM1040_2492 {Silicibacter sp. tm1040 [TaxId: 292414]} Back     information, alignment and structure
>d1jjia_ c.69.1.2 (A:) Carboxylesterase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1ufoa_ c.69.1.27 (A:) Hypothetical protein TT1662 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2h1ia1 c.69.1.14 (A:1-202) Carboxylesterase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1jjfa_ c.69.1.2 (A:) Feruloyl esterase domain of the cellulosomal xylanase z {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1u4na_ c.69.1.2 (A:) Carboxylesterase {Alicyclobacillus acidocaldarius [TaxId: 405212]} Back     information, alignment and structure
>d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d2b9va2 c.69.1.21 (A:50-434) Alpha-amino acid ester hydrolase {Acetobacter pasteurianus [TaxId: 438]} Back     information, alignment and structure
>d3c8da2 c.69.1.2 (A:151-396) Enterochelin esterase, catalytic domain {Shigella flexneri 2a str. 2457T [TaxId: 198215]} Back     information, alignment and structure
>d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vkha_ c.69.1.32 (A:) Putative serine hydrolase Ydr428c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2gzsa1 c.69.1.38 (A:41-305) Enterobactin and salmochelin hydrolase IroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fj2a_ c.69.1.14 (A:) Acyl protein thioesterase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3b5ea1 c.69.1.14 (A:7-215) Uncharacterized protein Mll8374 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1sfra_ c.69.1.3 (A:) Antigen 85a {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1a88a_ c.69.1.12 (A:) Chloroperoxidase L {Streptomyces lividans [TaxId: 1916]} Back     information, alignment and structure
>d2r8ba1 c.69.1.14 (A:44-246) Uncharacterized protein Atu2452 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2rhwa1 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]} Back     information, alignment and structure
>d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1j1ia_ c.69.1.10 (A:) Meta cleavage compound hydrolase CarC {Janthinobacterium sp. J3 [TaxId: 213804]} Back     information, alignment and structure
>d1va4a_ c.69.1.12 (A:) Arylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1a8sa_ c.69.1.12 (A:) Chloroperoxidase F {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1xkla_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1uxoa_ c.69.1.31 (A:) Hypothetical protein YdeN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1azwa_ c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas campestris, pv. citri [TaxId: 339]} Back     information, alignment and structure
>d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]} Back     information, alignment and structure
>d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1auoa_ c.69.1.14 (A:) Carboxylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]} Back     information, alignment and structure
>d1pv1a_ c.69.1.34 (A:) Hypothetical esterase YJL068C {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1wb4a1 c.69.1.2 (A:803-1075) Feruloyl esterase domain of the cellulosomal xylanase y {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1bn7a_ c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1hkha_ c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wm1a_ c.69.1.7 (A:) Proline aminopeptidase {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1r88a_ c.69.1.3 (A:) Antigen pt51/mpb51 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1ehya_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]} Back     information, alignment and structure
>d1m33a_ c.69.1.26 (A:) Biotin biosynthesis protein BioH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2d81a1 c.69.1.37 (A:21-338) Polyhydroxybutyrate depolymerase {Penicillium funiculosum [TaxId: 28572]} Back     information, alignment and structure
>d1dqza_ c.69.1.3 (A:) Antigen 85c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1qlwa_ c.69.1.15 (A:) A novel bacterial esterase {Alcaligenes sp. [TaxId: 512]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1r3da_ c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1mj5a_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qo7a_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1pjaa_ c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ispa_ c.69.1.18 (A:) Lipase A {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jmkc_ c.69.1.22 (C:) Surfactin synthetase, SrfA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d2h7xa1 c.69.1.22 (A:9-291) Picromycin polyketide synthase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d2b61a1 c.69.1.40 (A:2-358) Homoserine O-acetyltransferase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2pl5a1 c.69.1.40 (A:5-366) Homoserine O-acetyltransferase {Leptospira interrogans [TaxId: 173]} Back     information, alignment and structure
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1tcaa_ c.69.1.17 (A:) Triacylglycerol lipase {Yeast (Candida antarctica), form b [TaxId: 34362]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1cvla_ c.69.1.18 (A:) Lipase {Chromobacterium viscosum [TaxId: 42739]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d2h7ca1 c.69.1.1 (A:1021-1553) Mammalian carboxylesterase (liver carboxylesterase I) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1llfa_ c.69.1.17 (A:) Type-B carboxylesterase/lipase {Candida cylindracea, cholesterol esterase [TaxId: 44322]} Back     information, alignment and structure
>d2vata1 c.69.1.40 (A:7-382) Acetyl-CoA:deacetylcephalosporin C acetyltransferase CefG {Acremonium chrysogenum [TaxId: 5044]} Back     information, alignment and structure
>d1thga_ c.69.1.17 (A:) Type-B carboxylesterase/lipase {Fungus (Geotrichum candidum), ATCC 34614 [TaxId: 27317]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1qe3a_ c.69.1.1 (A:) Thermophilic para-nitrobenzyl esterase (PNB esterase) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ha2a1 c.69.1.1 (A:1-542) Acetylcholinesterase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ukca_ c.69.1.17 (A:) Esterase EstA {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1ex9a_ c.69.1.18 (A:) Lipase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ea5a_ c.69.1.1 (A:) Acetylcholinesterase {Pacific electric ray (Torpedo californica) [TaxId: 7787]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2bcea_ c.69.1.1 (A:) Bile-salt activated lipase (cholesterol esterase) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p0ia_ c.69.1.1 (A:) Butyryl cholinesterase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mo2a_ c.69.1.22 (A:) Erythromycin polyketide synthase {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d2hu7a1 b.69.7.2 (A:9-321) Acylamino-acid-releasing enzyme, N-terminal donain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1dx4a_ c.69.1.1 (A:) Acetylcholinesterase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkta_ c.69.1.22 (A:) Fatty acid synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dsta1 c.69.1.39 (A:2-123) Hypothetical protein TTHA1544 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ei9a_ c.69.1.13 (A:) Palmitoyl protein thioesterase 1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rp1a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1bu8a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1ivya_ c.69.1.5 (A:) Human 'protective protein', HPP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hu7a1 b.69.7.2 (A:9-321) Acylamino-acid-releasing enzyme, N-terminal donain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1ku0a_ c.69.1.18 (A:) Lipase L1 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1wpxa1 c.69.1.5 (A:1-421) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1lgya_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizopus niveus [TaxId: 4844]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1uwca_ c.69.1.17 (A:) Feruloyl esterase A {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1tiaa_ c.69.1.17 (A:) Triacylglycerol lipase {Penicillium camembertii [TaxId: 5075]} Back     information, alignment and structure
>d3tgla_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizomucor miehei [TaxId: 4839]} Back     information, alignment and structure
>d1tiba_ c.69.1.17 (A:) Triacylglycerol lipase {Thermomyces lanuginosus, formerly Humicola lanuginosa [TaxId: 5541]} Back     information, alignment and structure
>d1ac5a_ c.69.1.5 (A:) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae), kex1(delta)p [TaxId: 4932]} Back     information, alignment and structure
>d1cexa_ c.69.1.30 (A:) Cutinase {Fungus (Fusarium solani), subsp. pisi [TaxId: 169388]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure