Citrus Sinensis ID: 002165

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------
MGPSSPTSSCSSSYSSPFTSPEFSSLPVMSLREKIVEKVLENRVTLIVGETGCGKSSQVPQFLLAENMEPILCTQPRRFAVVAVAKMVAKGRNCELGGEVGYHIGHSKHLSERSKIVFKTAGVLLDEMRDRGLNALKYKVIILDEVHERSVESDLVLVCVKQLLLKKNDLRVVLMSATADITKYRDYFRDLGRGERVEVLAIPSTNQRTIFQRRVSYLEQVTELLGVDHGMTSELSSLRYCSGPSPSMANAEIKPEVHKLIHDLVLHIHKNESDIEKSILVFLPTYYALEQQWHLMKPLSSFFKVHILHSSVDTEQALMAMKICKSHRKVILATNIAESSVTIPKVAYVIDSCRSLQVFWDVNRKIDSAELVWVSQSQAEQRRGRTGRTCDGQVYRLVTKSFFGTLEDHECPAILRLSLRLQVLLICCAESKAISDPKVLLQKALDPPYPEVVGDALDLLDHKRALQKISPRGRYEPTFYGRLLASFSLSFDASVLVLKFGEIGMLREGILLGILMDTQPLPILHPFGDDALFAEYTGCYFGGDGNTRLLTGRKEMVIMGNLCAFQFWQHVFKDKQRLDHLQQVLKFDETKVTASLLPKIEEEWCSLHYLVQSSLHHVSELYEDILNAVHRFRPKFLGTSNGLPTYYDPYEFEHTCLLNCDPPRDMDPLAADNEHLGPSFEAKKCVAVPFVAPNQFQSNNVAEKLASIIKEIRVQYVEDVSGNQDKAVNGSETPGEAPLCVYFINGSCNRGTGCPFSHSLQAKRPACKFFYSLQGCRNGDSCIFSHDLGQPVLPSSSFTCLPEDGVANAASLLRLFPTSSDGSILLLDDTDMHFSANLACLYDPSRIISTTCLSDSAICDTSLAGIRILWGLCHSLKTVISEAGDNPIPWKEVKCVLWYPSLESYSENLESQKTLMQNFFEHLAIRMLADALYDTRVIITMNNIKFAQLQVIFVAVK
cccccccccccccccccccccccccccHHHHHHHHHHHHHcccEEEEEccccccHHHHHHHHHHHccccccEEccccHHHHHHHHHHHHHHHcccccccEEEEEEccccccccccEEEEcHHHHHHHHHcccccccccEEEEEccccccccHHHHHHHHHHHHHHHccccEEEEEEccccHHHHHHHHccccccccccEEEcccccccccccccccHHHHHHHHHcccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHccccccccEEEEcccHHHHHHHHHHHcccccccEEEEccccccHHHHHHcccccccccEEEEEEcccccccccccEEEEEEcccccccccccccccccccEEcccHHHHHHccccccccccccEEEEccHHHHHHccccccccEEcccHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHccccccccccccccccHHHHHHHHccccHHHHHHHHHcccccccHHHHHHHHHHcccccccccccccHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHccccccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccEEcccccccccccHHHHHHHHHHHHHEEEEEcccccccccccccccccccccccEEEEEccccccccccccccccccccccEEEEEEccccccccccccccccccccccccccccccccccccccHHHcccccccccEEEEEcccccHHHHccccccccccEEEEccccccccccccccccHHHccccccHHHHHccccccccccccEEEEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEcccEEEEEEEEEEEEc
ccccccccccccccccccHHHHHccccHHHHHHHHHHHHHcccEEEEEEccccccccHHHHHHHHcccccEccccHHHHHHHHHHHHHHHHHccccccEEEEEEEEcccccccEEEEEcccHHHHHHHHcccccHHHccEEEEEcHHHHHHHHHHHHHHHHHHHHHccccEEEEEEccccHHHHHHHHcccccccEEEEEEEcccccccEccEEEEEccccHHHcccccccccccEEEEccccccHHHHHHHccHHHHHHHHHHHHHHHHccccccccEEEEEccHHHHHHHHHHHHHHccccEEEEEHccccHHHHHHcccccccccEEEEEEEEEEEEEEEccEEEEEccccEEEEEccccccccEEEEEEccHHHHHHHccccccccccEEEEEEcHHHHHHccccccHHHHHHHHHHHHHHHHHcccHHccccccccccccccccHHHHHHHHHHHHHHcccccccccccccccHHHHHHHcccccHHHHHHHHHHHHcccHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEcccccccccHHHHHHHHHHHHHHHHHHHccccEEEEcccEEEEcccccccHHEEHHHHHHHHHHHHHccccccHHHHHHHcccccHHHcccEEEEEEccccccHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccEEEEEEEccccccccccccccccccccEEEEEEEcccccccccccccccccccccccccccccccccccccHcHHHHcccccccEEEEEEccccEEEHHHHHcccccEEEEccccccccccccccHHHHHHccccccccEEEcccccccccHHHEEEEEEcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccEEEEEEcccEEEEEEEEEEEEc
mgpssptsscsssysspftspefsslpvmSLREKIVEKVLENRVTLIVgetgcgkssqvpqfllaenmepilctqpRRFAVVAVAKMVAKGrncelggevgyhighskhlseRSKIVFKTAGVLLDEMRDRGLNALKYKVIILDEVHERSVESDLVLVCVKQLLLKKNDLRVVLMSATADITKYRDYFRdlgrgervevlaipstnqrTIFQRRVSYLEQVTELlgvdhgmtselsslrycsgpspsmanaeikPEVHKLIHDLVLHIHKNESDIEKSILVFLPTYYALEQQWhlmkplssffKVHILHSSVDTEQALMAMKICKSHRKVILAtniaessvtiPKVAYVIDSCRSLQVFWDvnrkidsaeLVWVSQSQaeqrrgrtgrtcdgqvYRLVTKSFfgtledhecpAILRLSLRLQVLLICCAeskaisdpkvllqkaldppypevvgdALDLLDHKRALqkisprgryeptfYGRLLASFSLSFDASVLVLKFGEIGMLREGILLGilmdtqplpilhpfgddalfaeytgcyfggdgntrlltGRKEMVIMGNLCAFQFWQHVFKDKQRLDHLQQVLKFDETKVTASLLPKIEEEWCSLHYLVQSSLHHVSELYEDILNAVHrfrpkflgtsnglptyydpyefehtcllncdpprdmdplaadnehlgpsfeakkcvavpfvapnqfqsnNVAEKLASIIKEIRVQYVEdvsgnqdkavngsetpgeaplCVYFingscnrgtgcpfshslqakrpackffyslqgcrngdscifshdlgqpvlpsssftclpedgvANAASLLRLfptssdgsilllddtdmhFSANlaclydpsriisttclsdsaicdtSLAGIRILWGLCHSLKTVIseagdnpipwkevkcvlwypslesySENLESQKTLMQNFFEHLAIRMLADALYDTRVIITMNNIKFAQLQVIFVAVK
mgpssptsscsssysspftspefsslpVMSLREKIVEKVLENRVTLIvgetgcgksSQVPQFLLAENMEPILCTQPRRFAVVAVAKMVAKGRNCELGGEVGYHIghskhlsersKIVFKTAGVLLDEMRDRGLNALKYKVIILDEVHERSVESDLVLVCVKQlllkkndlrvvlmsataditkyrdYFRDLGRGERVevlaipstnqrtifqRRVSYLEQVTELLGVDHGMTSELSSLRYCSGPSPSMANAEIKPEVHKLIHDLVLHIHKNESDIEKSILVFLPTYYALEQQWHLMKPLSSFFKVHILHSSVDTEQALMAMKICKSHRKVILAtniaessvtipKVAYVIDSCRSLQVFWDVNRKIDsaelvwvsqsqaeqrrgrtgrtcdgqvYRLVTKSFFGTLEDHECPAILRLSLRLQVLLICCAEskaisdpkvLLQKALDPPYPEVVGDALDLLDHKRAlqkisprgryepTFYGRLLASFSLSFDASVLVLKFGEIGMLREGILLGILMDTQPLPILHPFGDDALFAEYTGCYFGGDGNTRLLTGRKEMVIMGNLCAFQFWQHVFKDKQRLDHLQQVLKFDETKVTASLLPKIEEEWCSLHYLVQSSLHHVSELYEDILNAVHRFRPKFLGTSNGLPTYYDPYEFEHTCLLNCDPPRDMDPLAADNEHLGPSFEAKKCVAVPFVAPNQFQSNNVAEKLASIIKEIRVQYVEDVSGNQDkavngsetpgeAPLCVYFINGSCNRGTGCPFSHSLQAKRPACKFFYSLQGCRNGDSCIFSHDLGQPVLPSSSFTCLPEDGVANAASLLRLFPTSSDGSILLLDDTDMHFSANLACLYDPSRIISTTCLSDSAICDTSLAGIRILWGLCHSLKTVIseagdnpipwkEVKCVLWYPSLESYSENLESQKTLMQNFFEHLAIRMLADALYDTRVIITMNNIKFAQLQVIFVAVK
MGpssptsscsssysspftspefsslpVMSLREKIVEKVLENRVTLIVGETGCGKSSQVPQFLLAENMEPILCTQPRRFavvavakmvakGRNCELGGEVGYHIGHSKHLSERSKIVFKTAGVLLDEMRDRGLNALKYKVIILDEVHERSVESDlvlvcvkqlllkkNDLRVVLMSATADITKYRDYFRDLGRGERVEVLAIPSTNQRTIFQRRVSYLEQVTELLGVDHGMTSELSSLRYCSGPSPSMANAEIKPEVHKLIHDLVLHIHKNESDIEKSILVFLPTYYALEQQWHLMKPLSSFFKVHILHSSVDTEQALMAMKICKSHRKVILATNIAESSVTIPKVAYVIDSCRSLQVFWDVNRKIDSAELVWVSQSQAEQRRGRTGRTCDGQVYRLVTKSFFGTLEDHECPAIlrlslrlqvllICCAESKAISDPKVLLQKALDPPYPEVVGDALDLLDHKRALQKISPRGRYEPTFYGRllasfslsfdasvlvlKFGEIGMLREGILLGILMDTQPLPILHPFGDDALFAEYTGCYFGGDGNTRLLTGRKEMVIMGNLCAFQFWQHVFKDKQRLDHLQQVLKFDETKVTASLLPKIEEEWCSLHYLVQSSLHHVSELYEDILNAVHRFRPKFLGTSNGLPTYYDPYEFEHTCLLNCDPPRDMDPLAADNEHLGPSFEAKKCVAVPFVAPNQFQSNNVAEKLASIIKEIRVQYVEDVSGNQDKAVNGSETPGEAPLCVYFINGSCNRGTGCPFSHSLQAKRPACKFFYSLQGCRNGDSCIFSHDLGQPVLPSSSFTCLPEDGVANAASLLRLFPTSSDGSILLLDDTDMHFSANLACLYDPSRIISTTCLSDSAICDTSLAGIRILWGLCHSLKTVISEAGDNPIPWKEVKCVLWYPSLESYSENLESQKTLMQNFFEHLAIRMLADALYDTRVIITMNNIKFAQLQVIFVAVK
*****************************SLREKIVEKVLENRVTLIVGETGCGKSSQVPQFLLAENMEPILCTQPRRFAVVAVAKMVAKGRNCELGGEVGYHIGHSKHLSERSKIVFKTAGVLLDEMRDRGLNALKYKVIILDEVHERSVESDLVLVCVKQLLLKKNDLRVVLMSATADITKYRDYFRDLGRGERVEVLAIPSTNQRTIFQRRVSYLEQVTELLGVDHGMTSELSSLRYC************KPEVHKLIHDLVLHIHKNESDIEKSILVFLPTYYALEQQWHLMKPLSSFFKVHILHSSVDTEQALMAMKICKSHRKVILATNIAESSVTIPKVAYVIDSCRSLQVFWDVNRKIDSAELVWVS***********GRTCDGQVYRLVTKSFFGTLEDHECPAILRLSLRLQVLLICCAESKAISDPKVLLQKALDPPYPEVVGDALDLLDHKRALQKISPRGRYEPTFYGRLLASFSLSFDASVLVLKFGEIGMLREGILLGILMDTQPLPILHPFGDDALFAEYTGCYFGGDGNTRLLTGRKEMVIMGNLCAFQFWQHVFKDKQRLDHLQQVLKFDETKVTASLLPKIEEEWCSLHYLVQSSLHHVSELYEDILNAVHRFRPKFLGTSNGLPTYYDPYEFEHTCLLNCDP****************SFEAKKCVAVPFVAPNQFQSNNVAEKLASIIKEIRVQYVEDV****************APLCVYFINGSCNRGTGCPFSHSLQAKRPACKFFYSLQGCRNGDSCIFSHDLGQPVLPSSSFTCLPEDGVANAASLLRLFPTSSDGSILLLDDTDMHFSANLACLYDPSRIISTTCLSDSAICDTSLAGIRILWGLCHSLKTVISEAGDNPIPWKEVKCVLWYPSLESYSENLESQKTLMQNFFEHLAIRMLADALYDTRVIITMNNIKFAQLQVIFVA**
*************************LPVMSLREKIVEKVLENRVTLIVGETGCGKSSQVPQFLLAENMEPILCTQPRRFAVVAVAKMVAKGRNCELGGEVGYHIGHSKHLSERSKIVFKTAGVLLDEMRDRGLNALKYKVIILDEVHERSVESDLVLVCVKQLLLKKNDLRVVLMSATADITKYRDYFRDLGRGERVEVLAIPSTNQRTIFQRRVSYLEQVTELLGVDHGMTSELSSLRYCSGPSPSMANAEIKPEVHKLIHDLVLHIHKNESDIEKSILVFLPTYYALEQQWHLMKPLSSFFKVHILHSSVDTEQALMAMKICKSHRKVILATNIAESSVTIPKVAYVIDSCRSLQVFWDVNRKIDSAELVWVSQSQAEQRRGRTGRTCDGQVYRLVTKSFFGTLEDHECPAILRLSLRLQVLLICCAESKAISDPKVLLQKALDPPYPEVVGDALDLLDHKRALQKISPRGRYEPTFYGRLLASFSLSFDASVLVLKFGEIGMLREGILLGILMDTQPLPILHPFGD**********YFGGDGNTRLLTGRKEMVIMGNLCAFQFWQHVFKDKQRLDHLQQVLKFDETKVTASLLPKIEEEWCSLHYLVQSSLHHVSELYEDILNAVHRFRPK*****NGLPTYYDPYEFEHTCLLNCDPPRD******************KCVAVPFVAPNQFQSNNVAEKLASIIKEIR******************ETPGEAPLCVYFINGSCNRGTGCPFSHSLQAKRPACKFFYSLQGCRNGDSCIF**********************ANAASLLRLFPTSSDGSILLLDDTDMHFSANLACLYDPSRIISTTCLSDSAICDTSLAGIRILWGLCHSLKTVISEAGDNPIPWKEVKCVLWYPSLES******S**TLMQNFFEHLAIRMLADALYDTRVIITMNNIKFAQLQVIFVAVK
***********************SSLPVMSLREKIVEKVLENRVTLIVGETGCGKSSQVPQFLLAENMEPILCTQPRRFAVVAVAKMVAKGRNCELGGEVGYHIGHSKHLSERSKIVFKTAGVLLDEMRDRGLNALKYKVIILDEVHERSVESDLVLVCVKQLLLKKNDLRVVLMSATADITKYRDYFRDLGRGERVEVLAIPSTNQRTIFQRRVSYLEQVTELLGVDHGMTSELSSLRYCSGPSPSMANAEIKPEVHKLIHDLVLHIHKNESDIEKSILVFLPTYYALEQQWHLMKPLSSFFKVHILHSSVDTEQALMAMKICKSHRKVILATNIAESSVTIPKVAYVIDSCRSLQVFWDVNRKIDSAELVWV**************TCDGQVYRLVTKSFFGTLEDHECPAILRLSLRLQVLLICCAESKAISDPKVLLQKALDPPYPEVVGDALDLLDHKRALQKISPRGRYEPTFYGRLLASFSLSFDASVLVLKFGEIGMLREGILLGILMDTQPLPILHPFGDDALFAEYTGCYFGGDGNTRLLTGRKEMVIMGNLCAFQFWQHVFKDKQRLDHLQQVLKFDETKVTASLLPKIEEEWCSLHYLVQSSLHHVSELYEDILNAVHRFRPKFLGTSNGLPTYYDPYEFEHTCLLNCDPPRDMDPLAADNEHLGPSFEAKKCVAVPFVAPNQFQSNNVAEKLASIIKEIRVQYVEDVSGNQDKAVNGSETPGEAPLCVYFINGSCNRGTGCPFSHSLQAKRPACKFFYSLQGCRNGDSCIFSHDLGQPVLPSSSFTCLPEDGVANAASLLRLFPTSSDGSILLLDDTDMHFSANLACLYDPSRIISTTCLSDSAICDTSLAGIRILWGLCHSLKTVISEAGDNPIPWKEVKCVLWYPSLESYSENLESQKTLMQNFFEHLAIRMLADALYDTRVIITMNNIKFAQLQVIFVAVK
****************PFTSPEFSSLPVMSLREKIVEKVLENRVTLIVGETGCGKSSQVPQFLLAENMEPILCTQPRRFAVVAVAKMVAKGRNCELGGEVGYHIGHSKHLSERSKIVFKTAGVLLDEMRDRGLNALKYKVIILDEVHERSVESDLVLVCVKQLLLKKNDLRVVLMSATADITKYRDYFRDLGRGERVEVLAIPSTNQRTIFQRRVSYLEQVTELLGVDHGMTSELSSLRYCSGPSPSMANAEIKPEVHKLIHDLVLHIHKNESDIEKSILVFLPTYYALEQQWHLMKPLSSFFKVHILHSSVDTEQALMAMKICKSHRKVILATNIAESSVTIPKVAYVIDSCRSLQVFWDVNRKIDSAELVWVSQSQAE****RTGRTCDGQVYRLVTKSFFGTLEDHECPAILRLSLRLQVLLICCAESKAISDPKVLLQKALDPPYPEVVGDALDLLDHKRALQKISPRGRYEPTFYGRLLASFSLSFDASVLVLKFGEIGMLREGILLGILMDTQPLPILHPFGDDALFAEYTGCYFGGDGNTRLLTGRKEMVIMGNLCAFQFWQHVFKDKQRLDHLQQVLKFDETKVTASLLPKIEEEWCSLHYLVQSSLHHVSELYEDILNAVHRFRPKFLGTSNGLPTYYDPYEFEHTCLLNCDPPRDMDPLAADNEHLGPSFEAKKCVAVPFVAPNQFQSNNVAEKLASIIKEIRVQYVEDVSGNQDKAVNGSETPGEAPLCVYFINGSCNRGTGCPFSHSLQAKRPACKFFYSLQGCRNGDSCI***********************ANAASLLRLFPTSSDGSILLLDDTDMHFSANLACLYDPSRIISTTCLSDSAICDTSLAGIRILWGLCHSLKTVISEAGDNPIPWKEVKCVLWYPSLESYSENLESQKTLMQNFFEHLAIRMLADALYDTRVIITMNNIKFAQLQVIFVAVK
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGPSSPTSSCSSSYSSPFTSPEFSSLPVMSLREKIVEKVLENRVTLIVGETGCGKSSQVPQFLLAENMEPILCTQPRRFAVVAVAKMVAKGRNCELGGEVGYHIGHSKHLSERSKIVFKTAGVLLDEMRDRGLNALKYKVIILDEVHERSVESDLVLVCVKQLLLKKNDLRVVLMSATADITKYRDYFRDLGRGERVEVLAIPSTNQRTIFQRRVSYLEQVTELLGVDHGMTSELSSLRYCSGPSPSMANAEIKPEVHKLIHDLVLHIHKNESDIEKSILVFLPTYYALEQQWHLMKPLSSFFKVHILHSSVDTEQALMAMKICKSHRKVILATNIAESSVTIPKVAYVIDSCRSLQVFWDVNRKIDSAELVWVSQSQAEQRRGRTGRTCDGQVYRLVTKSFFGTLEDHECPAILRLSLRLQVLLICCAESKAISDPKVLLQKALDPPYPEVVGDALDLLDHKRALQKISPRGRYEPTFYGRLLASFSLSFDASVLVLKFGEIGMLREGILLGILMDTQPLPILHPFGDDALFAEYTGCYFGGDGNTRLLTGRKEMVIMGNLCAFQFWQHVFKDKQRLDHLQQVLKFDETKVTASLLPKIEEEWCSLHYLVQSSLHHVSELYEDILNAVHRFRPKFLGTSNGLPTYYDPYEFEHTCLLNCDPPRDMDPLAADNEHLGPSFEAKKCVAVPFVAPNQFQSNNVAEKLASIIKEIRVQYVEDVSGNQDKAVNGSETPGEAPLCVYFINGSCNRGTGCPFSHSLQAKRPACKFFYSLQGCRNGDSCIFSHDLGQPVLPSSSFTCLPEDGVANAASLLRLFPTSSDGSILLLDDTDMHFSANLACLYDPSRIISTTCLSDSAICDTSLAGIRILWGLCHSLKTVISEAGDNPIPWKEVKCVLWYPSLESYSENLESQKTLMQNFFEHLAIRMLADALYDTRVIITMNNIKFAQLQVIFVAVK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query957 2.2.26 [Sep-21-2011]
O222431015 Zinc finger CCCH domain-c yes no 0.959 0.904 0.659 0.0
Q1EHT71007 Zinc finger CCCH domain-c yes no 0.952 0.905 0.571 0.0
Q6PGC11365 ATP-dependent RNA helicas yes no 0.524 0.367 0.333 1e-59
Q7Z4781369 ATP-dependent RNA helicas yes no 0.526 0.368 0.322 5e-58
Q3MHU3 1384 Putative ATP-dependent RN no no 0.603 0.417 0.282 5e-56
Q14BI7 1383 Putative ATP-dependent RN no no 0.621 0.430 0.285 2e-55
Q16JS8 1374 Probable ATP-dependent RN N/A no 0.499 0.347 0.300 6e-55
Q8NDG6 1382 Putative ATP-dependent RN no no 0.610 0.422 0.290 1e-54
Q296Q5 1433 Probable ATP-dependent RN yes no 0.516 0.344 0.300 8e-54
Q7QCW2 1463 Probable ATP-dependent RN yes no 0.486 0.318 0.309 9e-53
>sp|O22243|C3H31_ARATH Zinc finger CCCH domain-containing protein 31 OS=Arabidopsis thaliana GN=At2g47680 PE=2 SV=2 Back     alignment and function desciption
 Score = 1222 bits (3163), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 617/935 (65%), Positives = 752/935 (80%), Gaps = 17/935 (1%)

Query: 23  FSSLPVMSLREKIVEKVLENRVTLIVGETGCGKSSQVPQFLLAENMEPILCTQPRRFAVV 82
           F+SLP+M+++ +I++K+LENRVTLIVGE GCGKSSQVPQFLL  NM PILCTQPRRFAVV
Sbjct: 23  FASLPIMAMKRRIIDKILENRVTLIVGEPGCGKSSQVPQFLLEANMAPILCTQPRRFAVV 82

Query: 83  AVAKMVAKGRNCELGGEVGYHIGHSKHLSERSKIVFKTAGVLLDEMRDRGLNALKYKVII 142
           AVAKMVAK RN +LGGE+GYHIGHSK L+E SKI+FKTAGVLLDEM D+GLNALKYKVII
Sbjct: 83  AVAKMVAKSRNSDLGGEIGYHIGHSKILTEGSKILFKTAGVLLDEMLDKGLNALKYKVII 142

Query: 143 LDEVHERSVESDLVLVCVKQLLLKKNDLRVVLMSATADITKYRDYFRDLGRGERVEVLAI 202
           LDEVHERSVESDLVLVCVKQ L+K NDLRVVLMSATADIT+YRDYF++LGRGERVEV+AI
Sbjct: 143 LDEVHERSVESDLVLVCVKQFLMKNNDLRVVLMSATADITRYRDYFKELGRGERVEVVAI 202

Query: 203 PSTNQRTIFQRRVSYLEQVTELLGVDHGMTSELSSLRYCSGPSPSMANAEIKPEVHKLIH 262
           PS +QRTIFQRRV YLEQV  LLGV    +S+LS+  YC GPSPS A+ EIKPE+  LIH
Sbjct: 203 PSPDQRTIFQRRVLYLEQVAGLLGV----SSDLSA--YCPGPSPSSADTEIKPELQNLIH 256

Query: 263 DLVLHIHKNESDIEKSILVFLPTYYALEQQWHLMKPLSSFFKVHILHSSVDTEQALMAMK 322
           DL+L+IH+ E DIEKSILVFLPTYY+LEQQ+H ++P  + F+VHILH S+DTEQAL AMK
Sbjct: 257 DLILYIHEKEPDIEKSILVFLPTYYSLEQQYHQLEPFFASFEVHILHRSIDTEQALAAMK 316

Query: 323 ICKSHRKVILATNIAESSVTIPKVAYVIDSCRSLQVFWDVNRKIDSAELVWVSQSQAEQR 382
           IC+S RKVILATNIAESSVTIPKVAYVIDSCRSLQVFWD +RK D+ +LVWVS+SQAEQR
Sbjct: 317 ICRSRRKVILATNIAESSVTIPKVAYVIDSCRSLQVFWDPSRKRDAVQLVWVSRSQAEQR 376

Query: 383 RGRTGRTCDGQVYRLVTKSFFGTLEDHECPAILRLSLRLQVLLICCAESKAISDPKVLLQ 442
           RGRTGRTCDG+VYRLV  +FF  LE+HE P+IL+LSLR QVL ICC ES+AI+D   LL 
Sbjct: 377 RGRTGRTCDGEVYRLVPSAFFNKLEEHEPPSILKLSLRQQVLHICCTESRAINDANALLA 436

Query: 443 KALDPPYPEVVGDALDLLDHKRALQKISPRGRYEPTFYGRLLASFSLSFDASVLVLKFGE 502
           KA+DPP P+VV DAL +L   +AL+K SPRGRYEPTFYGRLLASF LSFDAS+LV+KFGE
Sbjct: 437 KAMDPPDPDVVDDALRMLLSIQALRK-SPRGRYEPTFYGRLLASFPLSFDASILVVKFGE 495

Query: 503 IGMLREGILLGILMDTQPLPILHPFGDDALFAEYTGCYFGGDGNTRLLTGRKEMVIMGNL 562
           +GMLR+GILLG+LMDT PLPI HPFGDD+LF EY   YFG  G+  +  GR+EMV+M N 
Sbjct: 496 MGMLRQGILLGVLMDTLPLPIHHPFGDDSLFLEYVDHYFG--GSKTISGGRREMVLMANF 553

Query: 563 CAFQFWQHVFKDKQRLDHLQQVLKFDETKVTASLLPKIEEEWCSLHYLVQSSLHHVSELY 622
           CAFQFWQ VFKDK RL++L+Q+L  ++ K    + P+IE+EWC  H + QSS +HVSELY
Sbjct: 554 CAFQFWQRVFKDKHRLENLKQLLSKEKDKDLKLMFPEIEKEWCDFHNIAQSSFYHVSELY 613

Query: 623 EDILNAVHRFRPKFLGTSNGLPTYYDPYEFEHTCLLNCDPPRDMDPLAADNEHLGPSFEA 682
           ED L++ HRFRP+F+ +S+  PTYY+PYEF+HTC + C P  D    + D ++  P  E 
Sbjct: 614 EDTLSSFHRFRPQFISSSDSQPTYYNPYEFDHTCYIECQPSEDKYLHSEDVDNNQPPPEV 673

Query: 683 KKCVAVPFVAPNQFQSNNVAEKLASIIKEIRVQYVEDVSGNQDKAVNGSE--TPGEAPLC 740
           +KCV+VPFV PN FQ+N +AE +ASIIKEIR Q     S N   A+   +    GEAP+C
Sbjct: 674 RKCVSVPFVPPNAFQANAIAENMASIIKEIRTQCTPSESDNGHGALEPEDYVEYGEAPVC 733

Query: 741 VYFINGSCNRGTGCPFSHSLQAKRPACKFFYSLQGCRNGDSCIFSHDLGQ---PVLPSSS 797
           VYF+NG CNRG  C F+H+LQ+ RPACKFF S QGCRNG+SC+FSH + +     LP   
Sbjct: 734 VYFLNGYCNRGGQCTFTHTLQSTRPACKFFASSQGCRNGESCLFSHAMRRRTTSYLPPPQ 793

Query: 798 FTCLPEDGVANAASLLRLFPTSSDGSILLLDDTDMHFSANLACLYDPSRIISTTCLSDSA 857
             CLPE+  ++ + LL LFPTSS+G IL+ DD+DMHF++++A  Y   RI+ST+  S++ 
Sbjct: 794 --CLPEEDGSSTSPLLDLFPTSSEGCILVFDDSDMHFTSSIANRYPSWRILSTSSSSETL 851

Query: 858 ICDTSLAGIRILWGLCHSLKTVISEAG-DNPIPWKEVKCVLWYPSLESYSENLESQKTLM 916
            CD+SLA  RI WGL H  +T+IS+AG +NPIPW EVKCVLW+ + +SY++  E QKT++
Sbjct: 852 FCDSSLADTRIFWGLNHPYQTIISKAGRENPIPWNEVKCVLWFLNPDSYADTPEKQKTIL 911

Query: 917 QNFFEHLAIRMLADALYDTRVIITMNNIKFAQLQV 951
           QNFFEH+AIR+L D LY  RV++TMNN++F+ LQV
Sbjct: 912 QNFFEHMAIRLLGDKLYKIRVVLTMNNVRFSLLQV 946

Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: -
>sp|Q1EHT7|C3H4_ORYSJ Zinc finger CCCH domain-containing protein 4 OS=Oryza sativa subsp. japonica GN=Os01g0256800 PE=2 SV=1 Back     alignment and function description
>sp|Q6PGC1|DHX29_MOUSE ATP-dependent RNA helicase Dhx29 OS=Mus musculus GN=Dhx29 PE=2 SV=1 Back     alignment and function description
>sp|Q7Z478|DHX29_HUMAN ATP-dependent RNA helicase DHX29 OS=Homo sapiens GN=DHX29 PE=1 SV=2 Back     alignment and function description
>sp|Q3MHU3|TDRD9_RAT Putative ATP-dependent RNA helicase TDRD9 OS=Rattus norvegicus GN=Tdrd9 PE=2 SV=3 Back     alignment and function description
>sp|Q14BI7|TDRD9_MOUSE Putative ATP-dependent RNA helicase TDRD9 OS=Mus musculus GN=Tdrd9 PE=1 SV=3 Back     alignment and function description
>sp|Q16JS8|SPNE_AEDAE Probable ATP-dependent RNA helicase spindle-E OS=Aedes aegypti GN=spn-E PE=3 SV=1 Back     alignment and function description
>sp|Q8NDG6|TDRD9_HUMAN Putative ATP-dependent RNA helicase TDRD9 OS=Homo sapiens GN=TDRD9 PE=2 SV=3 Back     alignment and function description
>sp|Q296Q5|SPNE_DROPS Probable ATP-dependent RNA helicase spindle-E OS=Drosophila pseudoobscura pseudoobscura GN=spn-E PE=3 SV=2 Back     alignment and function description
>sp|Q7QCW2|SPNE_ANOGA Probable ATP-dependent RNA helicase spindle-E OS=Anopheles gambiae GN=spn-E PE=3 SV=5 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query957
2555641681025 ATP-dependent RNA helicase, putative [Ri 0.968 0.904 0.711 0.0
2977438761007 unnamed protein product [Vitis vinifera] 0.957 0.909 0.715 0.0
3594799041014 PREDICTED: zinc finger CCCH domain-conta 0.957 0.903 0.708 0.0
3574425071035 Zinc finger CCCH domain-containing prote 0.963 0.890 0.668 0.0
2978284891015 zinc finger helicase family protein [Ara 0.958 0.903 0.657 0.0
152271121015 zinc finger CCCH domain-containing prote 0.959 0.904 0.659 0.0
449469086998 PREDICTED: LOW QUALITY PROTEIN: zinc fin 0.942 0.903 0.644 0.0
1222250401007 RecName: Full=Zinc finger CCCH domain-co 0.952 0.905 0.571 0.0
3571278701004 PREDICTED: zinc finger CCCH domain-conta 0.949 0.905 0.566 0.0
4139470161007 putative RNA helicase family protein [Ze 0.950 0.903 0.539 0.0
>gi|255564168|ref|XP_002523081.1| ATP-dependent RNA helicase, putative [Ricinus communis] gi|223537643|gb|EEF39266.1| ATP-dependent RNA helicase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score = 1368 bits (3540), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 672/945 (71%), Positives = 781/945 (82%), Gaps = 18/945 (1%)

Query: 17  PFTSPEFSSLPVMSLREKIVEKVLENRVTLIVGETGCGKSSQVPQFLLAENMEPILCTQP 76
           PF   EF+SLP+MSLR+KIVEKVLENRVTLIVG+TGCGKSSQVPQFLL ENMEPILCTQP
Sbjct: 18  PFLQREFASLPIMSLRQKIVEKVLENRVTLIVGDTGCGKSSQVPQFLLEENMEPILCTQP 77

Query: 77  RRFAVVAVAKMVAKGRNCELGGEVGYHIGHSKHLSERSKIVFKTAGVLLDEMRDRGLNAL 136
           RRFAVVAVAKMVAK RNCELGGEVGYHIGH KHLSERSKIVFKTAGVL DEMR++GLNAL
Sbjct: 78  RRFAVVAVAKMVAKARNCELGGEVGYHIGHLKHLSERSKIVFKTAGVLSDEMREKGLNAL 137

Query: 137 KYKVIILDEVHERSVESDLVLVCVKQLLLKKNDLRVVLMSATADITKYRDYFRDLGRGER 196
           KYKVIILDEVHERS+ESDLVLVCVKQ LL+ NDLRVVLMSATAD  +YRDYF+DLGRGER
Sbjct: 138 KYKVIILDEVHERSIESDLVLVCVKQFLLRNNDLRVVLMSATADFGRYRDYFKDLGRGER 197

Query: 197 VEVLAIPSTNQRTIFQRRVSYLEQVTELLGVDHGMTSELSSLRYCSGPSPSMANAEIKPE 256
           VEVLAIPS+NQ+ +FQRRVSYLEQ            S++ + +YCSGPSP+M +A+IKPE
Sbjct: 198 VEVLAIPSSNQQALFQRRVSYLEQEI--------TCSQVLATKYCSGPSPAMVSADIKPE 249

Query: 257 VHKLIHDLVLHIHKNESDIEKSILVFLPTYYALEQQWHLMKPLSSFFKVHILHSSVDTEQ 316
           VHKLIHDLV+HIH NE DIEK ILVFLPTY+ L QQW+L+KPL S FKVHILH S+DTEQ
Sbjct: 250 VHKLIHDLVMHIHDNEPDIEKGILVFLPTYHDLLQQWYLLKPLGSCFKVHILHGSIDTEQ 309

Query: 317 ALMAMKICKSHRKVILATNIAESSVTIPKVAYVIDSCRSLQVFWDVNRKIDSAELVWVSQ 376
           AL+AMKI KSHRKVILATNIAESSVTIPKVAYVIDSCRSLQVFWD  RK D AELVWVS+
Sbjct: 310 ALLAMKIWKSHRKVILATNIAESSVTIPKVAYVIDSCRSLQVFWDGTRKKDYAELVWVSK 369

Query: 377 SQAEQRRGRTGRTCDGQVYRLVTKSFFGTLEDHECPAILRLSLRLQVLLICCAESKAISD 436
           SQA+QR+GRTGRTCDGQ+YRLVT+SFF  L+++E PAILRLSLR QVL++CCAESKAI+D
Sbjct: 370 SQADQRKGRTGRTCDGQIYRLVTRSFFNKLQEYESPAILRLSLRQQVLMVCCAESKAIND 429

Query: 437 PKVLLQKALDPPYPEVVGDALDLLDHKRALQKISPRGRYEPTFYGRLLASFSLSFDASVL 496
           P+VLLQK LDPP P V+ DAL+LL H +AL + S RGRYEPTFYGRLLASF LSFDAS +
Sbjct: 430 PRVLLQKTLDPPDPRVIEDALNLLVHIKALDRTSARGRYEPTFYGRLLASFPLSFDASFI 489

Query: 497 VLKFGEIGMLREGILLGILMDTQPLPILHPFGDDALFAEYTGCYFGGDGNTRLLTGRKEM 556
           VLKFG++G+LREGIL+GILMD QP PILHPFG++ LFAEY   Y+GGD N  +  GRKEM
Sbjct: 490 VLKFGDVGLLREGILIGILMDIQPQPILHPFGEEHLFAEYAYHYYGGDCNNMVRIGRKEM 549

Query: 557 VIMGNLCAFQFWQHVFKDKQRLDHLQQVLKFDETKVTASLLPKIEEEWCSLHYLVQSSLH 616
           ++MGNLCA++FWQ VFKD+ RL+HL+++  FDE K   SLLPKIEEEWCS H LV SSLH
Sbjct: 550 ILMGNLCAYKFWQRVFKDRHRLEHLKRLSTFDEMKAVTSLLPKIEEEWCSFHNLVWSSLH 609

Query: 617 HVSELYEDILNAVHRFRPKFLGTSNGLPTYYDPYEFEHTCLLNCDPPRDMDPLAADNEHL 676
            VSE+YEDIL+++HRFRP+FLG  +GLPTYYDPYEF H CLL      D+  +AAD+EH 
Sbjct: 610 QVSEIYEDILSSLHRFRPRFLGKCDGLPTYYDPYEFGHVCLLKSQQNEDIVVVAADDEHQ 669

Query: 677 GPSFEAKKCVAVPFVAPNQFQSNNVAEKLASIIKEIR-------VQYVE-DVSGNQDKAV 728
            PS E KKC AVPFV    FQ+ NVAEKL +I+KE+          YV  D SGN    V
Sbjct: 670 EPSSEIKKCCAVPFVDSGHFQTINVAEKLLTIVKEVNKLCTGNDSSYVNGDPSGNDAGYV 729

Query: 729 NG--SETPGEAPLCVYFINGSCNRGTGCPFSHSLQAKRPACKFFYSLQGCRNGDSCIFSH 786
           N   S    EAPLCVYF+NGSCN+G+ C FSHSLQAK+PAC++F++LQGCRNG+SC FSH
Sbjct: 730 NEDVSHVNEEAPLCVYFVNGSCNKGSQCSFSHSLQAKKPACRYFFTLQGCRNGESCSFSH 789

Query: 787 DLGQPVLPSSSFTCLPEDGVANAASLLRLFPTSSDGSILLLDDTDMHFSANLACLYDPSR 846
           D+G  V   S   C PED   NA SLL+LFPTSSDG ILLL+D+D+HFS N AC YDPS+
Sbjct: 790 DIGSSVSSCSPAPCPPEDDDVNAVSLLQLFPTSSDGCILLLEDSDLHFSLNFACFYDPSK 849

Query: 847 IISTTCLSDSAICDTSLAGIRILWGLCHSLKTVISEAGDNPIPWKEVKCVLWYPSLESYS 906
           IISTTC+S++++ D SL G+RILW      +T+IS+AG N IPW EVKC+LW+PS  S S
Sbjct: 850 IISTTCMSETSLNDPSLNGVRILWEFRDPCRTIISKAGRNLIPWSEVKCILWFPSFASQS 909

Query: 907 ENLESQKTLMQNFFEHLAIRMLADALYDTRVIITMNNIKFAQLQV 951
           ENLE QK L+QNFF++LA R++AD+LY+ R+IITMNN++FAQLQV
Sbjct: 910 ENLEGQKILVQNFFDYLASRIIADSLYELRIIITMNNVRFAQLQV 954

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|297743876|emb|CBI36846.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359479904|ref|XP_002267435.2| PREDICTED: zinc finger CCCH domain-containing protein 31 [Vitis vinifera] Back     alignment and taxonomy information
>gi|357442507|ref|XP_003591531.1| Zinc finger CCCH domain-containing protein [Medicago truncatula] gi|355480579|gb|AES61782.1| Zinc finger CCCH domain-containing protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|297828489|ref|XP_002882127.1| zinc finger helicase family protein [Arabidopsis lyrata subsp. lyrata] gi|297327966|gb|EFH58386.1| zinc finger helicase family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15227112|ref|NP_182290.1| zinc finger CCCH domain-containing protein 31 [Arabidopsis thaliana] gi|75317978|sp|O22243.2|C3H31_ARATH RecName: Full=Zinc finger CCCH domain-containing protein 31; Short=AtC3H31 gi|3738282|gb|AAC63624.1| putative ATP-dependent RNA helicase A [Arabidopsis thaliana] gi|225898609|dbj|BAH30435.1| hypothetical protein [Arabidopsis thaliana] gi|330255781|gb|AEC10875.1| zinc finger CCCH domain-containing protein 31 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449469086|ref|XP_004152252.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger CCCH domain-containing protein 31-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|122225040|sp|Q1EHT7.1|C3H4_ORYSJ RecName: Full=Zinc finger CCCH domain-containing protein 4; Short=OsC3H4 gi|108792647|dbj|BAE95808.1| ATP-dependent RNA helicase A -like [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|357127870|ref|XP_003565600.1| PREDICTED: zinc finger CCCH domain-containing protein 4-like [Brachypodium distachyon] Back     alignment and taxonomy information
>gi|413947016|gb|AFW79665.1| putative RNA helicase family protein [Zea mays] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query957
TAIR|locus:20434131015 AT2G47680 [Arabidopsis thalian 0.954 0.899 0.613 4.9e-307
FB|FBgn0032883942 CG9323 [Drosophila melanogaste 0.179 0.182 0.396 5.1e-41
UNIPROTKB|E1C3881372 DHX29 "Uncharacterized protein 0.222 0.155 0.313 8.7e-41
UNIPROTKB|F1S9V4 1333 TDRD9 "Uncharacterized protein 0.456 0.327 0.305 2.9e-39
UNIPROTKB|Q8NDG6 1382 TDRD9 "Putative ATP-dependent 0.452 0.313 0.308 5.4e-39
MGI|MGI:1921941 1383 Tdrd9 "tudor domain containing 0.452 0.313 0.292 1.4e-38
UNIPROTKB|F1MNA1 1392 TDRD9 "Uncharacterized protein 0.453 0.311 0.300 2e-38
RGD|1306942 1384 Tdrd9 "tudor domain containing 0.452 0.312 0.289 2.7e-38
ZFIN|ZDB-GENE-090313-193 1344 tdrd9 "tudor domain containing 0.432 0.308 0.301 3.4e-38
UNIPROTKB|C3XYZ4 1475 BRAFLDRAFT_65715 "Putative unc 0.378 0.245 0.321 1e-37
TAIR|locus:2043413 AT2G47680 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2946 (1042.1 bits), Expect = 4.9e-307, P = 4.9e-307
 Identities = 571/930 (61%), Positives = 701/930 (75%)

Query:    28 VMSLREKIVEKVLENRVTLIVGETGCGKSSQVPQFLLAENMEPILCTQPRRFXXXXXXXX 87
             +M+++ +I++K+LENRVTLIVGE GCGKSSQVPQFLL  NM PILCTQPRRF        
Sbjct:    28 IMAMKRRIIDKILENRVTLIVGEPGCGKSSQVPQFLLEANMAPILCTQPRRFAVVAVAKM 87

Query:    88 XXXGRNCELGGEVGYHIGHSKHLSERSKIVFKTAGVLLDEMRDRGLNALKYKVIILDEVH 147
                 RN +LGGE+GYHIGHSK L+E SKI+FKTAGVLLDEM D+GLNALKYKVIILDEVH
Sbjct:    88 VAKSRNSDLGGEIGYHIGHSKILTEGSKILFKTAGVLLDEMLDKGLNALKYKVIILDEVH 147

Query:   148 ERSVESDXXXXXXXXXXXXXNDLRVVLMSATADITKYRDYFRDLGRGERVEVLAIPSTNQ 207
             ERSVESD             NDLRVVLMSATADIT+YRDYF++LGRGERVEV+AIPS +Q
Sbjct:   148 ERSVESDLVLVCVKQFLMKNNDLRVVLMSATADITRYRDYFKELGRGERVEVVAIPSPDQ 207

Query:   208 RTIFQRRVSYLEQVTELLGVDHGMTSELSSLRYCSGPSPSMANAEIKPEVHKLIHDLVLH 267
             RTIFQRRV YLEQV  LLGV    +S+LS+  YC GPSPS A+ EIKPE+  LIHDL+L+
Sbjct:   208 RTIFQRRVLYLEQVAGLLGV----SSDLSA--YCPGPSPSSADTEIKPELQNLIHDLILY 261

Query:   268 IHKNESDIEKSILVFLPTYYALEQQWHLMKPLSSFFKVHILHSSVDTEQALMAMKICKSH 327
             IH+ E DIEKSILVFLPTYY+LEQQ+H ++P  + F+VHILH S+DTEQAL AMKIC+S 
Sbjct:   262 IHEKEPDIEKSILVFLPTYYSLEQQYHQLEPFFASFEVHILHRSIDTEQALAAMKICRSR 321

Query:   328 RKVILATNIAESSVTIPKVAYVIDSCRSLQVFWDVNRKIDSAELVWVSQSQAEQRRGRTG 387
             RKVILATNIAESSVTIPKVAYVIDSCRSLQVFWD +RK D+ +LVWVS+SQAEQRRGRTG
Sbjct:   322 RKVILATNIAESSVTIPKVAYVIDSCRSLQVFWDPSRKRDAVQLVWVSRSQAEQRRGRTG 381

Query:   388 RTCDGQVYRLVTKSFFGTLEDHECPAIXXXXXXXXXXXICCAESKAISDPKVLLQKALDP 447
             RTCDG+VYRLV  +FF  LE+HE P+I           ICC ES+AI+D   LL KA+DP
Sbjct:   382 RTCDGEVYRLVPSAFFNKLEEHEPPSILKLSLRQQVLHICCTESRAINDANALLAKAMDP 441

Query:   448 PYPEVVGDALDLLDHKRALQKISPRGRYEPTFYGRXXXXXXXXXXXXXXXXKFGEIGMLR 507
             P P+VV DAL +L   +AL+K SPRGRYEPTFYGR                KFGE+GMLR
Sbjct:   442 PDPDVVDDALRMLLSIQALRK-SPRGRYEPTFYGRLLASFPLSFDASILVVKFGEMGMLR 500

Query:   508 EGILLGILMDTQPLPILHPFGDDALFAEYTGCYFGGDGNTRLLTGRKEMVIMGNLCAFQF 567
             +GILLG+LMDT PLPI HPFGDD+LF EY   YFGG  +  +  GR+EMV+M N CAFQF
Sbjct:   501 QGILLGVLMDTLPLPIHHPFGDDSLFLEYVDHYFGG--SKTISGGRREMVLMANFCAFQF 558

Query:   568 WQHVFKDKQRLDHLQQVLKFDETKVTASLLPKIEEEWCSLHYLVQSSLHHVSELYEDILN 627
             WQ VFKDK RL++L+Q+L  ++ K    + P+IE+EWC  H + QSS +HVSELYED L+
Sbjct:   559 WQRVFKDKHRLENLKQLLSKEKDKDLKLMFPEIEKEWCDFHNIAQSSFYHVSELYEDTLS 618

Query:   628 AVHRFRPKFLGTSNGLPTYYDPYEFEHTCLLNCDPPRDMDPLAADNEHLGPSFEAKKCVA 687
             + HRFRP+F+ +S+  PTYY+PYEF+HTC + C P  D    + D ++  P  E +KCV+
Sbjct:   619 SFHRFRPQFISSSDSQPTYYNPYEFDHTCYIECQPSEDKYLHSEDVDNNQPPPEVRKCVS 678

Query:   688 VPFVAPNQFQSNNVAEKLASIIKEIRVQYVEDVSGNQDKAVNGSETP--GEAPLCVYFIN 745
             VPFV PN FQ+N +AE +ASIIKEIR Q     S N   A+   +    GEAP+CVYF+N
Sbjct:   679 VPFVPPNAFQANAIAENMASIIKEIRTQCTPSESDNGHGALEPEDYVEYGEAPVCVYFLN 738

Query:   746 GSCNRGTGCPFSHSLQAKRPACKFFYSLQGCRNGDSCIFSHDLGQPV---LPSSSFTCLP 802
             G CNRG  C F+H+LQ+ RPACKFF S QGCRNG+SC+FSH + +     LP     CLP
Sbjct:   739 GYCNRGGQCTFTHTLQSTRPACKFFASSQGCRNGESCLFSHAMRRRTTSYLPPPQ--CLP 796

Query:   803 EDGVANAASLLRLFPTSSDGSILLLDDTDMHFSANLACLYDPSRIISTTCLSDSAICDTS 862
             E+  ++ + LL LFPTSS+G IL+ DD+DMHF++++A  Y   RI+ST+  S++  CD+S
Sbjct:   797 EEDGSSTSPLLDLFPTSSEGCILVFDDSDMHFTSSIANRYPSWRILSTSSSSETLFCDSS 856

Query:   863 LAGIRILWGLCHSLKTVISEAG-DNPIPWKEVKCVLWYPSLESYSENLESQKTLMQNFFE 921
             LA  RI WGL H  +T+IS+AG +NPIPW EVKCVLW+ + +SY++  E QKT++QNFFE
Sbjct:   857 LADTRIFWGLNHPYQTIISKAGRENPIPWNEVKCVLWFLNPDSYADTPEKQKTILQNFFE 916

Query:   922 HLAIRMLADALYDTRVIITMNNIKFAQLQV 951
             H+AIR+L D LY  RV++TMNN++F+ LQV
Sbjct:   917 HMAIRLLGDKLYKIRVVLTMNNVRFSLLQV 946
GO:0003676 "nucleic acid binding" evidence=IEA;ISS
GO:0004386 "helicase activity" evidence=IEA;ISS
GO:0005524 "ATP binding" evidence=IEA
GO:0006139 "nucleobase-containing compound metabolic process" evidence=ISS
GO:0008026 "ATP-dependent helicase activity" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0019243 "methylglyoxal catabolic process to D-lactate" evidence=RCA
FB|FBgn0032883 CG9323 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|E1C388 DHX29 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1S9V4 TDRD9 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q8NDG6 TDRD9 "Putative ATP-dependent RNA helicase TDRD9" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1921941 Tdrd9 "tudor domain containing 9" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1MNA1 TDRD9 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|1306942 Tdrd9 "tudor domain containing 9" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-090313-193 tdrd9 "tudor domain containing 9" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|C3XYZ4 BRAFLDRAFT_65715 "Putative uncharacterized protein" [Branchiostoma floridae (taxid:7739)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O22243C3H31_ARATH3, ., 6, ., 4, ., -0.65980.95920.9044yesno
Q1EHT7C3H4_ORYSJ3, ., 6, ., 4, ., -0.57110.95290.9056yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.6.40.691

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00027989001
SubName- Full=Chromosome chr7 scaffold_42, whole genome shotgun sequence; (996 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query957
COG1643845 COG1643, HrpA, HrpA-like helicases [DNA replicatio 4e-78
TIGR01970819 TIGR01970, DEAH_box_HrpB, ATP-dependent helicase H 3e-38
TIGR01967 1283 TIGR01967, DEAH_box_HrpA, ATP-dependent helicase H 3e-30
PRK11131 1294 PRK11131, PRK11131, ATP-dependent RNA helicase Hrp 4e-30
PRK11664812 PRK11664, PRK11664, ATP-dependent RNA helicase Hrp 3e-25
cd00046144 cd00046, DEXDc, DEAD-like helicases superfamily 1e-19
smart00487201 smart00487, DEXDc, DEAD-like helicases superfamily 2e-18
PHA02653675 PHA02653, PHA02653, RNA helicase NPH-II; Provision 6e-17
TIGR01967 1283 TIGR01967, DEAH_box_HrpA, ATP-dependent helicase H 8e-14
PRK11131 1294 PRK11131, PRK11131, ATP-dependent RNA helicase Hrp 8e-12
smart0049082 smart00490, HELICc, helicase superfamily c-termina 3e-09
pfam0027178 pfam00271, Helicase_C, Helicase conserved C-termin 5e-08
cd00079131 cd00079, HELICc, Helicase superfamily c-terminal d 1e-06
pfam00270169 pfam00270, DEAD, DEAD/DEAH box helicase 5e-06
COG0513513 COG0513, SrmB, Superfamily II DNA and RNA helicase 3e-05
COG5084285 COG5084, YTH1, Cleavage and polyadenylation specif 3e-04
smart0035627 smart00356, ZnF_C3H1, zinc finger 3e-04
COG1111542 COG1111, MPH1, ERCC4-like helicases [DNA replicati 8e-04
>gnl|CDD|224557 COG1643, HrpA, HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information 
 Score =  272 bits (697), Expect = 4e-78
 Identities = 159/533 (29%), Positives = 249/533 (46%), Gaps = 93/533 (17%)

Query: 3   PSSPTSSCSSSYSSPFTSPEFSSLPVMSLREKIVEKVLENRVTLIVGETGCGKSSQVPQF 62
            S   +   S+          S LPV ++R++I++ + +N+V +IVGETG GK++Q+PQF
Sbjct: 27  GSGMDARSRSANVPDI-LEYRSGLPVTAVRDEILKAIEQNQVVIIVGETGSGKTTQLPQF 85

Query: 63  LLAENMEP---ILCTQPRRFAVVAVAKMVAKGRNCELGGEVGYHIGHSKHLSERSKIVFK 119
           LL E +     I CTQPRR A  +VA+ VA+    +LG  VGY I     +S R++I   
Sbjct: 86  LLEEGLGIAGKIGCTQPRRLAARSVAERVAEELGEKLGETVGYSIRFESKVSPRTRIKVM 145

Query: 120 TAGVLLDEMR-DRGLNALKYKVIILDEVHERSVESDLVLVCVKQLL-LKKNDLRVVLMSA 177
           T G+LL E++ D  L+   Y V+I+DE HERS+ +D++L  +K LL  +++DL++++MSA
Sbjct: 146 TDGILLREIQNDPLLS--GYSVVIIDEAHERSLNTDILLGLLKDLLARRRDDLKLIIMSA 203

Query: 178 TADITKYRDYFRDL------GRGERVEVLAIPSTNQRTIFQRRVSYLEQVTELLGVDHGM 231
           T D  ++  YF +       GR   VE                + YL +      +   +
Sbjct: 204 TLDAERFSAYFGNAPVIEIEGRTYPVE----------------IRYLPEAEADYILLDAI 247

Query: 232 TSELSSLRYCSGPSPSMANAEIKPEVHKLIHDLVLHIHKNESDIEKSILVFLP------- 284
            +                                + IH  E     SILVFLP       
Sbjct: 248 VA-------------------------------AVDIHLREG--SGSILVFLPGQREIER 274

Query: 285 TYYALEQQWHLMKPLSSFFKVHILHSSVDTEQALMAMKIC-KSHRKVILATNIAESSVTI 343
           T   LE+       L    ++  L+ ++  E+ +   +      RKV+LATNIAE+S+TI
Sbjct: 275 TAEWLEK-----AELGDDLEILPLYGALSAEEQVRVFEPAPGGKRKVVLATNIAETSLTI 329

Query: 344 PKVAYVIDSCRSLQVFWDVNRKIDSAELVWVSQSQAEQRRGRTGRTCDGQVYRLVTKSFF 403
           P + YVIDS  + +  +D    +   E   +S++ A+QR GR GRT  G  YRL ++  F
Sbjct: 330 PGIRYVIDSGLAKEKRYDPRTGLTRLETEPISKASADQRAGRAGRTGPGICYRLYSEEDF 389

Query: 404 GTLEDHECPAILRLSLRLQVLLICCAESKAIS-DPKVLLQKALDPPYPEVVGDALDLLDH 462
               +   P ILR  L   ++L    + K++     +     LDPP    +  AL LL  
Sbjct: 390 LAFPEFTLPEILRTDLS-GLVL----QLKSLGIGQDIAPFPFLDPPPEAAIQAALTLLQE 444

Query: 463 KRALQ---KISPRGRYEPTFYGRLLASFSLSFDASVLVLKFGEIGMLREGILL 512
             AL    K++P G+         ++   L    + ++L   E G L E   +
Sbjct: 445 LGALDDSGKLTPLGKQ--------MSLLPLDPRLARMLLTAPEGGCLGEAATI 489

Length = 845
>gnl|CDD|233660 TIGR01970, DEAH_box_HrpB, ATP-dependent helicase HrpB Back     alignment and domain information
>gnl|CDD|233659 TIGR01967, DEAH_box_HrpA, ATP-dependent helicase HrpA Back     alignment and domain information
>gnl|CDD|182986 PRK11131, PRK11131, ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>gnl|CDD|236950 PRK11664, PRK11664, ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>gnl|CDD|238005 cd00046, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|214692 smart00487, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|177443 PHA02653, PHA02653, RNA helicase NPH-II; Provisional Back     alignment and domain information
>gnl|CDD|233659 TIGR01967, DEAH_box_HrpA, ATP-dependent helicase HrpA Back     alignment and domain information
>gnl|CDD|182986 PRK11131, PRK11131, ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>gnl|CDD|197757 smart00490, HELICc, helicase superfamily c-terminal domain Back     alignment and domain information
>gnl|CDD|201125 pfam00271, Helicase_C, Helicase conserved C-terminal domain Back     alignment and domain information
>gnl|CDD|238034 cd00079, HELICc, Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>gnl|CDD|215832 pfam00270, DEAD, DEAD/DEAH box helicase Back     alignment and domain information
>gnl|CDD|223587 COG0513, SrmB, Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|227416 COG5084, YTH1, Cleavage and polyadenylation specificity factor (CPSF) Clipper subunit and related makorin family Zn-finger proteins [General function prediction only] Back     alignment and domain information
>gnl|CDD|214632 smart00356, ZnF_C3H1, zinc finger Back     alignment and domain information
>gnl|CDD|224036 COG1111, MPH1, ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 957
KOG0923902 consensus mRNA splicing factor ATP-dependent RNA h 100.0
KOG0922674 consensus DEAH-box RNA helicase [RNA processing an 100.0
KOG0925699 consensus mRNA splicing factor ATP-dependent RNA h 100.0
KOG09241042 consensus mRNA splicing factor ATP-dependent RNA h 100.0
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 100.0
KOG0920924 consensus ATP-dependent RNA helicase A [RNA proces 100.0
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 100.0
COG1643845 HrpA HrpA-like helicases [DNA replication, recombi 100.0
KOG09261172 consensus DEAH-box RNA helicase [RNA processing an 100.0
TIGR01970819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 100.0
PRK11664812 ATP-dependent RNA helicase HrpB; Provisional 100.0
KOG09211282 consensus Dosage compensation complex, subunit MLE 100.0
PHA02653675 RNA helicase NPH-II; Provisional 100.0
PRK01172674 ski2-like helicase; Provisional 100.0
PRK02362737 ski2-like helicase; Provisional 100.0
KOG0331519 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0330476 consensus ATP-dependent RNA helicase [RNA processi 100.0
PRK00254720 ski2-like helicase; Provisional 100.0
PRK11776460 ATP-dependent RNA helicase DbpA; Provisional 100.0
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 100.0
PTZ00110545 helicase; Provisional 100.0
PRK11192434 ATP-dependent RNA helicase SrmB; Provisional 100.0
PRK10590456 ATP-dependent RNA helicase RhlE; Provisional 100.0
COG0513513 SrmB Superfamily II DNA and RNA helicases [DNA rep 100.0
PLN00206518 DEAD-box ATP-dependent RNA helicase; Provisional 100.0
PRK11634629 ATP-dependent RNA helicase DeaD; Provisional 100.0
PRK04537572 ATP-dependent RNA helicase RhlB; Provisional 100.0
PTZ00424401 helicase 45; Provisional 100.0
PRK01297475 ATP-dependent RNA helicase RhlB; Provisional 100.0
KOG0345567 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0333673 consensus U5 snRNP-like RNA helicase subunit [RNA 100.0
KOG0342543 consensus ATP-dependent RNA helicase pitchoune [RN 100.0
TIGR00614470 recQ_fam ATP-dependent DNA helicase, RecQ family. 100.0
KOG0338691 consensus ATP-dependent RNA helicase [RNA processi 100.0
COG1204766 Superfamily II helicase [General function predicti 100.0
KOG0340442 consensus ATP-dependent RNA helicase [RNA processi 99.98
PLN031371195 ATP-dependent DNA helicase; Q4-like; Provisional 99.98
KOG0343758 consensus RNA Helicase [RNA processing and modific 99.98
PRK11057607 ATP-dependent DNA helicase RecQ; Provisional 99.98
KOG0328400 consensus Predicted ATP-dependent RNA helicase FAL 99.97
TIGR03817742 DECH_helic helicase/secretion neighborhood putativ 99.97
COG1202830 Superfamily II helicase, archaea-specific [General 99.97
PRK13767876 ATP-dependent helicase; Provisional 99.97
KOG0339731 consensus ATP-dependent RNA helicase [RNA processi 99.97
KOG0335482 consensus ATP-dependent RNA helicase [RNA processi 99.97
TIGR01389591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 99.97
KOG0336629 consensus ATP-dependent RNA helicase [RNA processi 99.97
KOG0348708 consensus ATP-dependent RNA helicase [RNA processi 99.97
COG1111542 MPH1 ERCC4-like helicases [DNA replication, recomb 99.97
KOG0332477 consensus ATP-dependent RNA helicase [RNA processi 99.96
TIGR00580926 mfd transcription-repair coupling factor (mfd). Al 99.96
KOG0347731 consensus RNA helicase [RNA processing and modific 99.96
PRK10917681 ATP-dependent DNA helicase RecG; Provisional 99.96
COG1201814 Lhr Lhr-like helicases [General function predictio 99.96
TIGR00643630 recG ATP-dependent DNA helicase RecG. 99.96
KOG0952 1230 consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup 99.96
KOG0341610 consensus DEAD-box protein abstrakt [RNA processin 99.96
KOG0326459 consensus ATP-dependent RNA helicase [RNA processi 99.96
PRK106891147 transcription-repair coupling factor; Provisional 99.96
TIGR01587358 cas3_core CRISPR-associated helicase Cas3. This mo 99.95
TIGR02621844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 99.95
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 99.95
KOG0350620 consensus DEAD-box ATP-dependent RNA helicase [RNA 99.95
COG0514590 RecQ Superfamily II DNA helicase [DNA replication, 99.95
KOG0354746 consensus DEAD-box like helicase [General function 99.94
KOG4284980 consensus DEAD box protein [Transcription] 99.94
PHA02558501 uvsW UvsW helicase; Provisional 99.94
KOG0346569 consensus RNA helicase [RNA processing and modific 99.93
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. 99.93
KOG0334997 consensus RNA helicase [RNA processing and modific 99.93
PRK13766773 Hef nuclease; Provisional 99.93
KOG0344593 consensus ATP-dependent RNA helicase [RNA processi 99.93
KOG09481041 consensus Nuclear exosomal RNA helicase MTR4, DEAD 99.93
KOG0327397 consensus Translation initiation factor 4F, helica 99.92
KOG09471248 consensus Cytoplasmic exosomal RNA helicase SKI2, 99.91
KOG0951 1674 consensus RNA helicase BRR2, DEAD-box superfamily 99.91
TIGR00603732 rad25 DNA repair helicase rad25. All proteins in t 99.91
KOG0352641 consensus ATP-dependent DNA helicase [Replication, 99.9
KOG0337529 consensus ATP-dependent RNA helicase [RNA processi 99.9
COG45811041 Superfamily II RNA helicase [DNA replication, reco 99.9
PRK09401 1176 reverse gyrase; Reviewed 99.9
PRK05580679 primosome assembly protein PriA; Validated 99.89
COG1205851 Distinct helicase family with a unique C-terminal 99.89
PRK14701 1638 reverse gyrase; Provisional 99.89
TIGR03714762 secA2 accessory Sec system translocase SecA2. Memb 99.88
COG1200677 RecG RecG-like helicase [DNA replication, recombin 99.88
COG4098441 comFA Superfamily II DNA/RNA helicase required for 99.87
TIGR00595505 priA primosomal protein N'. All proteins in this f 99.87
PRK09694878 helicase Cas3; Provisional 99.87
KOG0351941 consensus ATP-dependent DNA helicase [Replication, 99.86
PRK12898656 secA preprotein translocase subunit SecA; Reviewed 99.86
COG1061442 SSL2 DNA or RNA helicases of superfamily II [Trans 99.86
PRK09200790 preprotein translocase subunit SecA; Reviewed 99.86
COG11971139 Mfd Transcription-repair coupling factor (superfam 99.85
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 99.85
TIGR00963745 secA preprotein translocase, SecA subunit. The pro 99.85
PRK114481123 hsdR type I restriction enzyme EcoKI subunit R; Pr 99.82
KOG09501008 consensus DNA polymerase theta/eta, DEAD-box super 99.8
KOG09211282 consensus Dosage compensation complex, subunit MLE 99.79
PRK04914956 ATP-dependent helicase HepA; Validated 99.77
KOG0329387 consensus ATP-dependent RNA helicase [RNA processi 99.73
COG1203733 CRISPR-associated helicase Cas3 [Defense mechanism 99.73
PRK13104896 secA preprotein translocase subunit SecA; Reviewed 99.71
KOG0353695 consensus ATP-dependent DNA helicase [General func 99.7
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 99.68
PRK12906796 secA preprotein translocase subunit SecA; Reviewed 99.68
KOG0349725 consensus Putative DEAD-box RNA helicase DDX1 [RNA 99.67
PRK12904830 preprotein translocase subunit SecA; Reviewed 99.66
COG4096875 HsdR Type I site-specific restriction-modification 99.64
KOG09491330 consensus Predicted helicase, DEAD-box superfamily 99.63
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 99.57
COG1198730 PriA Primosomal protein N' (replication factor Y) 99.57
TIGR00348667 hsdR type I site-specific deoxyribonuclease, HsdR 99.56
PRK13107908 preprotein translocase subunit SecA; Reviewed 99.56
KOG0953700 consensus Mitochondrial RNA helicase SUV3, DEAD-bo 99.55
PRK12899970 secA preprotein translocase subunit SecA; Reviewed 99.53
PLN031421033 Probable chromatin-remodeling complex ATPase chain 99.5
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 99.46
PF04408102 HA2: Helicase associated domain (HA2); InterPro: I 99.43
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 99.43
TIGR01407850 dinG_rel DnaQ family exonuclease/DinG family helic 99.41
smart00487201 DEXDc DEAD-like helicases superfamily. 99.41
TIGR025621110 cas3_yersinia CRISPR-associated helicase Cas3. The 99.35
smart0084792 HA2 Helicase associated domain (HA2) Add an annota 99.32
cd00079131 HELICc Helicase superfamily c-terminal domain; ass 99.29
KOG1123776 consensus RNA polymerase II transcription initiati 99.28
PF04851184 ResIII: Type III restriction enzyme, res subunit; 99.26
TIGR00631655 uvrb excinuclease ABC, B subunit. This family is b 99.25
KOG41501034 consensus Predicted ATP-dependent RNA helicase [RN 99.24
PF0027178 Helicase_C: Helicase conserved C-terminal domain; 99.21
PRK129001025 secA preprotein translocase subunit SecA; Reviewed 99.21
PRK05298652 excinuclease ABC subunit B; Provisional 99.19
PRK12326764 preprotein translocase subunit SecA; Reviewed 99.18
PF07652148 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR 99.16
PRK13103913 secA preprotein translocase subunit SecA; Reviewed 99.1
KOG0385971 consensus Chromatin remodeling complex WSTF-ISWI, 99.09
KOG0387923 consensus Transcription-coupled repair protein CSB 99.08
PF02399824 Herpes_ori_bp: Origin of replication binding prote 99.07
PRK07246820 bifunctional ATP-dependent DNA helicase/DNA polyme 99.06
KOG09511674 consensus RNA helicase BRR2, DEAD-box superfamily 99.01
smart0049082 HELICc helicase superfamily c-terminal domain. 98.99
PRK08074928 bifunctional ATP-dependent DNA helicase/DNA polyme 98.94
PRK12903925 secA preprotein translocase subunit SecA; Reviewed 98.92
CHL00122870 secA preprotein translocase subunit SecA; Validate 98.91
COG0556663 UvrB Helicase subunit of the DNA excision repair c 98.85
PRK14873665 primosome assembly protein PriA; Provisional 98.77
COG4889 1518 Predicted helicase [General function prediction on 98.75
KOG0390776 consensus DNA repair protein, SNF2 family [Replica 98.74
PRK12902939 secA preprotein translocase subunit SecA; Reviewed 98.73
KOG03841373 consensus Chromodomain-helicase DNA-binding protei 98.68
TIGR03117636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 98.68
KOG1000689 consensus Chromatin remodeling protein HARP/SMARCA 98.51
KOG1040325 consensus Polyadenylation factor I complex, subuni 98.35
KOG1677332 consensus CCCH-type Zn-finger protein [General fun 98.31
KOG03921549 consensus SNF2 family DNA-dependent ATPase domain- 98.24
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 97.98
KOG0389941 consensus SNF2 family DNA-dependent ATPase [Chroma 97.97
COG5084285 YTH1 Cleavage and polyadenylation specificity fact 97.97
PF00176299 SNF2_N: SNF2 family N-terminal domain; InterPro: I 97.94
KOG3702681 consensus Nuclear polyadenylated RNA binding prote 97.94
COG0610962 Type I site-specific restriction-modification syst 97.9
TIGR00596814 rad1 DNA repair protein (rad1). This family is bas 97.89
PF0064227 zf-CCCH: Zinc finger C-x8-C-x5-C-x3-H type (and si 97.89
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 97.87
KOG1763343 consensus Uncharacterized conserved protein, conta 97.78
PF0064227 zf-CCCH: Zinc finger C-x8-C-x5-C-x3-H type (and si 97.78
COG5063351 CTH1 CCCH-type Zn-finger protein [General function 97.76
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 97.74
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 97.68
KOG1492377 consensus C3H1-type Zn-finger protein [General fun 97.68
smart0035627 ZnF_C3H1 zinc finger. 97.66
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 97.65
PRK10875615 recD exonuclease V subunit alpha; Provisional 97.59
smart00489289 DEXDc3 DEAD-like helicases superfamily. 97.57
smart00488289 DEXDc2 DEAD-like helicases superfamily. 97.57
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 97.57
KOG1492377 consensus C3H1-type Zn-finger protein [General fun 97.56
TIGR01447586 recD exodeoxyribonuclease V, alpha subunit. This f 97.56
PRK129011112 secA preprotein translocase subunit SecA; Reviewed 97.56
KOG1002791 consensus Nucleotide excision repair protein RAD16 97.53
KOG2494331 consensus C3H1-type Zn-finger protein [Transcripti 97.5
PF1324576 AAA_19: Part of AAA domain 97.5
PRK10536262 hypothetical protein; Provisional 97.49
KOG03861157 consensus Chromatin remodeling complex SWI/SNF, co 97.43
TIGR01448720 recD_rel helicase, putative, RecD/TraA family. Thi 97.42
KOG1040325 consensus Polyadenylation factor I complex, subuni 97.39
TIGR02768744 TraA_Ti Ti-type conjugative transfer relaxase TraA 97.37
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 97.36
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 97.31
PF09848352 DUF2075: Uncharacterized conserved protein (DUF207 97.27
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 97.26
COG0653822 SecA Preprotein translocase subunit SecA (ATPase, 97.24
PRK06526254 transposase; Provisional 97.14
smart0035627 ZnF_C3H1 zinc finger. 97.12
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 97.11
PRK11747697 dinG ATP-dependent DNA helicase DinG; Provisional 97.06
COG5252299 Uncharacterized conserved protein, contains CCCH-t 97.06
smart00382148 AAA ATPases associated with a variety of cellular 97.02
PF06862442 DUF1253: Protein of unknown function (DUF1253); In 97.02
KOG1595528 consensus CCCH-type Zn-finger protein [General fun 97.01
PRK04296190 thymidine kinase; Provisional 96.99
PRK14974336 cell division protein FtsY; Provisional 96.97
KOG03911958 consensus SNF2 family DNA-dependent ATPase [Genera 96.93
PRK13889988 conjugal transfer relaxase TraA; Provisional 96.92
PF05970364 PIF1: PIF1-like helicase; InterPro: IPR010285 This 96.91
PRK15483986 type III restriction-modification system StyLTI en 96.87
COG1199654 DinG Rad3-related DNA helicases [Transcription / D 96.86
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 96.85
PF13872303 AAA_34: P-loop containing NTP hydrolase pore-1 96.85
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 96.84
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 96.82
PRK08181269 transposase; Validated 96.79
PF07517266 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011 96.73
KOG2340698 consensus Uncharacterized conserved protein [Funct 96.71
PRK138261102 Dtr system oriT relaxase; Provisional 96.7
PRK14723767 flhF flagellar biosynthesis regulator FlhF; Provis 96.69
KOG09521230 consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup 96.62
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 96.62
PRK14721420 flhF flagellar biosynthesis regulator FlhF; Provis 96.55
PF13173128 AAA_14: AAA domain 96.53
KOG2333 614 consensus Uncharacterized conserved protein [Gener 96.53
PRK06835329 DNA replication protein DnaC; Validated 96.43
COG5084285 YTH1 Cleavage and polyadenylation specificity fact 96.41
PF1460819 zf-CCCH_2: Zinc finger C-x8-C-x5-C-x3-H type 96.4
PF1460819 zf-CCCH_2: Zinc finger C-x8-C-x5-C-x3-H type 96.38
PRK08727233 hypothetical protein; Validated 96.31
COG1875436 NYN ribonuclease and ATPase of PhoH family domains 96.3
PF05127177 Helicase_RecD: Helicase; InterPro: IPR007807 This 96.21
PF05729166 NACHT: NACHT domain 96.2
PF13307167 Helicase_C_2: Helicase C-terminal domain; PDB: 4A1 96.16
PRK05642234 DNA replication initiation factor; Validated 96.11
PRK07003830 DNA polymerase III subunits gamma and tau; Validat 96.1
PRK08116268 hypothetical protein; Validated 96.04
PRK07952244 DNA replication protein DnaC; Validated 96.02
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 96.0
COG5063351 CTH1 CCCH-type Zn-finger protein [General function 95.99
PRK06893229 DNA replication initiation factor; Validated 95.95
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Valida 95.94
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 95.93
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 95.93
PRK14956484 DNA polymerase III subunits gamma and tau; Provisi 95.92
KOG1802935 consensus RNA helicase nonsense mRNA reducing fact 95.89
TIGR00376637 DNA helicase, putative. The gene product may repre 95.87
TIGR00604705 rad3 DNA repair helicase (rad3). All proteins in t 95.86
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [P 95.83
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 95.82
PTZ001121164 origin recognition complex 1 protein; Provisional 95.78
TIGR02782299 TrbB_P P-type conjugative transfer ATPase TrbB. Th 95.78
PRK00411394 cdc6 cell division control protein 6; Reviewed 95.77
PF00580315 UvrD-helicase: UvrD/REP helicase N-terminal domain 95.76
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 95.73
KOG03881185 consensus SNF2 family DNA-dependent ATPase [Replic 95.71
COG2804500 PulE Type II secretory pathway, ATPase PulE/Tfp pi 95.71
PRK10416318 signal recognition particle-docking protein FtsY; 95.7
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 95.69
KOG1595528 consensus CCCH-type Zn-finger protein [General fun 95.64
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 95.58
PRK08084235 DNA replication initiation factor; Provisional 95.56
PRK13894319 conjugal transfer ATPase TrbB; Provisional 95.54
PRK14949944 DNA polymerase III subunits gamma and tau; Provisi 95.53
KOG2185 486 consensus Predicted RNA-processing protein, contai 95.51
PRK00771437 signal recognition particle protein Srp54; Provisi 95.5
PRK07994647 DNA polymerase III subunits gamma and tau; Validat 95.48
PHA00729226 NTP-binding motif containing protein 95.45
PRK12323700 DNA polymerase III subunits gamma and tau; Provisi 95.44
KOG4791 667 consensus Uncharacterized conserved protein [Funct 95.39
PRK14964491 DNA polymerase III subunits gamma and tau; Provisi 95.39
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 95.35
KOG2185 486 consensus Predicted RNA-processing protein, contai 95.32
PRK06921266 hypothetical protein; Provisional 95.31
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 95.31
TIGR02760 1960 TraI_TIGR conjugative transfer relaxase protein Tr 95.28
PRK14960702 DNA polymerase III subunits gamma and tau; Provisi 95.27
PRK09111598 DNA polymerase III subunits gamma and tau; Validat 95.27
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 95.22
PRK14958509 DNA polymerase III subunits gamma and tau; Provisi 95.17
TIGR02928365 orc1/cdc6 family replication initiation protein. M 95.17
PHA02244383 ATPase-like protein 95.15
PRK14957546 DNA polymerase III subunits gamma and tau; Provisi 95.13
PRK09183259 transposase/IS protein; Provisional 95.11
PF12340229 DUF3638: Protein of unknown function (DUF3638); In 95.08
PRK08691709 DNA polymerase III subunits gamma and tau; Validat 95.07
KOG1677332 consensus CCCH-type Zn-finger protein [General fun 95.07
PF00004132 AAA: ATPase family associated with various cellula 95.06
COG1444758 Predicted P-loop ATPase fused to an acetyltransfer 95.06
PHA03333752 putative ATPase subunit of terminase; Provisional 95.02
PRK06645507 DNA polymerase III subunits gamma and tau; Validat 95.01
COG1484254 DnaC DNA replication protein [DNA replication, rec 94.98
TIGR00064272 ftsY signal recognition particle-docking protein F 94.97
PRK13833323 conjugal transfer protein TrbB; Provisional 94.96
PRK09112351 DNA polymerase III subunit delta'; Validated 94.94
PRK13851344 type IV secretion system protein VirB11; Provision 94.92
PRK12377248 putative replication protein; Provisional 94.9
PRK08903227 DnaA regulatory inactivator Hda; Validated 94.89
PRK08939306 primosomal protein DnaI; Reviewed 94.87
PRK12402337 replication factor C small subunit 2; Reviewed 94.86
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 94.83
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 94.8
PRK14088440 dnaA chromosomal replication initiation protein; P 94.76
PRK14969527 DNA polymerase III subunits gamma and tau; Provisi 94.74
PRK12422445 chromosomal replication initiation protein; Provis 94.71
CHL00181287 cbbX CbbX; Provisional 94.67
KOG1803649 consensus DNA helicase [Replication, recombination 94.65
PRK07764824 DNA polymerase III subunits gamma and tau; Validat 94.65
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 94.62
PRK00149450 dnaA chromosomal replication initiation protein; R 94.54
TIGR02788308 VirB11 P-type DNA transfer ATPase VirB11. The VirB 94.52
KOG0989346 consensus Replication factor C, subunit RFC4 [Repl 94.51
KOG2228408 consensus Origin recognition complex, subunit 4 [R 94.49
PRK11331459 5-methylcytosine-specific restriction enzyme subun 94.43
KOG4791 667 consensus Uncharacterized conserved protein [Funct 94.42
PRK14086617 dnaA chromosomal replication initiation protein; P 94.41
PRK14952584 DNA polymerase III subunits gamma and tau; Provisi 94.36
COG1702348 PhoH Phosphate starvation-inducible protein PhoH, 94.3
PRK09087226 hypothetical protein; Validated 94.23
PTZ00293211 thymidine kinase; Provisional 94.23
TIGR027601960 TraI_TIGR conjugative transfer relaxase protein Tr 94.22
PRK147121623 conjugal transfer nickase/helicase TraI; Provision 94.19
TIGR00362405 DnaA chromosomal replication initiator protein Dna 94.13
PLN03025319 replication factor C subunit; Provisional 94.1
KOG18051100 consensus DNA replication helicase [Replication, r 94.06
PRK14951618 DNA polymerase III subunits gamma and tau; Provisi 94.02
PRK14962472 DNA polymerase III subunits gamma and tau; Provisi 94.01
KOG2373514 consensus Predicted mitochondrial DNA helicase twi 93.9
TIGR01650327 PD_CobS cobaltochelatase, CobS subunit. This model 93.87
COG0553866 HepA Superfamily II DNA/RNA helicases, SNF2 family 93.86
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 93.81
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 93.78
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 93.74
PRK07133725 DNA polymerase III subunits gamma and tau; Validat 93.73
PRK14959624 DNA polymerase III subunits gamma and tau; Provisi 93.73
PRK04841903 transcriptional regulator MalT; Provisional 93.67
KOG2494331 consensus C3H1-type Zn-finger protein [Transcripti 93.64
PRK137091747 conjugal transfer nickase/helicase TraI; Provision 93.64
PF00437270 T2SE: Type II/IV secretion system protein; InterPr 93.62
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 93.6
PHA02533534 17 large terminase protein; Provisional 93.59
PHA02544316 44 clamp loader, small subunit; Provisional 93.55
PRK14950585 DNA polymerase III subunits gamma and tau; Provisi 93.54
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 93.53
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 93.51
KOG0741744 consensus AAA+-type ATPase [Posttranslational modi 93.48
PRK10436462 hypothetical protein; Provisional 93.41
cd03115173 SRP The signal recognition particle (SRP) mediates 93.34
PRK00440319 rfc replication factor C small subunit; Reviewed 93.29
PRK14965576 DNA polymerase III subunits gamma and tau; Provisi 93.26
PRK10867433 signal recognition particle protein; Provisional 93.21
PRK14953486 DNA polymerase III subunits gamma and tau; Provisi 93.19
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 93.19
PF10354166 DUF2431: Domain of unknown function (DUF2431); Int 93.14
COG2256436 MGS1 ATPase related to the helicase subunit of the 93.11
PRK08451535 DNA polymerase III subunits gamma and tau; Validat 93.04
COG5152259 Uncharacterized conserved protein, contains RING a 93.04
PRK05896605 DNA polymerase III subunits gamma and tau; Validat 93.02
PRK14948620 DNA polymerase III subunits gamma and tau; Provisi 92.99
KOG1132945 consensus Helicase of the DEAD superfamily [Replic 92.94
COG2909894 MalT ATP-dependent transcriptional regulator [Tran 92.94
PF01443234 Viral_helicase1: Viral (Superfamily 1) RNA helicas 92.91
TIGR02533486 type_II_gspE general secretory pathway protein E. 92.87
PRK13900332 type IV secretion system ATPase VirB11; Provisiona 92.86
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 92.83
TIGR03819340 heli_sec_ATPase helicase/secretion neighborhood AT 92.83
PRK14087450 dnaA chromosomal replication initiation protein; P 92.83
PF03266168 NTPase_1: NTPase; InterPro: IPR004948 This entry r 92.81
PRK04195482 replication factor C large subunit; Provisional 92.74
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 92.67
COG2255332 RuvB Holliday junction resolvasome, helicase subun 92.54
PRK05707328 DNA polymerase III subunit delta'; Validated 92.48
PRK05563559 DNA polymerase III subunits gamma and tau; Validat 92.46
TIGR02538564 type_IV_pilB type IV-A pilus assembly ATPase PilB. 92.44
PRK14963504 DNA polymerase III subunits gamma and tau; Provisi 92.39
PRK05342412 clpX ATP-dependent protease ATP-binding subunit Cl 92.37
TIGR02688449 conserved hypothetical protein TIGR02688. Members 92.37
PRK14954620 DNA polymerase III subunits gamma and tau; Provisi 92.31
CHL00176638 ftsH cell division protein; Validated 92.25
COG2805353 PilT Tfp pilus assembly protein, pilus retraction 92.24
PRK06620214 hypothetical protein; Validated 92.19
TIGR00959428 ffh signal recognition particle protein. This mode 92.14
PRK14970367 DNA polymerase III subunits gamma and tau; Provisi 92.12
PF1355562 AAA_29: P-loop containing region of AAA domain 92.03
KOG10151567 consensus Transcription regulator XNP/ATRX, DEAD-b 92.02
COG3587985 Restriction endonuclease [Defense mechanisms] 92.0
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 91.96
KOG0745564 consensus Putative ATP-dependent Clp-type protease 91.91
PRK11747697 dinG ATP-dependent DNA helicase DinG; Provisional 91.87
COG4962355 CpaF Flp pilus assembly protein, ATPase CpaF [Intr 91.87
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 91.81
TIGR00604705 rad3 DNA repair helicase (rad3). All proteins in t 91.75
cd01124187 KaiC KaiC is a circadian clock protein primarily f 91.69
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 91.64
TIGR02785 1232 addA_Gpos recombination helicase AddA, Firmicutes 91.63
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 91.45
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 91.38
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 91.25
PRK07471365 DNA polymerase III subunit delta'; Validated 91.21
COG0470325 HolB ATPase involved in DNA replication [DNA repli 91.21
TIGR02524358 dot_icm_DotB Dot/Icm secretion system ATPase DotB. 91.2
PRK13342413 recombination factor protein RarA; Reviewed 91.2
PRK07940394 DNA polymerase III subunit delta'; Validated 91.05
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 90.73
KOG2543438 consensus Origin recognition complex, subunit 5 [R 90.69
cd03239178 ABC_SMC_head The structural maintenance of chromos 90.66
PRK08769319 DNA polymerase III subunit delta'; Validated 90.63
COG0552340 FtsY Signal recognition particle GTPase [Intracell 90.56
KOG1039 344 consensus Predicted E3 ubiquitin ligase [Posttrans 90.55
KOG4439901 consensus RNA polymerase II transcription terminat 90.54
PRK13341725 recombination factor protein RarA/unknown domain f 90.49
PRK06647563 DNA polymerase III subunits gamma and tau; Validat 90.48
PHA03368738 DNA packaging terminase subunit 1; Provisional 90.45
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 90.4
TIGR02858270 spore_III_AA stage III sporulation protein AA. Mem 90.39
COG1199654 DinG Rad3-related DNA helicases [Transcription / D 90.3
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 90.26
PRK14971614 DNA polymerase III subunits gamma and tau; Provisi 90.23
PRK11823446 DNA repair protein RadA; Provisional 90.14
KOG0391 1958 consensus SNF2 family DNA-dependent ATPase [Genera 90.08
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 90.08
cd00544169 CobU Adenosylcobinamide kinase / adenosylcobinamid 90.03
COG0541451 Ffh Signal recognition particle GTPase [Intracellu 89.98
COG5152259 Uncharacterized conserved protein, contains RING a 89.96
PRK07399314 DNA polymerase III subunit delta'; Validated 89.95
PRK06067234 flagellar accessory protein FlaH; Validated 89.9
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 89.88
COG0466782 Lon ATP-dependent Lon protease, bacterial type [Po 89.76
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 89.74
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 89.7
cd03216163 ABC_Carb_Monos_I This family represents the domain 89.56
PRK11054684 helD DNA helicase IV; Provisional 89.51
cd03281213 ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS 89.47
TIGR01241495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 89.37
PRK10865857 protein disaggregation chaperone; Provisional 89.36
COG1126240 GlnQ ABC-type polar amino acid transport system, A 89.35
KOG1763343 consensus Uncharacterized conserved protein, conta 89.27
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 89.27
PF14617252 CMS1: U3-containing 90S pre-ribosomal complex subu 89.22
COG2812515 DnaX DNA polymerase III, gamma/tau subunits [DNA r 89.18
COG1618179 Predicted nucleotide kinase [Nucleotide transport 89.16
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 89.15
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 89.12
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 89.1
PRK06305451 DNA polymerase III subunits gamma and tau; Validat 89.04
PF00265176 TK: Thymidine kinase; InterPro: IPR001267 Thymidin 88.99
PLN00020413 ribulose bisphosphate carboxylase/oxygenase activa 88.97
PRK10787784 DNA-binding ATP-dependent protease La; Provisional 88.96
cd03246173 ABCC_Protease_Secretion This family represents the 88.95
PRK129001025 secA preprotein translocase subunit SecA; Reviewed 88.92
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 88.85
TIGR00763775 lon ATP-dependent protease La. This protein is ind 88.84
COG0556663 UvrB Helicase subunit of the DNA excision repair c 88.8
PRK10919672 ATP-dependent DNA helicase Rep; Provisional 88.75
COG1435201 Tdk Thymidine kinase [Nucleotide transport and met 88.68
PRK08699325 DNA polymerase III subunit delta'; Validated 88.61
COG0396251 sufC Cysteine desulfurase activator ATPase [Posttr 88.42
TIGR00382413 clpX endopeptidase Clp ATP-binding regulatory subu 88.41
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 88.21
PRK06964342 DNA polymerase III subunit delta'; Validated 88.19
PF03354477 Terminase_1: Phage Terminase ; InterPro: IPR005021 88.16
TIGR02525372 plasmid_TraJ plasmid transfer ATPase TraJ. Members 88.13
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 88.11
PF1065023 zf-C3H1: Putative zinc-finger domain; InterPro: IP 88.07
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 88.05
PF02367123 UPF0079: Uncharacterised P-loop hydrolase UPF0079; 88.0
TIGR02868529 CydC thiol reductant ABC exporter, CydC subunit. T 87.97
PRK06871325 DNA polymerase III subunit delta'; Validated 87.82
cd03243202 ABC_MutS_homologs The MutS protein initiates DNA m 87.82
COG1136226 SalX ABC-type antimicrobial peptide transport syst 87.63
TIGR00602637 rad24 checkpoint protein rad24. This family is bas 87.58
cd03215182 ABC_Carb_Monos_II This family represents domain II 87.5
KOG2004906 consensus Mitochondrial ATP-dependent protease PIM 87.5
TIGR01420343 pilT_fam pilus retraction protein PilT. This model 87.47
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 87.45
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r 87.39
COG0593408 DnaA ATPase involved in DNA replication initiation 87.34
cd01393226 recA_like RecA is a bacterial enzyme which has rol 87.31
KOG0349725 consensus Putative DEAD-box RNA helicase DDX1 [RNA 87.23
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 87.18
PRK129011112 secA preprotein translocase subunit SecA; Reviewed 87.13
cd03282204 ABC_MSH4_euk MutS4 homolog in eukaryotes. The MutS 87.1
KOG1039 344 consensus Predicted E3 ubiquitin ligase [Posttrans 87.08
PF12775272 AAA_7: P-loop containing dynein motor region D3; P 87.04
PRK13695174 putative NTPase; Provisional 86.9
COG0630312 VirB11 Type IV secretory pathway, VirB11 component 86.87
TIGR00767415 rho transcription termination factor Rho. Members 86.86
COG3973747 Superfamily I DNA and RNA helicases [General funct 86.74
COG3267269 ExeA Type II secretory pathway, component ExeA (pr 86.7
COG5008375 PilU Tfp pilus assembly protein, ATPase PilU [Cell 86.69
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 86.63
KOG0737386 consensus AAA+-type ATPase [Posttranslational modi 86.62
PRK10865857 protein disaggregation chaperone; Provisional 86.5
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 86.48
PF12846304 AAA_10: AAA-like domain 86.41
PRK03992389 proteasome-activating nucleotidase; Provisional 86.39
PRK09354349 recA recombinase A; Provisional 86.15
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 86.01
PF06745226 KaiC: KaiC; InterPro: IPR014774 This entry represe 85.93
TIGR03263180 guanyl_kin guanylate kinase. Members of this famil 85.88
PRK05564313 DNA polymerase III subunit delta'; Validated 85.88
CHL00095821 clpC Clp protease ATP binding subunit 85.75
TIGR01074664 rep ATP-dependent DNA helicase Rep. Designed to id 85.73
PRK08058329 DNA polymerase III subunit delta'; Validated 85.6
>KOG0923 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information 
Probab=100.00  E-value=7.2e-118  Score=987.80  Aligned_cols=589  Identities=27%  Similarity=0.389  Sum_probs=522.7

Q ss_pred             CccccCCCCchHHHHHHHHHHHcCCeEEEEcCCCCcHHHHHHHHHHhcCCC----cEEEeccHHHHHHHHHHHHHhhcCC
Q 002165           19 TSPEFSSLPVMSLREKIVEKVLENRVTLIVGETGCGKSSQVPQFLLAENME----PILCTQPRRFAVVAVAKMVAKGRNC   94 (957)
Q Consensus        19 ~~~~r~~LPi~~~Q~~il~~l~~~~~vII~a~TGSGKTt~lp~~lle~~~~----~Iivt~Prrlaa~~va~rva~e~~~   94 (957)
                      ++..|+.|||++++++++.++.+++++||.|+||||||||+||||.|.|+.    +|.||||||+||+++|.||++|+|+
T Consensus       257 iee~RksLPVy~ykdell~av~e~QVLiI~GeTGSGKTTQiPQyL~EaGytk~gk~IgcTQPRRVAAmSVAaRVA~EMgv  336 (902)
T KOG0923|consen  257 IEEVRKSLPVYPYKDELLKAVKEHQVLIIVGETGSGKTTQIPQYLYEAGYTKGGKKIGCTQPRRVAAMSVAARVAEEMGV  336 (902)
T ss_pred             HHHHHhcCCchhhHHHHHHHHHhCcEEEEEcCCCCCccccccHHHHhcccccCCceEeecCcchHHHHHHHHHHHHHhCc
Confidence            334589999999999999999999999999999999999999999999873    4999999999999999999999999


Q ss_pred             ccCCeeEEeeecccccCCCCcEEEEcHHHHHHHHHccCCCcCcceEEEEcccccccccccHHHHHHHHHHhcCCCceEEE
Q 002165           95 ELGGEVGYHIGHSKHLSERSKIVFKTAGVLLDEMRDRGLNALKYKVIILDEVHERSVESDLVLVCVKQLLLKKNDLRVVL  174 (957)
Q Consensus        95 ~lg~~Vgy~v~~~~~~~~~t~Ivv~T~g~Ll~~l~~~~l~l~~~~~VIIDEaHER~~~~d~ll~~lk~l~~~~~~lklIl  174 (957)
                      .+|..|||+|||+++++.+|.|.|||+|||+++++.++ .+..|++|||||||||++.+|+|.+++|.+...||++|+++
T Consensus       337 kLG~eVGYsIRFEdcTSekTvlKYMTDGmLlREfL~ep-dLasYSViiiDEAHERTL~TDILfgLvKDIar~RpdLKllI  415 (902)
T KOG0923|consen  337 KLGHEVGYSIRFEDCTSEKTVLKYMTDGMLLREFLSEP-DLASYSVIIVDEAHERTLHTDILFGLVKDIARFRPDLKLLI  415 (902)
T ss_pred             ccccccceEEEeccccCcceeeeeecchhHHHHHhccc-cccceeEEEeehhhhhhhhhhHHHHHHHHHHhhCCcceEEe
Confidence            99999999999999999999999999999999999876 46799999999999999999999999999999999999999


Q ss_pred             ecccCChHHHHHHHhhcCCCceeEEEEecCCCccceeeeeeehHHHHHHHhccCCCCccccccccccCCCCCCcccccCC
Q 002165          175 MSATADITKYRDYFRDLGRGERVEVLAIPSTNQRTIFQRRVSYLEQVTELLGVDHGMTSELSSLRYCSGPSPSMANAEIK  254 (957)
Q Consensus       175 mSATld~~~~~~~f~~~~~~~~v~v~~~~~~~~~~~~~v~v~yl~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  254 (957)
                      +|||+|+++|+.||++      ++++.+|+    +.|||.++|...                       +.         
T Consensus       416 sSAT~DAekFS~fFDd------apIF~iPG----RRyPVdi~Yt~~-----------------------PE---------  453 (902)
T KOG0923|consen  416 SSATMDAEKFSAFFDD------APIFRIPG----RRYPVDIFYTKA-----------------------PE---------  453 (902)
T ss_pred             eccccCHHHHHHhccC------CcEEeccC----cccceeeecccC-----------------------Cc---------
Confidence            9999999999999987      78999997    679999988542                       11         


Q ss_pred             hhHHHHHHHHHHHHHhhCCCCCCcEEEEeCCHHHHHHHHHHhc-------CCCCCcEEEEecCCCCHHHHHHHHhccc-C
Q 002165          255 PEVHKLIHDLVLHIHKNESDIEKSILVFLPTYYALEQQWHLMK-------PLSSFFKVHILHSSVDTEQALMAMKICK-S  326 (957)
Q Consensus       255 ~~~~~li~~lv~~i~~~~~~~~g~iLVFl~~~~~ie~l~~~L~-------~~~~~~~v~~lhs~l~~~er~~i~~~f~-~  326 (957)
                      .+..+.....+..||.+.+  .|+||||+++.++|+.+.+.|.       .....+-+.|+|++||.+.|..|++.-+ +
T Consensus       454 AdYldAai~tVlqIH~tqp--~GDILVFltGQeEIEt~~e~l~~~~~~LGski~eliv~PiYaNLPselQakIFePtP~g  531 (902)
T KOG0923|consen  454 ADYLDAAIVTVLQIHLTQP--LGDILVFLTGQEEIETVKENLKERCRRLGSKIRELIVLPIYANLPSELQAKIFEPTPPG  531 (902)
T ss_pred             hhHHHHHHhhheeeEeccC--CccEEEEeccHHHHHHHHHHHHHHHHHhccccceEEEeeccccCChHHHHhhcCCCCCC
Confidence            2234445577888998887  4899999999999987666554       3345678999999999999999998754 4


Q ss_pred             CceEEEEccccccCccCCCeeEEEeCCcceeeeecCCCCccccceeecCHHhHHHhcCCCCCCCCCeEEEeechhhhh-h
Q 002165          327 HRKVILATNIAESSVTIPKVAYVIDSCRSLQVFWDVNRKIDSAELVWVSQSQAEQRRGRTGRTCDGQVYRLVTKSFFG-T  405 (957)
Q Consensus       327 ~rkVlVaTniae~GIdIp~V~~VId~G~~k~~~yd~~~~~~~l~~~~iSkas~~QR~GRAGR~~~G~~~~L~s~~~~~-~  405 (957)
                      .||||+||||||+||||+||.||||+|++|++.|++.+|+++|.+.|||||++.||+|||||++||+|||||+...|. .
T Consensus       532 aRKVVLATNIAETSlTIdgI~yViDpGf~K~nsynprtGmesL~v~piSKAsA~QRaGRAGRtgPGKCfRLYt~~aY~~e  611 (902)
T KOG0923|consen  532 ARKVVLATNIAETSLTIDGIKYVIDPGFVKQNSYNPRTGMESLLVTPISKASANQRAGRAGRTGPGKCFRLYTAWAYEHE  611 (902)
T ss_pred             ceeEEEeecchhhceeecCeEEEecCccccccCcCCCcCceeEEEeeechhhhhhhccccCCCCCCceEEeechhhhhhh
Confidence            569999999999999999999999999999999999999999999999999999999999999999999999997775 6


Q ss_pred             ccCCCCCchhcCCHHHHHHHHhhhhcccCCChhHhhhcccCCCCHHHHHHHHHHHHHcCccccCCCCCCCccCHHHHHHH
Q 002165          406 LEDHECPAILRLSLRLQVLLICCAESKAISDPKVLLQKALDPPYPEVVGDALDLLDHKRALQKISPRGRYEPTFYGRLLA  485 (957)
Q Consensus       406 l~~~~~PEI~r~~L~~~iL~l~~~~~~~l~~~~~~l~~~l~pP~~~~i~~al~~L~~lgal~~~~~~g~~~lT~lG~~~a  485 (957)
                      ++..+.|||+|.||.++||.|++     +|..+.+.|+|+|||+.+++..||+.|..||||+..   |  +||.+||.|+
T Consensus       612 LE~~t~PEIqRtnL~nvVL~LkS-----LGI~Dl~~FdFmDpPp~etL~~aLE~LyaLGALn~~---G--eLTk~GrrMa  681 (902)
T KOG0923|consen  612 LEEMTVPEIQRTNLGNVVLLLKS-----LGIHDLIHFDFLDPPPTETLLKALEQLYALGALNHL---G--ELTKLGRRMA  681 (902)
T ss_pred             hccCCCcceeeccchhHHHHHHh-----cCcchhcccccCCCCChHHHHHHHHHHHHhhccccc---c--chhhhhhhhh
Confidence            88889999999999999999964     445556778999999999999999999999999984   7  6999999999


Q ss_pred             hCCCChHHHHHHHHhcccCcHHHHHHHHHHhccCCCcccCCCcchHHHHHHhcccccCCCCcccccccchhhHHHHHHHH
Q 002165          486 SFSLSFDASVLVLKFGEIGMLREGILLGILMDTQPLPILHPFGDDALFAEYTGCYFGGDGNTRLLTGRKEMVIMGNLCAF  565 (957)
Q Consensus       486 ~lpl~p~~~~~ll~~~~~~c~~e~l~iaa~ls~~~~~~~~P~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~l~~l~af  565 (957)
                      +||+||++||||+.+..++|..|+++||||||+.+.+|.+|.+++-.+|.++..|..+.||           |+..|++|
T Consensus       682 EfP~dPmlsKmi~as~ky~cs~EiitiaamlS~~~svfyrpk~~~v~ad~a~~~f~~~~gD-----------hi~~L~vy  750 (902)
T KOG0923|consen  682 EFPVDPMLSKMIVASEKYKCSEEIITIAAMLSVGASVFYRPKDKQVHADNARKNFEEPVGD-----------HIVLLNVY  750 (902)
T ss_pred             hcCCCHHHHhHHhhhccccchHHHHHHHHHHhcCchheecchhhhhhhhhhhhccCCCCcc-----------hhhhhHHH
Confidence            9999999999999999999999999999999999999999999888889999999988887           88888999


Q ss_pred             HHHHHHHhhhhhhhhhhhhhhhchhhhccccCchhhHHHHHhccCChhhHHhHHHHHHHHHHHHHhcCCcccccCCCCC-
Q 002165          566 QFWQHVFKDKQRLDHLQQVLKFDETKVTASLLPKIEEEWCSLHYLVQSSLHHVSELYEDILNAVHRFRPKFLGTSNGLP-  644 (957)
Q Consensus       566 ~~w~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~wC~~~~L~~~~l~~~~~i~~qL~~~~~r~~~~~~~~~~~~~-  644 (957)
                      +.|..                           .+.+.+||.+||+++++|.++++||+||..++.+..+..++..+... 
T Consensus       751 n~w~e---------------------------s~~s~~wC~e~~iq~~sm~rardir~qL~gll~~v~~~~~s~~~~~~~  803 (902)
T KOG0923|consen  751 NQWKE---------------------------SKYSTQWCYENFIQYRSMKRARDIRDQLEGLLERVEIDLSSNQNDLDK  803 (902)
T ss_pred             HHHhh---------------------------cchhhHHHHHhhhhHHHHHHHHHHHHHHHHHhhhccccccCChHHHHH
Confidence            99986                           45578999999999999999999999999999998877665332210 


Q ss_pred             --------CCCC-----------Ccc-------ccccccccCCCCCCCCCCccCCCCCCCCcccccccc----------C
Q 002165          645 --------TYYD-----------PYE-------FEHTCLLNCDPPRDMDPLAADNEHLGPSFEAKKCVA----------V  688 (957)
Q Consensus       645 --------~~~~-----------~~~-------~~h~~~~~~~~~~v~~~e~~~t~~~~~~~~~r~~~~----------~  688 (957)
                              .||+           ...       .-..++...+|.||+|||+|+|+    ++|||.|+.          |
T Consensus       804 irk~i~aGff~h~a~l~~~g~y~tvk~~~tv~~hp~S~l~~~~P~wvvy~eLv~ts----ke~mr~~~e~e~~Wlie~ap  879 (902)
T KOG0923|consen  804 IRKAITAGFFYHTAKLSKGGHYRTVKHPQTVSIHPNSGLFEQLPRWVVYHELVLTS----KEFMRQVIEIEEEWLIEVAP  879 (902)
T ss_pred             HHHHHhccccccceeccCCCcceeeccCcceeecCcccccccCCceEEEeehhcCh----HHHHHHHHhhhhhHHHHhch
Confidence                    1111           111       11233555889999999999999    999999987          9


Q ss_pred             CCCCCCcccCchHHHH
Q 002165          689 PFVAPNQFQSNNVAEK  704 (957)
Q Consensus       689 ~~~~~~~f~~~e~k~~  704 (957)
                      +||+.+++.+..+++.
T Consensus       880 hyyk~kdled~~~kk~  895 (902)
T KOG0923|consen  880 HYYKLKDLEDATNKKM  895 (902)
T ss_pred             hhhhhhhccccccccc
Confidence            9999999987766543

>KOG0922 consensus DEAH-box RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0925 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0924 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>KOG0920 consensus ATP-dependent RNA helicase A [RNA processing and modification] Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0926 consensus DEAH-box RNA helicase [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>KOG0921 consensus Dosage compensation complex, subunit MLE [Transcription] Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>KOG0331 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0330 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0345 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0333 consensus U5 snRNP-like RNA helicase subunit [RNA processing and modification] Back     alignment and domain information
>KOG0342 consensus ATP-dependent RNA helicase pitchoune [RNA processing and modification] Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>KOG0338 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>KOG0340 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>KOG0343 consensus RNA Helicase [RNA processing and modification] Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>KOG0328 consensus Predicted ATP-dependent RNA helicase FAL1, involved in rRNA maturation, DEAD-box superfamily [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>KOG0339 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0335 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>KOG0336 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0348 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0332 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>KOG0347 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0341 consensus DEAD-box protein abstrakt [RNA processing and modification] Back     alignment and domain information
>KOG0326 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>KOG0350 consensus DEAD-box ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0354 consensus DEAD-box like helicase [General function prediction only] Back     alignment and domain information
>KOG4284 consensus DEAD box protein [Transcription] Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>KOG0346 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>KOG0334 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>KOG0344 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0948 consensus Nuclear exosomal RNA helicase MTR4, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0327 consensus Translation initiation factor 4F, helicase subunit (eIF-4A) and related helicases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0947 consensus Cytoplasmic exosomal RNA helicase SKI2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>KOG0352 consensus ATP-dependent DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>KOG0337 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>KOG0351 consensus ATP-dependent DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>KOG0950 consensus DNA polymerase theta/eta, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>KOG0921 consensus Dosage compensation complex, subunit MLE [Transcription] Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>KOG0329 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0353 consensus ATP-dependent DNA helicase [General function prediction only] Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0349 consensus Putative DEAD-box RNA helicase DDX1 [RNA processing and modification] Back     alignment and domain information
>PRK12904 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>KOG0949 consensus Predicted helicase, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family Back     alignment and domain information
>PRK13107 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0953 consensus Mitochondrial RNA helicase SUV3, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF04408 HA2: Helicase associated domain (HA2); InterPro: IPR007502 This presumed domain is about 90 amino acid residues in length Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3 Back     alignment and domain information
>smart00847 HA2 Helicase associated domain (HA2) Add an annotation Back     alignment and domain information
>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>KOG1123 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, 3'-5' helicase subunit SSL2 [Transcription; Replication, recombination and repair] Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>KOG4150 consensus Predicted ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins Back     alignment and domain information
>PRK12900 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>PRK12326 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain Back     alignment and domain information
>PRK13103 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0385 consensus Chromatin remodeling complex WSTF-ISWI, small subunit [Transcription] Back     alignment and domain information
>KOG0387 consensus Transcription-coupled repair protein CSB/RAD26 (contains SNF2 family DNA-dependent ATPase domain) [Transcription; Replication, recombination and repair] Back     alignment and domain information
>PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>smart00490 HELICc helicase superfamily c-terminal domain Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PRK12903 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>CHL00122 secA preprotein translocase subunit SecA; Validated Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>COG4889 Predicted helicase [General function prediction only] Back     alignment and domain information
>KOG0390 consensus DNA repair protein, SNF2 family [Replication, recombination and repair] Back     alignment and domain information
>PRK12902 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0384 consensus Chromodomain-helicase DNA-binding protein [Transcription] Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>KOG1000 consensus Chromatin remodeling protein HARP/SMARCAL1, DEAD-box superfamily [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1040 consensus Polyadenylation factor I complex, subunit, Yth1 (CPSF subunit) [RNA processing and modification] Back     alignment and domain information
>KOG1677 consensus CCCH-type Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG0392 consensus SNF2 family DNA-dependent ATPase domain-containing protein [Transcription] Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>KOG0389 consensus SNF2 family DNA-dependent ATPase [Chromatin structure and dynamics] Back     alignment and domain information
>COG5084 YTH1 Cleavage and polyadenylation specificity factor (CPSF) Clipper subunit and related makorin family Zn-finger proteins [General function prediction only] Back     alignment and domain information
>PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e Back     alignment and domain information
>KOG3702 consensus Nuclear polyadenylated RNA binding protein [RNA processing and modification] Back     alignment and domain information
>COG0610 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>TIGR00596 rad1 DNA repair protein (rad1) Back     alignment and domain information
>PF00642 zf-CCCH: Zinc finger C-x8-C-x5-C-x3-H type (and similar); InterPro: IPR000571 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>KOG1763 consensus Uncharacterized conserved protein, contains CCCH-type Zn-finger [General function prediction only] Back     alignment and domain information
>PF00642 zf-CCCH: Zinc finger C-x8-C-x5-C-x3-H type (and similar); InterPro: IPR000571 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5063 CTH1 CCCH-type Zn-finger protein [General function prediction only] Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>KOG1492 consensus C3H1-type Zn-finger protein [General function prediction only] Back     alignment and domain information
>smart00356 ZnF_C3H1 zinc finger Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PRK10875 recD exonuclease V subunit alpha; Provisional Back     alignment and domain information
>smart00489 DEXDc3 DEAD-like helicases superfamily Back     alignment and domain information
>smart00488 DEXDc2 DEAD-like helicases superfamily Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>KOG1492 consensus C3H1-type Zn-finger protein [General function prediction only] Back     alignment and domain information
>TIGR01447 recD exodeoxyribonuclease V, alpha subunit Back     alignment and domain information
>PRK12901 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>KOG2494 consensus C3H1-type Zn-finger protein [Transcription] Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>KOG0386 consensus Chromatin remodeling complex SWI/SNF, component SWI2 and related ATPases (DNA/RNA helicase superfamily) [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>TIGR01448 recD_rel helicase, putative, RecD/TraA family Back     alignment and domain information
>KOG1040 consensus Polyadenylation factor I complex, subunit, Yth1 (CPSF subunit) [RNA processing and modification] Back     alignment and domain information
>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>COG0653 SecA Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>smart00356 ZnF_C3H1 zinc finger Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>COG5252 Uncharacterized conserved protein, contains CCCH-type Zn-finger protein [General function prediction only] Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PF06862 DUF1253: Protein of unknown function (DUF1253); InterPro: IPR010678 This family is defined by a C-terminal region of approximately 500 residues, Digestive organ expansion factor (DEF) is thought to Regulate the p53 pathway to control the expansion growth of digestive organs and is required for the expansion growth of intestine, liver and exocrine pancreas, but not endocrine pancreas [, ] Back     alignment and domain information
>KOG1595 consensus CCCH-type Zn-finger protein [General function prediction only] Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>KOG0391 consensus SNF2 family DNA-dependent ATPase [General function prediction only] Back     alignment and domain information
>PRK13889 conjugal transfer relaxase TraA; Provisional Back     alignment and domain information
>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins Back     alignment and domain information
>PRK15483 type III restriction-modification system StyLTI enzyme res; Provisional Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF13872 AAA_34: P-loop containing NTP hydrolase pore-1 Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PF07517 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011115 SecA protein binds to the plasma membrane where it interacts with proOmpA to support translocation of proOmpA through the membrane Back     alignment and domain information
>KOG2340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK13826 Dtr system oriT relaxase; Provisional Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>KOG2333 consensus Uncharacterized conserved protein [General function prediction only] Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>COG5084 YTH1 Cleavage and polyadenylation specificity factor (CPSF) Clipper subunit and related makorin family Zn-finger proteins [General function prediction only] Back     alignment and domain information
>PF14608 zf-CCCH_2: Zinc finger C-x8-C-x5-C-x3-H type Back     alignment and domain information
>PF14608 zf-CCCH_2: Zinc finger C-x8-C-x5-C-x3-H type Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only] Back     alignment and domain information
>PF05127 Helicase_RecD: Helicase; InterPro: IPR007807 This domain is about 350 amino acid residues long and appears to have a P-loop motif, suggesting this is an ATPase Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>PF13307 Helicase_C_2: Helicase C-terminal domain; PDB: 4A15_A 2VSF_A 3CRV_A 3CRW_1 2VL7_A Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>COG5063 CTH1 CCCH-type Zn-finger protein [General function prediction only] Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG1802 consensus RNA helicase nonsense mRNA reducing factor (pNORF1) [RNA processing and modification] Back     alignment and domain information
>TIGR00376 DNA helicase, putative Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>KOG0388 consensus SNF2 family DNA-dependent ATPase [Replication, recombination and repair] Back     alignment and domain information
>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>KOG1595 consensus CCCH-type Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK13894 conjugal transfer ATPase TrbB; Provisional Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG2185 consensus Predicted RNA-processing protein, contains G-patch domain [RNA processing and modification] Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG4791 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>KOG2185 consensus Predicted RNA-processing protein, contains G-patch domain [RNA processing and modification] Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PF12340 DUF3638: Protein of unknown function (DUF3638); InterPro: IPR022099 This domain family is found in eukaryotes, and is approximately 230 amino acids in length Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG1677 consensus CCCH-type Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>COG1444 Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only] Back     alignment and domain information
>PHA03333 putative ATPase subunit of terminase; Provisional Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>PRK13833 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK13851 type IV secretion system protein VirB11; Provisional Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>KOG1803 consensus DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 Back     alignment and domain information
>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] Back     alignment and domain information
>KOG2228 consensus Origin recognition complex, subunit 4 [Replication, recombination and repair] Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>KOG4791 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1702 PhoH Phosphate starvation-inducible protein PhoH, predicted ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>PTZ00293 thymidine kinase; Provisional Back     alignment and domain information
>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI Back     alignment and domain information
>PRK14712 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>KOG1805 consensus DNA replication helicase [Replication, recombination and repair] Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG2373 consensus Predicted mitochondrial DNA helicase twinkle [Replication, recombination and repair] Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG2494 consensus C3H1-type Zn-finger protein [Transcription] Back     alignment and domain information
>PRK13709 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>PHA02533 17 large terminase protein; Provisional Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10436 hypothetical protein; Provisional Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>PF10354 DUF2431: Domain of unknown function (DUF2431); InterPro: IPR019446 This entry represents the N-terminal domain of a family of proteins whose function is not known Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG1132 consensus Helicase of the DEAD superfamily [Replication, recombination and repair] Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PF01443 Viral_helicase1: Viral (Superfamily 1) RNA helicase; InterPro: IPR000606 This entry includes RNA and DNA helicases Back     alignment and domain information
>TIGR02533 type_II_gspE general secretory pathway protein E Back     alignment and domain information
>PRK13900 type IV secretion system ATPase VirB11; Provisional Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>TIGR03819 heli_sec_ATPase helicase/secretion neighborhood ATPase Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>TIGR02688 conserved hypothetical protein TIGR02688 Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>KOG1015 consensus Transcription regulator XNP/ATRX, DEAD-box superfamily [Transcription] Back     alignment and domain information
>COG3587 Restriction endonuclease [Defense mechanisms] Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>KOG0745 consensus Putative ATP-dependent Clp-type protease (AAA+ ATPase superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>COG4962 CpaF Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>TIGR02785 addA_Gpos recombination helicase AddA, Firmicutes type Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>KOG2543 consensus Origin recognition complex, subunit 5 [Replication, recombination and repair] Back     alignment and domain information
>cd03239 ABC_SMC_head The structural maintenance of chromosomes (SMC) proteins are essential for successful chromosome transmission during replication and segregation of the genome in all organisms Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4439 consensus RNA polymerase II transcription termination factor TTF2/lodestar, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PHA03368 DNA packaging terminase subunit 1; Provisional Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>TIGR02858 spore_III_AA stage III sporulation protein AA Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>KOG0391 consensus SNF2 family DNA-dependent ATPase [General function prediction only] Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) Back     alignment and domain information
>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PRK11054 helD DNA helicase IV; Provisional Back     alignment and domain information
>cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1763 consensus Uncharacterized conserved protein, contains CCCH-type Zn-finger [General function prediction only] Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>PF14617 CMS1: U3-containing 90S pre-ribosomal complex subunit Back     alignment and domain information
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF00265 TK: Thymidine kinase; InterPro: IPR001267 Thymidine kinase (TK) (2 Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>PRK12900 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK10919 ATP-dependent DNA helicase Rep; Provisional Back     alignment and domain information
>COG1435 Tdk Thymidine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF03354 Terminase_1: Phage Terminase ; InterPro: IPR005021 This entry is represented by Lactococcus phage bIL285, Orf41 (terminase) Back     alignment and domain information
>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>PF10650 zf-C3H1: Putative zinc-finger domain; InterPro: IPR019607 This domain is conserved in fungi and might be a zinc-finger domain as it contains three conserved Cs and an H in the C-x8-C-x5-C-x3-H conformation typical of a zinc-finger Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>PF02367 UPF0079: Uncharacterised P-loop hydrolase UPF0079; InterPro: IPR003442 This group consists of bacterial proteins, which contain a P-loop Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>KOG0349 consensus Putative DEAD-box RNA helicase DDX1 [RNA processing and modification] Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>PRK12901 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>cd03282 ABC_MSH4_euk MutS4 homolog in eukaryotes Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A Back     alignment and domain information
>PRK13695 putative NTPase; Provisional Back     alignment and domain information
>COG0630 VirB11 Type IV secretory pathway, VirB11 components, and related ATPases involved in archaeal flagella biosynthesis [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR00767 rho transcription termination factor Rho Back     alignment and domain information
>COG3973 Superfamily I DNA and RNA helicases [General function prediction only] Back     alignment and domain information
>COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion] Back     alignment and domain information
>COG5008 PilU Tfp pilus assembly protein, ATPase PilU [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>KOG0737 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PF12846 AAA_10: AAA-like domain Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>PRK09354 recA recombinase A; Provisional Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>TIGR01074 rep ATP-dependent DNA helicase Rep Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query957
3kx2_B767 Crystal Structure Of Prp43p In Complex With Adp Len 2e-36
2xau_A773 Crystal Structure Of The Prp43p Deah-Box Rna Helica 2e-36
3llm_A235 Crystal Structure Analysis Of A Rna Helicase Length 3e-17
2cqe_A98 Solution Structure Of The Zinc-Finger Domain In Kia 8e-07
>pdb|3KX2|B Chain B, Crystal Structure Of Prp43p In Complex With Adp Length = 767 Back     alignment and structure 
Iteration: 1

 Score =  151 bits (381), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 130/470 (27%), Positives = 209/470 (44%), Gaps = 62/470 (13%)
Query: 28  VMSLREKIVEKVLENRVTLIVGETGCGKSSQVPQFLLAENM-----EPILCTQPRRFXXX 82
           V + R++ ++    N++ + VGETG GK++Q+PQF+L + M       + CTQPRR    
Sbjct: 95  VHAQRDEFLKLYQNNQIMVFVGETGSGKTTQIPQFVLFDEMPHLENTQVACTQPRRVAAM 154
Query: 83  XXXXXXXXGRNCELGGEVGYHIGHSKHLSERSKIVFKTAGVLLDE-MRDRGLNALKYKVI 141
                     + +LG EVGY I      S ++ + + T G+LL E M D  L+  +Y  I
Sbjct: 155 SVAQRVAEEMDVKLGEEVGYSIRFENKTSNKTILKYMTDGMLLREAMEDHDLS--RYSCI 212
Query: 142 ILDEVHERSVESDXXXXXXXXXXXXXNDLRVVLMSATADITKYRDYFRDL------GRGE 195
           ILDE HER++ +D              DL++++MSAT D  K++ YF D       GR  
Sbjct: 213 ILDEAHERTLATDILMGLLKQVVKRRPDLKIIIMSATLDAEKFQRYFNDAPLLAVPGRTY 272
Query: 196 RVEVLAIPSTNQRTIFQRRVSYLEQVTELLGVDHGMTSELSSLRYCSGPSPSMANAEIKP 255
            VE+   P       FQR   YL+     +   H        L + +G          + 
Sbjct: 273 PVELYYTPE------FQR--DYLDSAIRTVLQIHATEEAGDILLFLTG----------ED 314
Query: 256 EVHKLIHDLVLHIHKNESDIEKSILVFLPTYYAL--EQQWHLMKPLSSFFKVHILHSSVD 313
           E+   +  + L   +   +     L   P Y +L   QQ  + +P               
Sbjct: 315 EIEDAVRKISLEGDQLVREEGCGPLSVYPLYGSLPPHQQQRIFEPAPESHN--------- 365
Query: 314 TEQALMAMKICKSHRKVILATNIAESSVTIPKVAYVIDSCRSLQVFWDVNRKIDSAELVW 373
                      +  RKV+++TNIAE+S+TI  + YV+D   S Q  ++   +++S  +  
Sbjct: 366 ----------GRPGRKVVISTNIAETSLTIDGIVYVVDPGFSKQKVYNPRIRVESLLVSP 415
Query: 374 VSQSQAEQRRGRTGRTCDGQVYRLVT-KSFFGTLEDHECPAIXXXXXXXXXXXICCAESK 432
           +S++ A+QR GR GRT  G+ +RL T ++F   L +   P I               E K
Sbjct: 416 ISKASAQQRAGRAGRTRPGKCFRLYTEEAFQKELIEQSYPEILRSNLSS-----TVLELK 470
Query: 433 AISDPKVLLQKALDPPYPEVVGDALDLLDHKRALQ---KISPRGRYEPTF 479
            +    ++    +DPP PE +  AL+ L++   L     ++P GR    F
Sbjct: 471 KLGIDDLVHFDFMDPPAPETMMRALEELNYLACLDDEGNLTPLGRLASQF 520
>pdb|2XAU|A Chain A, Crystal Structure Of The Prp43p Deah-Box Rna Helicase In Complex With Adp Length = 773 Back     alignment and structure
>pdb|3LLM|A Chain A, Crystal Structure Analysis Of A Rna Helicase Length = 235 Back     alignment and structure
>pdb|2CQE|A Chain A, Solution Structure Of The Zinc-Finger Domain In Kiaa1064 Protein Length = 98 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query957
2xau_A773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 9e-82
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 1e-60
1yks_A440 Genome polyprotein [contains: flavivirin protease 1e-47
2v6i_A431 RNA helicase; membrane, hydrolase, transmembrane, 8e-41
3o8b_A666 HCV NS3 protease/helicase; ntpase, RNA, translocat 4e-27
3o8b_A666 HCV NS3 protease/helicase; ntpase, RNA, translocat 6e-19
2z83_A459 Helicase/nucleoside triphosphatase; hydrolase, mem 1e-26
2z83_A459 Helicase/nucleoside triphosphatase; hydrolase, mem 9e-20
2jlq_A451 Serine protease subunit NS3; ribonucleoprotein, nu 8e-26
2jlq_A451 Serine protease subunit NS3; ribonucleoprotein, nu 4e-21
2whx_A618 Serine protease/ntpase/helicase NS3; transcription 2e-23
2whx_A618 Serine protease/ntpase/helicase NS3; transcription 7e-22
2wv9_A673 Flavivirin protease NS2B regulatory subunit, FLAV 9e-22
2wv9_A673 Flavivirin protease NS2B regulatory subunit, FLAV 9e-20
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-17
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-15
2cqe_A98 KIAA1064 protein; CCCH zinc-finger, structural gen 3e-14
2rhk_C72 Cleavage and polyadenylation specificity factor su 5e-12
2d9n_A77 Cleavage and polyadenylation specificity factor, 3 1e-11
2d9n_A77 Cleavage and polyadenylation specificity factor, 3 8e-04
1m9o_A77 Tristetraproline; Cys3His type zinc finger, metal 6e-10
3d2q_A70 Muscleblind-like protein 1; tandem zinc finger dom 2e-05
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 2e-05
2e5s_A98 Otthump00000018578; ZF-CCCHX2 domain, muscleblind- 7e-05
2rpp_A89 Muscleblind-like protein 2; zinc finger domain, C3 2e-04
3b6e_A216 Interferon-induced helicase C domain-containing P; 2e-04
2lhn_A80 Nuclear polyadenylated RNA-binding protein NAB2; n 3e-04
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Length = 773 Back     alignment and structure
 Score =  280 bits (718), Expect = 9e-82
 Identities = 152/523 (29%), Positives = 242/523 (46%), Gaps = 121/523 (23%)

Query: 16  SPFTSPEFS-----------SLPVMSLREKIVEKVLENRVTLIVGETGCGKSSQVPQFLL 64
           +PFT  EF+            LPV + R++ ++    N++ + VGETG GK++Q+PQF+L
Sbjct: 72  NPFTGREFTPKYVDILKIRRELPVHAQRDEFLKLYQNNQIMVFVGETGSGKTTQIPQFVL 131

Query: 65  AENMEP-----ILCTQPRRFAVVAVAKMVAKGRNCELGGEVGYHIGHSKHLSERSKIVFK 119
            + M       + CTQPRR A ++VA+ VA+  + +LG EVGY I      S ++ + + 
Sbjct: 132 FDEMPHLENTQVACTQPRRVAAMSVAQRVAEEMDVKLGEEVGYSIRFENKTSNKTILKYM 191

Query: 120 TAGVLLDE-MRDRGLNALKYKVIILDEVHERSVESDLVLVCVKQLLLKKNDLRVVLMSAT 178
           T G+LL E M D  L+  +Y  IILDE HER++ +D+++  +KQ++ ++ DL++++MSAT
Sbjct: 192 TDGMLLREAMEDHDLS--RYSCIILDEAHERTLATDILMGLLKQVVKRRPDLKIIIMSAT 249

Query: 179 ADITKYRDYFRDLGRGERVEVLAIPSTNQRTIFQRRVSYLEQVTELLGVDHGMTSELSSL 238
            D  K++ YF D        +LA+P    RT +               V+         L
Sbjct: 250 LDAEKFQRYFND------APLLAVPG---RT-YP--------------VE---------L 276

Query: 239 RYCSGPSPSMANAEIKPEVHKLIHDLVLHIHKNES--DIEKSILVFLP-------TYYAL 289
            Y         ++ I+          VL IH  E   D    IL+FL            +
Sbjct: 277 YYTPEFQRDYLDSAIR---------TVLQIHATEEAGD----ILLFLTGEDEIEDAVRKI 323

Query: 290 EQQWHLMKPLSSFFKVHIL--HSSVDTEQALMAMKI---------CKSHRKVILATNIAE 338
             +   +        + +   + S+   Q     +I          +  RKV+++TNIAE
Sbjct: 324 SLEGDQLVREEGCGPLSVYPLYGSLPPHQ---QQRIFEPAPESHNGRPGRKVVISTNIAE 380

Query: 339 SSVTIPKVAYVIDSCRSLQVFWDVNRKIDSAELVWVSQSQAEQRRGRTGRTCDGQVYRLV 398
           +S+TI  + YV+D   S Q  ++   +++S  +  +S++ A+QR GR GRT  G+ +RL 
Sbjct: 381 TSLTIDGIVYVVDPGFSKQKVYNPRIRVESLLVSPISKASAQQRAGRAGRTRPGKCFRLY 440

Query: 399 TKSFFGT-LEDHECPAILRLSLRLQVLLICCAESKAISDPKVLLQKAL-----------D 446
           T+  F   L +   P ILR +L                   VL  K L           D
Sbjct: 441 TEEAFQKELIEQSYPEILRSNL----------------SSTVLELKKLGIDDLVHFDFMD 484

Query: 447 PPYPEVVGDALDLLDHKRALQKISPRGRYEPTFYGRLLASFSL 489
           PP PE +  AL+ L+    L  +   G    T  GRL + F L
Sbjct: 485 PPAPETMMRALEELN---YLACLDDEGNL--TPLGRLASQFPL 522
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Length = 235 Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Length = 440 Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Length = 431 Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4a92_A* 1cu1_A 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A 8ohm_A 2f55_A 1jr6_A 1onb_A Length = 666 Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4a92_A* 1cu1_A 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A 8ohm_A 2f55_A 1jr6_A 1onb_A Length = 666 Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Length = 459 Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Length = 459 Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Length = 451 Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Length = 451 Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Length = 618 Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Length = 618 Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Length = 673 Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Length = 673 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2cqe_A KIAA1064 protein; CCCH zinc-finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.66.1.1 g.66.1.1 Length = 98 Back     alignment and structure
>2rhk_C Cleavage and polyadenylation specificity factor subunit 4; influenza A, nonstructural protein, viral protein: HOST complex, Zn finger; 1.95A {Homo sapiens} Length = 72 Back     alignment and structure
>2d9n_A Cleavage and polyadenylation specificity factor, 30 kDa subunit; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 77 Back     alignment and structure
>2d9n_A Cleavage and polyadenylation specificity factor, 30 kDa subunit; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 77 Back     alignment and structure
>1m9o_A Tristetraproline; Cys3His type zinc finger, metal binding protein; NMR {Mus musculus} SCOP: g.66.1.1 PDB: 1rgo_A Length = 77 Back     alignment and structure
>3d2q_A Muscleblind-like protein 1; tandem zinc finger domain, alternative splicing, metal- binding, nucleus, RNA-binding, zinc, zinc-finger, metal binding; 1.50A {Homo sapiens} PDB: 3d2s_A Length = 70 Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Length = 494 Back     alignment and structure
>2e5s_A Otthump00000018578; ZF-CCCHX2 domain, muscleblind-like 2, isoform 1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 98 Back     alignment and structure
>2rpp_A Muscleblind-like protein 2; zinc finger domain, C3H, alternative splicing, cytoplasm, metal-binding, nucleus, RNA-binding, zinc, zinc-finger; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Length = 216 Back     alignment and structure
>2lhn_A Nuclear polyadenylated RNA-binding protein NAB2; nuclear protein; NMR {Saccharomyces cerevisiae S288C} Length = 80 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query957
2xau_A773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 100.0
2va8_A715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 100.0
2p6r_A702 Afuhel308 helicase; protein-DNA complex, SF2 helic 100.0
2zj8_A720 DNA helicase, putative SKI2-type helicase; RECA fo 100.0
3l9o_A1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 100.0
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 100.0
3o8b_A666 HCV NS3 protease/helicase; ntpase, RNA, translocat 100.0
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 100.0
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 100.0
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 100.0
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 100.0
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 100.0
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 100.0
4f92_B1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 100.0
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 100.0
4a4z_A997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 100.0
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 100.0
2xgj_A1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 100.0
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 100.0
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 100.0
2ykg_A696 Probable ATP-dependent RNA helicase DDX58; hydrola 100.0
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 100.0
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 100.0
2z83_A459 Helicase/nucleoside triphosphatase; hydrolase, mem 100.0
3sqw_A579 ATP-dependent RNA helicase MSS116, mitochondrial; 100.0
2jlq_A451 Serine protease subunit NS3; ribonucleoprotein, nu 100.0
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 100.0
2v1x_A591 ATP-dependent DNA helicase Q1; DNA strand annealin 100.0
3rc3_A677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 100.0
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 100.0
1oyw_A523 RECQ helicase, ATP-dependent DNA helicase; winged 100.0
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 99.98
3i4u_A270 ATP-dependent RNA helicase DHX8; splicing, ATP-bin 99.98
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 99.98
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 99.98
2whx_A618 Serine protease/ntpase/helicase NS3; transcription 99.98
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 99.97
4gl2_A699 Interferon-induced helicase C domain-containing P; 99.97
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 99.97
2v6i_A431 RNA helicase; membrane, hydrolase, transmembrane, 99.97
1yks_A440 Genome polyprotein [contains: flavivirin protease 99.97
4a2w_A936 RIG-I, retinoic acid inducible protein I; hydrolas 99.96
2wv9_A673 Flavivirin protease NS2B regulatory subunit, FLAV 99.96
2eyq_A1151 TRCF, transcription-repair coupling factor; MFD, S 99.95
1gm5_A780 RECG; helicase, replication restart; HET: DNA ADP; 99.95
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 99.95
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 99.95
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 99.95
1gku_B1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 99.94
3h1t_A590 Type I site-specific restriction-modification syst 99.93
1tf5_A844 Preprotein translocase SECA subunit; ATPase, helic 99.93
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 99.92
2fsf_A853 Preprotein translocase SECA subunit; ATPase, DNA-R 99.92
1nkt_A922 Preprotein translocase SECA 1 subunit; preprotein 99.91
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 99.87
3dmq_A968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 99.86
1z63_A500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 99.86
3i32_A300 Heat resistant RNA dependent ATPase; RNA helicase, 99.85
2w00_A1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 99.84
1z3i_X644 Similar to RAD54-like; recombination ATPase helica 99.8
3mwy_W800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 99.79
3jux_A822 Protein translocase subunit SECA; protein transloc 99.78
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 99.77
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 99.77
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 99.76
1c4o_A664 DNA nucleotide excision repair enzyme UVRB; uvrabc 99.76
3bor_A237 Human initiation factor 4A-II; translation initiat 99.76
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 99.75
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 99.75
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 99.75
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 99.75
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 99.75
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 99.74
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 99.74
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 99.74
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 99.73
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 99.72
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 99.7
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 99.69
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 99.69
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 99.69
3b6e_A216 Interferon-induced helicase C domain-containing P; 99.66
2d7d_A661 Uvrabc system protein B; helicase, protein-DNA-ADP 99.66
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 99.65
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 99.64
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 99.63
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 99.38
2ipc_A997 Preprotein translocase SECA subunit; nucleotide bi 99.53
2vl7_A540 XPD; helicase, unknown function; 2.25A {Sulfolobus 99.52
1rif_A282 DAR protein, DNA helicase UVSW; bacteriophage, REC 99.5
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 99.43
3crv_A551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 99.36
2cqe_A98 KIAA1064 protein; CCCH zinc-finger, structural gen 99.27
2d9n_A77 Cleavage and polyadenylation specificity factor, 3 99.23
2rhk_C72 Cleavage and polyadenylation specificity factor su 99.2
1z5z_A271 Helicase of the SNF2/RAD54 family; hydrolase, reco 99.17
1m9o_A77 Tristetraproline; Cys3His type zinc finger, metal 99.14
3d2q_A70 Muscleblind-like protein 1; tandem zinc finger dom 99.1
2e5s_A98 Otthump00000018578; ZF-CCCHX2 domain, muscleblind- 99.09
4a15_A620 XPD helicase, ATP-dependent DNA helicase TA0057; h 98.92
3d2n_A83 Muscleblind-like protein 1; tandem zinc finger dom 98.89
2rpp_A89 Muscleblind-like protein 2; zinc finger domain, C3 98.88
1w36_D608 RECD, exodeoxyribonuclease V alpha chain; recombin 98.04
3upu_A459 ATP-dependent DNA helicase DDA; RECA-like domain, 98.02
2d9n_A77 Cleavage and polyadenylation specificity factor, 3 97.8
3e1s_A574 Exodeoxyribonuclease V, subunit RECD; alpha and be 97.62
4b3f_X646 DNA-binding protein smubp-2; hydrolase, helicase; 97.55
2gk6_A624 Regulator of nonsense transcripts 1; UPF1, helicas 97.3
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 97.26
2rhk_C72 Cleavage and polyadenylation specificity factor su 97.1
2cqe_A98 KIAA1064 protein; CCCH zinc-finger, structural gen 97.03
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 96.89
3d2q_A70 Muscleblind-like protein 1; tandem zinc finger dom 96.89
2d9m_A69 Zinc finger CCCH-type domain containing protein 7A 96.82
3u9g_A229 Zinc finger CCCH-type antiviral protein 1; zinc fi 96.8
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 96.8
2fc6_A50 Nuclear, target of EGR1, member 1; structure genom 96.72
3lfu_A647 DNA helicase II; SF1 helicase, ATP-binding, DNA da 96.71
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 96.66
3u9g_A229 Zinc finger CCCH-type antiviral protein 1; zinc fi 96.63
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 96.55
2o0j_A385 Terminase, DNA packaging protein GP17; nucleotide- 96.53
1m9o_A77 Tristetraproline; Cys3His type zinc finger, metal 96.38
2lhn_A80 Nuclear polyadenylated RNA-binding protein NAB2; n 95.33
2e5s_A98 Otthump00000018578; ZF-CCCHX2 domain, muscleblind- 96.32
3vkw_A446 Replicase large subunit; alpha/beta domain, helica 96.3
2rpp_A89 Muscleblind-like protein 2; zinc finger domain, C3 96.3
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 96.27
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 96.25
3cpe_A592 Terminase, DNA packaging protein GP17; large termi 96.14
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 96.08
2chg_A226 Replication factor C small subunit; DNA-binding pr 96.05
2zpa_A671 Uncharacterized protein YPFI; RNA modification enz 96.01
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 95.96
2v1u_A387 Cell division control protein 6 homolog; DNA repli 95.94
2d9m_A69 Zinc finger CCCH-type domain containing protein 7A 95.93
3d2n_A83 Muscleblind-like protein 1; tandem zinc finger dom 95.89
3bos_A242 Putative DNA replication factor; P-loop containing 95.78
3co5_A143 Putative two-component system transcriptional RES 95.77
2orv_A234 Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 95.76
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 95.73
2j9r_A214 Thymidine kinase; TK1, DNK, lasso, transferase, AT 95.62
2qgz_A308 Helicase loader, putative primosome component; str 95.62
2fc6_A50 Nuclear, target of EGR1, member 1; structure genom 95.59
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 95.4
2kjq_A149 DNAA-related protein; solution structure, NESG, st 95.4
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 95.3
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 95.28
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 95.19
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 95.09
2xzl_A802 ATP-dependent helicase NAM7; hydrolase-RNA complex 95.02
2wjy_A800 Regulator of nonsense transcripts 1; nonsense medi 95.02
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 94.86
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 94.81
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 94.71
2lhn_A80 Nuclear polyadenylated RNA-binding protein NAB2; n 93.71
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 94.68
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 94.56
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 94.56
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 94.55
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 94.55
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 94.5
3e2i_A219 Thymidine kinase; Zn-binding, ATP-binding, DNA syn 94.48
2fna_A357 Conserved hypothetical protein; structural genomic 94.45
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 94.41
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 94.36
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 94.36
1w4r_A195 Thymidine kinase; type II, human, cytosolic, phosp 94.32
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 94.31
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 94.28
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 94.15
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 93.79
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 93.74
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 93.62
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 93.53
2r2a_A199 Uncharacterized protein; zonular occludens toxin, 93.48
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 93.45
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 93.42
1sxj_A516 Activator 1 95 kDa subunit; clamp loader, processi 93.16
1vma_A306 Cell division protein FTSY; TM0570, structural gen 93.05
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 92.91
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 92.85
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 92.84
1ojl_A304 Transcriptional regulatory protein ZRAR; response 92.82
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 92.73
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 92.66
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 92.52
2chq_A319 Replication factor C small subunit; DNA-binding pr 92.38
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 92.2
2gno_A305 DNA polymerase III, gamma subunit-related protein; 92.1
3pvs_A447 Replication-associated recombination protein A; ma 91.76
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 91.45
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 91.43
2ce7_A476 Cell division protein FTSH; metalloprotease; HET: 91.11
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 91.1
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 91.03
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 90.89
3hgt_A328 HDA1 complex subunit 3; RECA-like domain, SWI2/SNF 90.85
3k1j_A604 LON protease, ATP-dependent protease LON; ATP-bind 90.64
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 90.27
3u4q_A 1232 ATP-dependent helicase/nuclease subunit A; helicas 89.87
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 89.6
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 89.53
1um8_A376 ATP-dependent CLP protease ATP-binding subunit CL; 89.49
1uaa_A673 REP helicase, protein (ATP-dependent DNA helicase 89.1
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 88.96
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 88.81
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 88.81
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 88.75
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 88.51
1pjr_A724 PCRA; DNA repair, DNA replication, SOS response, h 87.96
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 87.94
1p9r_A418 General secretion pathway protein E; bacterial typ 87.63
2eyu_A261 Twitching motility protein PILT; pilus retraction 87.57
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 87.36
2oap_1511 GSPE-2, type II secretion system protein; hexameri 87.33
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 87.3
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 87.29
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 87.18
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 86.99
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 86.99
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 86.93
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 86.76
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 86.18
3cf2_A806 TER ATPase, transitional endoplasmic reticulum ATP 86.1
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 86.01
1qvr_A854 CLPB protein; coiled coil, AAA ATPase, chaperone; 85.95
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 85.91
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 85.33
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 85.17
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 85.04
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 85.03
3vaa_A199 Shikimate kinase, SK; structural genomics, center 84.4
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 84.24
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 83.94
2dhr_A499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 83.43
2ewv_A372 Twitching motility protein PILT; pilus retraction 83.36
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 83.24
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 83.05
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 82.54
3exa_A322 TRNA delta(2)-isopentenylpyrophosphate transferase 82.44
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 82.41
1qvr_A854 CLPB protein; coiled coil, AAA ATPase, chaperone; 82.28
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 82.07
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 81.92
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 81.83
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 81.7
1nij_A318 Hypothetical protein YJIA; structural genomics, P- 81.43
1kag_A173 SKI, shikimate kinase I; transferase, structural g 81.32
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 81.11
3a8t_A339 Adenylate isopentenyltransferase; rossmann fold pr 81.11
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 81.11
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 80.85
3m6a_A543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 80.82
2j37_W504 Signal recognition particle 54 kDa protein (SRP54) 80.63
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 80.48
2qmh_A205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 80.27
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 80.24
2ffh_A425 Protein (FFH); SRP54, signal recognition particle, 80.15
2cvh_A220 DNA repair and recombination protein RADB; filamen 80.11
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
Probab=100.00  E-value=8e-84  Score=795.33  Aligned_cols=599  Identities=28%  Similarity=0.403  Sum_probs=507.3

Q ss_pred             cCCCCchHHHHHHHHHHHcCCeEEEEcCCCCcHHHHHHHHHHhcCC-----CcEEEeccHHHHHHHHHHHHHhhcCCccC
Q 002165           23 FSSLPVMSLREKIVEKVLENRVTLIVGETGCGKSSQVPQFLLAENM-----EPILCTQPRRFAVVAVAKMVAKGRNCELG   97 (957)
Q Consensus        23 r~~LPi~~~Q~~il~~l~~~~~vII~a~TGSGKTt~lp~~lle~~~-----~~Iivt~Prrlaa~~va~rva~e~~~~lg   97 (957)
                      +..||++..|..+..++..+++++|+|||||||||++|+++++...     ..|++++|++.++.+++++++.+++..+|
T Consensus        90 r~~lP~~~q~~~i~~~l~~~~~vii~gpTGSGKTtllp~ll~~~~~~~~~g~~ilvl~P~r~La~q~~~~l~~~~~~~v~  169 (773)
T 2xau_A           90 RRELPVHAQRDEFLKLYQNNQIMVFVGETGSGKTTQIPQFVLFDEMPHLENTQVACTQPRRVAAMSVAQRVAEEMDVKLG  169 (773)
T ss_dssp             HTTSGGGGGHHHHHHHHHHCSEEEEECCTTSSHHHHHHHHHHHHHCGGGGTCEEEEEESCHHHHHHHHHHHHHHTTCCBT
T ss_pred             hhcCChHHHHHHHHHHHhCCCeEEEECCCCCCHHHHHHHHHHHhccccCCCceEEecCchHHHHHHHHHHHHHHhCCchh
Confidence            4579999999999999999999999999999999999999887532     35999999999999999999999999999


Q ss_pred             CeeEEeeecccccCCCCcEEEEcHHHHHHHHHccCCCcCcceEEEEcccccccccccHHHHHHHHHHhcCCCceEEEecc
Q 002165           98 GEVGYHIGHSKHLSERSKIVFKTAGVLLDEMRDRGLNALKYKVIILDEVHERSVESDLVLVCVKQLLLKKNDLRVVLMSA  177 (957)
Q Consensus        98 ~~Vgy~v~~~~~~~~~t~Ivv~T~g~Ll~~l~~~~l~l~~~~~VIIDEaHER~~~~d~ll~~lk~l~~~~~~lklIlmSA  177 (957)
                      ..+||.+++++....+++|+|+|+|+|++.+..+. .+.++++|||||+|+|+++.|+++.+++.+...+++.++|+|||
T Consensus       170 ~~vG~~i~~~~~~~~~~~I~v~T~G~l~r~l~~~~-~l~~~~~lIlDEah~R~ld~d~~~~~l~~l~~~~~~~~iIl~SA  248 (773)
T 2xau_A          170 EEVGYSIRFENKTSNKTILKYMTDGMLLREAMEDH-DLSRYSCIILDEAHERTLATDILMGLLKQVVKRRPDLKIIIMSA  248 (773)
T ss_dssp             TTEEEEETTEEECCTTCSEEEEEHHHHHHHHHHST-TCTTEEEEEECSGGGCCHHHHHHHHHHHHHHHHCTTCEEEEEES
T ss_pred             heecceeccccccCCCCCEEEECHHHHHHHHhhCc-cccCCCEEEecCccccccchHHHHHHHHHHHHhCCCceEEEEec
Confidence            99999999888888899999999999999887654 36699999999999999999999999999998889999999999


Q ss_pred             cCChHHHHHHHhhcCCCceeEEEEecCCCccceeeeeeehHHHHHHHhccCCCCccccccccccCCCCCCcccccCChhH
Q 002165          178 TADITKYRDYFRDLGRGERVEVLAIPSTNQRTIFQRRVSYLEQVTELLGVDHGMTSELSSLRYCSGPSPSMANAEIKPEV  257 (957)
Q Consensus       178 Tld~~~~~~~f~~~~~~~~v~v~~~~~~~~~~~~~v~v~yl~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  257 (957)
                      |++.+.+.+||+.      .+++.+++    +.++++++|+..                       +.         .+.
T Consensus       249 T~~~~~l~~~~~~------~~vi~v~g----r~~pv~~~~~~~-----------------------~~---------~~~  286 (773)
T 2xau_A          249 TLDAEKFQRYFND------APLLAVPG----RTYPVELYYTPE-----------------------FQ---------RDY  286 (773)
T ss_dssp             CSCCHHHHHHTTS------CCEEECCC----CCCCEEEECCSS-----------------------CC---------SCH
T ss_pred             cccHHHHHHHhcC------CCcccccC----cccceEEEEecC-----------------------Cc---------hhH
Confidence            9999999999964      33455554    356777666431                       00         011


Q ss_pred             HHHHHHHHHHHHhhCCCCCCcEEEEeCCHHHHHHHHHHhcC---------CCCCcEEEEecCCCCHHHHHHHHhccc---
Q 002165          258 HKLIHDLVLHIHKNESDIEKSILVFLPTYYALEQQWHLMKP---------LSSFFKVHILHSSVDTEQALMAMKICK---  325 (957)
Q Consensus       258 ~~li~~lv~~i~~~~~~~~g~iLVFl~~~~~ie~l~~~L~~---------~~~~~~v~~lhs~l~~~er~~i~~~f~---  325 (957)
                      .+.....+..++....  ++++||||+++++++.+++.|..         ...++.+.++||+|+.++|..+++.|+   
T Consensus       287 ~~~~l~~l~~~~~~~~--~g~iLVF~~~~~~i~~l~~~L~~~~~~l~~~~~~~~~~v~~lhg~l~~~eR~~v~~~f~~~~  364 (773)
T 2xau_A          287 LDSAIRTVLQIHATEE--AGDILLFLTGEDEIEDAVRKISLEGDQLVREEGCGPLSVYPLYGSLPPHQQQRIFEPAPESH  364 (773)
T ss_dssp             HHHHHHHHHHHHHHSC--SCEEEEECSCHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECTTCCHHHHGGGGSCCCCCS
T ss_pred             HHHHHHHHHHHHHhcC--CCCEEEECCCHHHHHHHHHHHHHHHHhhcccccCCCeEEEEeCCCCCHHHHHHHHhhccccc
Confidence            2222344455555443  57999999999999999998863         235788999999999999999999998   


Q ss_pred             --CCc-eEEEEccccccCccCCCeeEEEeCCcceeeeecCCCCccccceeecCHHhHHHhcCCCCCCCCCeEEEeechhh
Q 002165          326 --SHR-KVILATNIAESSVTIPKVAYVIDSCRSLQVFWDVNRKIDSAELVWVSQSQAEQRRGRTGRTCDGQVYRLVTKSF  402 (957)
Q Consensus       326 --~~r-kVlVaTniae~GIdIp~V~~VId~G~~k~~~yd~~~~~~~l~~~~iSkas~~QR~GRAGR~~~G~~~~L~s~~~  402 (957)
                        .|. +||||||++|+|||||+|++|||+|+++.+.||+..+++.+.+.|+|+++|.||+|||||.++|.||+||++++
T Consensus       365 ~~~g~~kVlVAT~iae~GidIp~v~~VId~g~~k~~~yd~~~g~~~L~~~p~S~~s~~QR~GRaGR~~~G~~~~l~~~~~  444 (773)
T 2xau_A          365 NGRPGRKVVISTNIAETSLTIDGIVYVVDPGFSKQKVYNPRIRVESLLVSPISKASAQQRAGRAGRTRPGKCFRLYTEEA  444 (773)
T ss_dssp             SSSCCEEEEEECTHHHHTCCCTTEEEEEECSEEEEEEEETTTTEEEEEEEECCHHHHHHHHHGGGSSSSEEEEESSCHHH
T ss_pred             CCCCceEEEEeCcHHHhCcCcCCeEEEEeCCCccceeeccccCccccccccCCHHHHHhhccccCCCCCCEEEEEecHHH
Confidence              776 99999999999999999999999999999999999999999999999999999999999999999999999998


Q ss_pred             h-hhccCCCCCchhcCCHHHHHHHHhhhhcccCCChhHhhhcccCCCCHHHHHHHHHHHHHcCccccCCCCCCCccCHHH
Q 002165          403 F-GTLEDHECPAILRLSLRLQVLLICCAESKAISDPKVLLQKALDPPYPEVVGDALDLLDHKRALQKISPRGRYEPTFYG  481 (957)
Q Consensus       403 ~-~~l~~~~~PEI~r~~L~~~iL~l~~~~~~~l~~~~~~l~~~l~pP~~~~i~~al~~L~~lgal~~~~~~g~~~lT~lG  481 (957)
                      + ..+.++..|||+|.+|.+++|+++.++   +++...  |+|++||+.+++..|++.|.++||||++   |  .+|++|
T Consensus       445 ~~~~l~~~~~pEi~r~~L~~~~L~l~~~g---i~~~~~--f~~~~~p~~~~i~~a~~~L~~lgald~~---~--~lT~lG  514 (773)
T 2xau_A          445 FQKELIEQSYPEILRSNLSSTVLELKKLG---IDDLVH--FDFMDPPAPETMMRALEELNYLACLDDE---G--NLTPLG  514 (773)
T ss_dssp             HHHTSCSSCCCGGGGSCCHHHHHHHHHTT---CCCGGG--CCCSSCCCHHHHHHHHHHHHHTTSBCTT---S--CBCHHH
T ss_pred             hcccccccCCCccccCcHHHHHHHHHHcC---CCChhh--ccccCCCcHHHHHHHHHHHHHcCCcccC---C--CcChhh
Confidence            8 679999999999999999999997654   444433  4899999999999999999999999873   5  599999


Q ss_pred             HHHHhCCCChHHHHHHHHhcccCcHHHHHHHHHHhccCCCcccCCCcchHHHHHHhcccccCCCCcccccccchhhHHHH
Q 002165          482 RLLASFSLSFDASVLVLKFGEIGMLREGILLGILMDTQPLPILHPFGDDALFAEYTGCYFGGDGNTRLLTGRKEMVIMGN  561 (957)
Q Consensus       482 ~~~a~lpl~p~~~~~ll~~~~~~c~~e~l~iaa~ls~~~~~~~~P~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~l~~  561 (957)
                      +.|+.|||||++|+||+.+..++|++++++|||+|++++ +|++|.+++++++.++..|.+++||           |++.
T Consensus       515 ~~~a~~pl~p~~~~~l~~~~~~~c~~~~l~i~a~ls~~~-~f~~~~~~~~~~~~~~~~f~~~~~D-----------~~~~  582 (773)
T 2xau_A          515 RLASQFPLDPMLAVMLIGSFEFQCSQEILTIVAMLSVPN-VFIRPTKDKKRADDAKNIFAHPDGD-----------HITL  582 (773)
T ss_dssp             HHHTTSSSCHHHHHHHHHGGGGTCHHHHHHHHHHHTSCC-CBCCCTTCHHHHHHHHHTTCCTTBH-----------HHHH
T ss_pred             hhhccccCCHHHHHHHHhhcccCchhHHHHHHHhcccCC-cccCChHHHHHHHHHHHhccCCCCc-----------HHHH
Confidence            999999999999999999999999999999999999764 8999999988888889999887776           8888


Q ss_pred             HHHHHHHHHHHhhhhhhhhhhhhhhhchhhhccccCchhhHHHHHhccCChhhHHhHHHHHHHHHHHHHhcCCcccccCC
Q 002165          562 LCAFQFWQHVFKDKQRLDHLQQVLKFDETKVTASLLPKIEEEWCSLHYLVQSSLHHVSELYEDILNAVHRFRPKFLGTSN  641 (957)
Q Consensus       562 l~af~~w~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~wC~~~~L~~~~l~~~~~i~~qL~~~~~r~~~~~~~~~~  641 (957)
                      +|+|+.|.....+                       ......||++||||+++|++|.++|.||.++|.++++...+...
T Consensus       583 l~~~~~~~~~~~~-----------------------~~~~~~~c~~~~l~~~~l~~~~~~~~ql~~~~~~~~~~~~~~~~  639 (773)
T 2xau_A          583 LNVYHAFKSDEAY-----------------------EYGIHKWCRDHYLNYRSLSAADNIRSQLERLMNRYNLELNTTDY  639 (773)
T ss_dssp             HHHHHHHTSHHHH-----------------------HHCHHHHHHHTTBCHHHHHHHHHHHHHHHHHHHHTTCCCCCCCT
T ss_pred             HHHHHHHHHhccc-----------------------cchHHHHHHHhCCCHHHHHHHHHHHHHHHHHHHhcCCCcCCCCC
Confidence            8999999753210                       01126799999999999999999999999999998876544211


Q ss_pred             CCC------------CC-------------CCCcccccc------ccccCCCCCCCCCCccCCCCCCCCcccccccc---
Q 002165          642 GLP------------TY-------------YDPYEFEHT------CLLNCDPPRDMDPLAADNEHLGPSFEAKKCVA---  687 (957)
Q Consensus       642 ~~~------------~~-------------~~~~~~~h~------~~~~~~~~~v~~~e~~~t~~~~~~~~~r~~~~---  687 (957)
                      ..+            +|             |......+.      +.+...|+||+|+|++.|+    +.|+|.|++   
T Consensus       640 ~~~~~~~~i~~~l~~g~~~~~a~~~~~~~~y~~~~~~~~~~ihp~s~l~~~~~~~v~~e~~~t~----~~~~~~~~~i~~  715 (773)
T 2xau_A          640 ESPKYFDNIRKALASGFFMQVAKKRSGAKGYITVKDNQDVLIHPSTVLGHDAEWVIYNEFVLTS----KNYIRTVTSVRP  715 (773)
T ss_dssp             TSTTHHHHHHHHHHHHHTTSEEEECCC--CEEETTTCCEEEECTTCCCCTTCSEEEEEEEEESS----SEEEEEEEECCH
T ss_pred             CchhhHHHHHHHHHHhChHhheeeccCCCcceEeeCCCEEEECCCcccCCCCCEEEEEEeeccc----hhheeecccCCH
Confidence            000            11             211011122      2333469999999999998    999999998   


Q ss_pred             -------CCCCCCCcccCchHHHHHHHHHHHHHhh
Q 002165          688 -------VPFVAPNQFQSNNVAEKLASIIKEIRVQ  715 (957)
Q Consensus       688 -------~~~~~~~~f~~~e~k~~L~~iike~r~~  715 (957)
                             |+||+..+|+.+++++.++++.+++.+.
T Consensus       716 ~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  750 (773)
T 2xau_A          716 EWLIEIAPAYYDLSNFQKGDVKLSLERIKEKVDRL  750 (773)
T ss_dssp             HHHHHHCTTTSCGGGCCSSHHHHHHHHHHHHHHC-
T ss_pred             HHHHHHHHHheeeccCCchhHHHHHHHHHHHhhhh
Confidence                   8999999999999999999998887654
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>3i4u_A ATP-dependent RNA helicase DHX8; splicing, ATP-binding, hydrolase, mRNA processing, splicing, nucleotide-binding, nucleus, phosphoprotein, SPLI; 2.10A {Homo sapiens} Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Back     alignment and structure
>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} Back     alignment and structure
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Back     alignment and structure
>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
>2cqe_A KIAA1064 protein; CCCH zinc-finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.66.1.1 g.66.1.1 Back     alignment and structure
>2d9n_A Cleavage and polyadenylation specificity factor, 30 kDa subunit; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2rhk_C Cleavage and polyadenylation specificity factor subunit 4; influenza A, nonstructural protein, viral protein: HOST complex, Zn finger; 1.95A {Homo sapiens} Back     alignment and structure
>1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 Back     alignment and structure
>1m9o_A Tristetraproline; Cys3His type zinc finger, metal binding protein; NMR {Mus musculus} SCOP: g.66.1.1 PDB: 1rgo_A Back     alignment and structure
>3d2q_A Muscleblind-like protein 1; tandem zinc finger domain, alternative splicing, metal- binding, nucleus, RNA-binding, zinc, zinc-finger, metal binding; 1.50A {Homo sapiens} PDB: 3d2s_A Back     alignment and structure
>2e5s_A Otthump00000018578; ZF-CCCHX2 domain, muscleblind-like 2, isoform 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>3d2n_A Muscleblind-like protein 1; tandem zinc finger domain, alternative splicing, metal- binding, nucleus, RNA-binding, zinc, zinc-finger, metal binding; 2.70A {Homo sapiens} Back     alignment and structure
>2rpp_A Muscleblind-like protein 2; zinc finger domain, C3H, alternative splicing, cytoplasm, metal-binding, nucleus, RNA-binding, zinc, zinc-finger; NMR {Homo sapiens} Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>2d9n_A Cleavage and polyadenylation specificity factor, 30 kDa subunit; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>2rhk_C Cleavage and polyadenylation specificity factor subunit 4; influenza A, nonstructural protein, viral protein: HOST complex, Zn finger; 1.95A {Homo sapiens} Back     alignment and structure
>2cqe_A KIAA1064 protein; CCCH zinc-finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.66.1.1 g.66.1.1 Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>3d2q_A Muscleblind-like protein 1; tandem zinc finger domain, alternative splicing, metal- binding, nucleus, RNA-binding, zinc, zinc-finger, metal binding; 1.50A {Homo sapiens} PDB: 3d2s_A Back     alignment and structure
>2d9m_A Zinc finger CCCH-type domain containing protein 7A; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3u9g_A Zinc finger CCCH-type antiviral protein 1; zinc finger protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2fc6_A Nuclear, target of EGR1, member 1; structure genomics, ZF-CCCH domain, member 1(nuclear), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.66.1.1 Back     alignment and structure
>3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A* Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>3u9g_A Zinc finger CCCH-type antiviral protein 1; zinc finger protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>2o0j_A Terminase, DNA packaging protein GP17; nucleotide-binding fold, hydrolase; HET: DNA ADP; 1.80A {Enterobacteria phage T4} PDB: 2o0h_A* 2o0k_A* Back     alignment and structure
>1m9o_A Tristetraproline; Cys3His type zinc finger, metal binding protein; NMR {Mus musculus} SCOP: g.66.1.1 PDB: 1rgo_A Back     alignment and structure
>2lhn_A Nuclear polyadenylated RNA-binding protein NAB2; nuclear protein; NMR {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2e5s_A Otthump00000018578; ZF-CCCHX2 domain, muscleblind-like 2, isoform 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} Back     alignment and structure
>2rpp_A Muscleblind-like protein 2; zinc finger domain, C3H, alternative splicing, cytoplasm, metal-binding, nucleus, RNA-binding, zinc, zinc-finger; NMR {Homo sapiens} Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>3cpe_A Terminase, DNA packaging protein GP17; large terminase, alternative initiation, ATP-binding, DNA- binding, hydrolase, nuclease; HET: DNA; 2.80A {Bacteriophage T4} PDB: 3ezk_A* Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>2zpa_A Uncharacterized protein YPFI; RNA modification enzyme, RNA helicase, acetyltransferase, GCN5 acetyltransferase; HET: ACO ADP; 2.35A {Escherichia coli K12} Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>2d9m_A Zinc finger CCCH-type domain containing protein 7A; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3d2n_A Muscleblind-like protein 1; tandem zinc finger domain, alternative splicing, metal- binding, nucleus, RNA-binding, zinc, zinc-finger, metal binding; 2.70A {Homo sapiens} Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>2fc6_A Nuclear, target of EGR1, member 1; structure genomics, ZF-CCCH domain, member 1(nuclear), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.66.1.1 Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>2lhn_A Nuclear polyadenylated RNA-binding protein NAB2; nuclear protein; NMR {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>3hgt_A HDA1 complex subunit 3; RECA-like domain, SWI2/SNF2 helical domain, chromatin regulator, coiled coil, nucleus, repressor, transcription; 2.20A {Saccharomyces cerevisiae} PDB: 3hgq_A Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3u4q_A ATP-dependent helicase/nuclease subunit A; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_A* Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>1uaa_A REP helicase, protein (ATP-dependent DNA helicase REP.); complex (helicase/DNA), DNA unwinding, hydrolase/DNA complex; HET: DNA; 3.00A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>1pjr_A PCRA; DNA repair, DNA replication, SOS response, helicase, ATP- binding, DNA-binding; 2.50A {Geobacillus stearothermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1qhg_A* 3pjr_A* 2pjr_A* 1qhh_B* 1qhh_D* 1qhh_A* 1qhh_C* 2pjr_B* Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 957
d2bmfa2305 c.37.1.14 (A:178-482) Dengue virus helicase {Dengu 2e-29
d1yksa2299 c.37.1.14 (A:325-623) YFV helicase domain {Yellow 1e-24
d1a1va1136 c.37.1.14 (A:190-325) HCV helicase domain {Human h 1e-20
d1yksa1140 c.37.1.14 (A:185-324) YFV helicase domain {Yellow 3e-11
d1wp9a1200 c.37.1.19 (A:1-200) putative ATP-dependent RNA hel 1e-04
d1wp9a2286 c.37.1.19 (A:201-486) putative ATP-dependent RNA h 1e-04
d1oywa2206 c.37.1.19 (A:1-206) RecQ helicase domain {Escheric 2e-04
d1gkub1237 c.37.1.16 (B:1-250) Helicase-like "domain" of reve 5e-04
d2cqea156 g.66.1.1 (A:458-513) Zinc finger CCCH domain-conta 0.001
d1a1va2299 c.37.1.14 (A:326-624) HCV helicase domain {Human h 0.002
d2p6ra3202 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus 0.002
d2fz4a1206 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Arc 0.004
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RNA helicase
domain: Dengue virus helicase
species: Dengue virus type 2 [TaxId: 11060]

 Score =  117 bits (293), Expect = 2e-29
 Identities = 52/377 (13%), Positives = 102/377 (27%), Gaps = 81/377 (21%)

Query: 37  EKVLENRVTLIVGETGCGKSSQVPQFLLAENMEP---ILCTQPRRFAVVAVAKMVAKGRN 93
           +   + R+T++    G GK+ +    ++ E ++     L   P R     + + +     
Sbjct: 4   DIFRKKRLTIMDLHPGAGKTKRYLPAIVREAIKRGLRTLILAPTRVVAAEMEEALRGLPI 63

Query: 94  CELGGEVGYHIGHSKHLSERSKIVFKTAGVLLDEMRDRGLNALKYKVIILDEVHERSVES 153
                 +       +       +           +    +    Y +II+DE H     S
Sbjct: 64  RYQTPAIRAEHTGREI------VDLMCHATFTMRLL-SPIRVPNYNLIIMDEAHFTDPAS 116

Query: 154 DLVLVCVKQLLLKKNDLRVVLMSATADITKYRDYFRDLGRGERVEVLAIPSTNQRTIFQR 213
                 +   +        + M+AT   ++      +           I    +    + 
Sbjct: 117 IAARGYISTRVEMGE-AAGIFMTATPPGSRDPFPQSN---------APIMDEEREIPERS 166

Query: 214 RVSYLEQVTELLGVDHGMTSELSSLRYCSGPSPSMANAEIKPEVHKLIHDLVLHIHKNES 273
             S  E VT+  G                                     +         
Sbjct: 167 WNSGHEWVTDFKG-----------------------------------KTVWFVPSIKA- 190

Query: 274 DIEKSILVFLPTYYALEQQWHLMKPLSSFFKVHILHSSVDTEQALMAMKICKSHRKVILA 333
                           +    L K   +  KV  L       +    +K   +    ++ 
Sbjct: 191 --------------GNDIAACLRK---NGKKVIQLSRKTFDSE---YIKTRTNDWDFVVT 230

Query: 334 TNIAESSVTIPKVAYVIDS--CRSLQVFWDVNRKIDSAELVWVSQSQAEQRRGRTGRTCD 391
           T+I+E          VID   C    +  D   ++  A  + V+ S A QRRGR GR   
Sbjct: 231 TDISEMGANFK-AERVIDPRRCMKPVILTDGEERVILAGPMPVTHSSAAQRRGRVGRNPK 289

Query: 392 GQVYRLVTKSFFGTLED 408
            +  + +       LE+
Sbjct: 290 NENDQYIYMG--EPLEN 304
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Length = 299 Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 136 Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Length = 140 Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 200 Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 286 Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Length = 206 Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 237 Back     information, alignment and structure
>d2cqea1 g.66.1.1 (A:458-513) Zinc finger CCCH domain-containing protein C19orf7 (KIAA1064) {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 299 Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Length = 202 Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 206 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query957
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 99.97
d1yksa2299 YFV helicase domain {Yellow fever virus [TaxId: 11 99.91
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 99.78
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 99.76
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 99.75
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 99.75
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 99.75
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 99.74
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.74
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 99.73
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 99.73
d2rb4a1168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 99.73
d1oywa3200 RecQ helicase domain {Escherichia coli [TaxId: 562 99.73
d2j0sa2168 Probable ATP-dependent RNA helicase DDX48 {Human ( 99.72
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 99.72
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.71
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 99.71
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 99.69
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 99.69
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 99.67
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.67
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 99.65
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.63
d1jr6a_138 HCV helicase domain {Human hepatitis C virus (HCV) 99.63
d2p6ra4201 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.6
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 99.58
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 99.55
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 99.54
d1wp9a2286 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.54
d1gm5a4206 RecG helicase domain {Thermotoga maritima [TaxId: 99.43
d2eyqa5211 Transcription-repair coupling factor, TRCF {Escher 99.41
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.4
d1a1va2299 HCV helicase domain {Human hepatitis C virus (HCV) 99.33
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 99.25
d2fwra1200 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.21
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 99.19
d1gkub2248 Helicase-like "domain" of reverse gyrase {Archaeon 99.16
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 99.15
d2cqea229 Zinc finger CCCH domain-containing protein C19orf7 98.51
d1z3ix1346 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 98.48
d1z5za1244 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 98.41
d1tf5a4175 Translocation ATPase SecA, nucleotide-binding doma 98.35
d1z63a1230 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 98.26
d1z3ix2298 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 98.22
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 97.85
d1m9oa_40 Tristetraproline (ttp, tis11, nup475) {Mouse (Mus 97.66
d1m9oa_40 Tristetraproline (ttp, tis11, nup475) {Mouse (Mus 97.66
d1rgoa234 Butyrate response factor 2 (Tis11D) {Human (Homo s 97.62
d1rgoa234 Butyrate response factor 2 (Tis11D) {Human (Homo s 97.62
d1rgoa136 Butyrate response factor 2 (Tis11D) {Human (Homo s 97.58
d2cqea156 Zinc finger CCCH domain-containing protein C19orf7 97.56
d1rgoa136 Butyrate response factor 2 (Tis11D) {Human (Homo s 97.52
d2cqea229 Zinc finger CCCH domain-containing protein C19orf7 97.5
d1nkta4219 Translocation ATPase SecA, nucleotide-binding doma 97.37
d1okkd2207 GTPase domain of the signal recognition particle r 97.11
d1tf5a3273 Translocation ATPase SecA, nucleotide-binding doma 97.1
d1vmaa2213 GTPase domain of the signal recognition particle r 96.88
d1nkta3288 Translocation ATPase SecA, nucleotide-binding doma 96.87
d2cqea156 Zinc finger CCCH domain-containing protein C19orf7 96.86
d2qy9a2211 GTPase domain of the signal recognition particle r 96.84
d1ls1a2207 GTPase domain of the signal sequence recognition p 96.5
d1j8yf2211 GTPase domain of the signal sequence recognition p 96.22
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 95.89
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 95.23
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 95.2
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 95.12
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 95.0
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 94.96
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 94.94
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 94.93
d2b8ta1139 Thymidine kinase, TK1, N-terminal domain {Ureaplas 94.83
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 94.51
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 94.43
d2fc6a137 Target of EGR1 protein 1, TOE1 {Human (Homo sapien 94.29
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 94.21
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 93.64
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 93.57
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 93.56
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 93.38
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 93.36
g1qhh.1623 DEXX box DNA helicase {Bacillus stearothermophilus 93.34
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 93.2
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 93.09
d1xbta1133 Thymidine kinase, TK1, N-terminal domain {Human (H 92.81
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 92.56
d1xx6a1141 Thymidine kinase, TK1, N-terminal domain {Clostrid 92.5
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 92.45
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 91.4
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 91.07
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 90.85
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 90.73
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 90.59
d2fc6a137 Target of EGR1 protein 1, TOE1 {Human (Homo sapien 90.46
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 90.39
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 90.03
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 89.9
d2p6ra185 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 89.3
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 89.18
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 89.08
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 88.61
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 88.52
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 88.42
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 88.39
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 88.11
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 87.99
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 87.56
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 87.31
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 86.87
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 86.33
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 86.0
d1t5la1413 Nucleotide excision repair enzyme UvrB {Bacillus c 85.98
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 85.83
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 85.55
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 85.54
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 85.49
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 85.45
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 85.31
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 85.12
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 85.02
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 84.99
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 84.84
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 84.84
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 84.66
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 84.57
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 84.47
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 84.45
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 84.42
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 83.77
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 83.55
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 83.47
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 83.44
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 83.21
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 83.01
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 82.81
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 82.79
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 82.5
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 82.16
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 81.98
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 81.98
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 81.62
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 81.62
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 81.21
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 81.19
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 80.76
d2hyda1255 Putative multidrug export ATP-binding/permease pro 80.71
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 80.71
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 80.25
d1w36b1485 Exodeoxyribonuclease V beta chain (RecB), N-termin 80.14
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 80.13
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RNA helicase
domain: Dengue virus helicase
species: Dengue virus type 2 [TaxId: 11060]

Probab=99.97  E-value=6.2e-31  Score=287.82  Aligned_cols=288  Identities=16%  Similarity=0.145  Sum_probs=194.3

Q ss_pred             HHcCCeEEEEcCCCCcHHHHHHHHHHhc---CCCcEEEeccHHHHHHHHHHHHHhhcCCccCCeeEEeeecccccCCCCc
Q 002165           39 VLENRVTLIVGETGCGKSSQVPQFLLAE---NMEPILCTQPRRFAVVAVAKMVAKGRNCELGGEVGYHIGHSKHLSERSK  115 (957)
Q Consensus        39 l~~~~~vII~a~TGSGKTt~lp~~lle~---~~~~Iivt~Prrlaa~~va~rva~e~~~~lg~~Vgy~v~~~~~~~~~t~  115 (957)
                      ++++++++|.||||||||++++..+++.   ...+++++.|++.+|.++++++.....    ...++.  ........+.
T Consensus         6 ~~~~~~~lv~~~TGsGKT~~~l~~~~~~~~~~~~~~lvi~Ptr~La~q~~~~l~~~~~----~~~~~~--~~~~~~~~~~   79 (305)
T d2bmfa2           6 FRKKRLTIMDLHPGAGKTKRYLPAIVREAIKRGLRTLILAPTRVVAAEMEEALRGLPI----RYQTPA--IRAEHTGREI   79 (305)
T ss_dssp             SSTTCEEEECCCTTSSTTTTHHHHHHHHHHHHTCCEEEEESSHHHHHHHHHHTTTSCC----BCCC----------CCCS
T ss_pred             hhcCCcEEEEECCCCCHHHHHHHHHHHHHHhcCCEEEEEccHHHHHHHHHHHHhcCCc----ceeeeE--EeecccCccc
Confidence            4578999999999999997654444432   124688888999999999887754211    111111  2334456789


Q ss_pred             EEEEcHHHHHHHHHccCCCcCcceEEEEcccccccccccHHHHHHHHHHhcCCCceEEEecccCChHHHHHHHhhcCCCc
Q 002165          116 IVFKTAGVLLDEMRDRGLNALKYKVIILDEVHERSVESDLVLVCVKQLLLKKNDLRVVLMSATADITKYRDYFRDLGRGE  195 (957)
Q Consensus       116 Ivv~T~g~Ll~~l~~~~l~l~~~~~VIIDEaHER~~~~d~ll~~lk~l~~~~~~lklIlmSATld~~~~~~~f~~~~~~~  195 (957)
                      |+++|+++|...+..+. .+.++++|||||+|+...+.....++++.+. .+++.++++||||++.....  +  ..  .
T Consensus        80 i~~~t~~~l~~~~~~~~-~~~~~~~vViDE~H~~~~~~~~~~~~l~~~~-~~~~~~~v~~SAT~~~~~~~--~--~~--~  151 (305)
T d2bmfa2          80 VDLMCHATFTMRLLSPI-RVPNYNLIIMDEAHFTDPASIAARGYISTRV-EMGEAAGIFMTATPPGSRDP--F--PQ--S  151 (305)
T ss_dssp             EEEEEHHHHHHHHTSSS-CCCCCSEEEEESTTCCSHHHHHHHHHHHHHH-HHTSCEEEEECSSCTTCCCS--S--CC--C
T ss_pred             cccCCcHHHHHHHhcCc-cccceeEEEeeeeeecchhhHHHHHHHHHhh-ccccceEEEeecCCCcceee--e--cc--c
Confidence            99999999988776543 4569999999999965545555556665543 35678999999997532100  0  00  0


Q ss_pred             eeEEEEecCCCccceeeeeeehHHHHHHHhccCCCCccccccccccCCCCCCcccccCChhHHHHHHHHHHHHHhhCCCC
Q 002165          196 RVEVLAIPSTNQRTIFQRRVSYLEQVTELLGVDHGMTSELSSLRYCSGPSPSMANAEIKPEVHKLIHDLVLHIHKNESDI  275 (957)
Q Consensus       196 ~v~v~~~~~~~~~~~~~v~v~yl~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~li~~lv~~i~~~~~~~  275 (957)
                      ..++...           ...              ..              .......           ...+.  .  .
T Consensus       152 ~~~~~~~-----------~~~--------------~~--------------~~~~~~~-----------~~~~~--~--~  177 (305)
T d2bmfa2         152 NAPIMDE-----------ERE--------------IP--------------ERSWNSG-----------HEWVT--D--F  177 (305)
T ss_dssp             SSCEEEE-----------ECC--------------CC--------------CSCCSSC-----------CHHHH--S--S
T ss_pred             CCcceEE-----------EEe--------------cc--------------HHHHHHH-----------HHHHH--h--h
Confidence            0000000           000              00              0000000           00011  1  1


Q ss_pred             CCcEEEEeCCHHHHHHHHHHhcCCCCCcEEEEecCCCCHHHHHHHHhcccCCc-eEEEEccccccCccCCCeeEEEeCCc
Q 002165          276 EKSILVFLPTYYALEQQWHLMKPLSSFFKVHILHSSVDTEQALMAMKICKSHR-KVILATNIAESSVTIPKVAYVIDSCR  354 (957)
Q Consensus       276 ~g~iLVFl~~~~~ie~l~~~L~~~~~~~~v~~lhs~l~~~er~~i~~~f~~~r-kVlVaTniae~GIdIp~V~~VId~G~  354 (957)
                      ++++||||+++++++.++..|...  ++.+..+||+++...+    ..++++. +++|||+++++|+|+ +++.|||+|.
T Consensus       178 ~~~~lvf~~~~~~~~~l~~~L~~~--~~~~~~l~~~~~~~~~----~~~~~~~~~~lvaT~~~~~G~~~-~~~~Vi~~~~  250 (305)
T d2bmfa2         178 KGKTVWFVPSIKAGNDIAACLRKN--GKKVIQLSRKTFDSEY----IKTRTNDWDFVVTTDISEMGANF-KAERVIDPRR  250 (305)
T ss_dssp             CSCEEEECSCHHHHHHHHHHHHHH--TCCCEECCTTCHHHHG----GGGGTSCCSEEEECGGGGTTCCC-CCSEEEECCE
T ss_pred             CCCEEEEeccHHHHHHHHHHHHhC--CCCEEEeCCcChHHHH----hhhhccchhhhhhhHHHHhcCCC-CccEEEEcCC
Confidence            468999999999999999999843  4678899999876543    4456666 999999999999999 6899999997


Q ss_pred             ce--eeeecCCCCccccceeecCHHhHHHhcCCCCCCCCCe-EEEeechh
Q 002165          355 SL--QVFWDVNRKIDSAELVWVSQSQAEQRRGRTGRTCDGQ-VYRLVTKS  401 (957)
Q Consensus       355 ~k--~~~yd~~~~~~~l~~~~iSkas~~QR~GRAGR~~~G~-~~~L~s~~  401 (957)
                      ..  ...||++.+...+...++|.++|.||+|||||.+.|. ...+|..+
T Consensus       251 ~~~~~~~~~~~~~~~~~~~~~~s~~~~~Qr~GR~GR~~~~~~~~~~~~~~  300 (305)
T d2bmfa2         251 CMKPVILTDGEERVILAGPMPVTHSSAAQRRGRVGRNPKNENDQYIYMGE  300 (305)
T ss_dssp             EEEEEEECSSSCEEEEEEEEECCHHHHHHHHTTSSCSSSCCCEEEEECSC
T ss_pred             ceeeeEecCCCCceEEeccccCCHHHHhhhhcCcCcCCCCceEEEEECCC
Confidence            54  3458899988888889999999999999999996655 44566653
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2cqea2 g.66.1.1 (A:429-457) Zinc finger CCCH domain-containing protein C19orf7 (KIAA1064) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1tf5a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m9oa_ g.66.1.1 (A:) Tristetraproline (ttp, tis11, nup475) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1m9oa_ g.66.1.1 (A:) Tristetraproline (ttp, tis11, nup475) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rgoa2 g.66.1.1 (A:187-220) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rgoa2 g.66.1.1 (A:187-220) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rgoa1 g.66.1.1 (A:151-186) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqea1 g.66.1.1 (A:458-513) Zinc finger CCCH domain-containing protein C19orf7 (KIAA1064) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rgoa1 g.66.1.1 (A:151-186) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqea2 g.66.1.1 (A:429-457) Zinc finger CCCH domain-containing protein C19orf7 (KIAA1064) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nkta4 c.37.1.19 (A:397-615) Translocation ATPase SecA, nucleotide-binding domains {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1tf5a3 c.37.1.19 (A:1-226,A:349-395) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2cqea1 g.66.1.1 (A:458-513) Zinc finger CCCH domain-containing protein C19orf7 (KIAA1064) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2fc6a1 g.66.1.1 (A:8-44) Target of EGR1 protein 1, TOE1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1xbta1 c.37.1.24 (A:18-150) Thymidine kinase, TK1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1xx6a1 c.37.1.24 (A:2-142) Thymidine kinase, TK1, N-terminal domain {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2fc6a1 g.66.1.1 (A:8-44) Target of EGR1 protein 1, TOE1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2p6ra1 a.4.5.43 (A:404-488) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w36b1 c.37.1.19 (B:1-485) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure