Citrus Sinensis ID: 002175
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 956 | ||||||
| 356526755 | 1282 | PREDICTED: geminivirus Rep-interacting m | 0.939 | 0.700 | 0.780 | 0.0 | |
| 449496402 | 1276 | PREDICTED: LOW QUALITY PROTEIN: geminivi | 0.930 | 0.697 | 0.778 | 0.0 | |
| 449451393 | 1276 | PREDICTED: geminivirus Rep-interacting m | 0.930 | 0.697 | 0.778 | 0.0 | |
| 356567769 | 1283 | PREDICTED: geminivirus Rep-interacting m | 0.939 | 0.699 | 0.777 | 0.0 | |
| 356497704 | 1280 | PREDICTED: geminivirus Rep-interacting m | 0.945 | 0.706 | 0.771 | 0.0 | |
| 356501588 | 1272 | PREDICTED: geminivirus Rep-interacting m | 0.939 | 0.705 | 0.776 | 0.0 | |
| 297811153 | 1273 | hypothetical protein ARALYDRAFT_487877 [ | 0.945 | 0.710 | 0.733 | 0.0 | |
| 15238169 | 1273 | geminivirus Rep-interacting motor protei | 0.944 | 0.709 | 0.726 | 0.0 | |
| 145334367 | 1274 | geminivirus Rep-interacting motor protei | 0.945 | 0.709 | 0.724 | 0.0 | |
| 72255627 | 1257 | 117M18_26 [Brassica rapa] | 0.945 | 0.719 | 0.716 | 0.0 |
| >gi|356526755|ref|XP_003531982.1| PREDICTED: geminivirus Rep-interacting motor protein-like [Glycine max] | Back alignment and taxonomy information |
|---|
Score = 1411 bits (3652), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 706/904 (78%), Positives = 806/904 (89%), Gaps = 6/904 (0%)
Query: 1 MEGSSHDRGLYARCFEELFDLSNSDTTATARFNFAVTVFELYNEQLRELLPQTGNGLAKI 60
MEGSS+DRGLYARCFEELFDL+N DTT+T+R+ F VTV ELYNEQ R+LL + G K+
Sbjct: 234 MEGSSYDRGLYARCFEELFDLANLDTTSTSRYKFCVTVCELYNEQTRDLLLEAGKSTPKL 293
Query: 61 RLQSLESSIELVQEKVDNPLEFSKVLKSAFQSRGNDVSKFNVSHLIIMIHIYYNNLITGE 120
L S E +ELVQE +D+PLEFS VLKSA Q+R ND+SK N+SHLI+ IHI+YNNLITGE
Sbjct: 294 CLGSPECFVELVQENIDSPLEFSAVLKSALQTRENDLSKNNISHLIVTIHIFYNNLITGE 353
Query: 121 NLYSKLSLVDLAGSEGLIAEDDSGERITDVLHVMKSLSALGDVLSSLTSRKDIVPYENSM 180
N YSKLSLVDLAGSEGLI EDDSG+R+TD+LHVMKSLSALGDVLSSLTS+KDI+PYENS+
Sbjct: 354 NSYSKLSLVDLAGSEGLITEDDSGDRVTDLLHVMKSLSALGDVLSSLTSKKDIIPYENSL 413
Query: 181 LTKVLADSLGESSKTLMIVNICPNAANMSETLSSLNFSSRARSTVLSLGNRDTIKKWRDI 240
LTK+LADSLG SSKTLMIVN+CP+ +N+SETLSS+NFS+RAR++ LSLGN+DTIKKWRD+
Sbjct: 414 LTKLLADSLGGSSKTLMIVNVCPSISNLSETLSSVNFSARARNSTLSLGNQDTIKKWRDV 473
Query: 241 ANDARKELYEREKEIQDLKQEILGLRQALKEANDQCVLLYNEVQKAWKVSFTLQSDLKSE 300
ANDARKELYE+EKEI DLKQE L L+QALK+ANDQC+LL+NEVQKA KVS LQ+DLKSE
Sbjct: 474 ANDARKELYEKEKEIHDLKQEGLELKQALKDANDQCILLFNEVQKARKVSSVLQTDLKSE 533
Query: 301 NYMLADKHKIEKEQNAQLRNQVAQLLQLEQEQKMQIQQRDSTIKTLQAKINSIESQRNEA 360
+ +L+DKH IEKEQN QLRNQVAQLL+LEQ+QK+QIQ++DSTI++LQAKI ++E+Q NEA
Sbjct: 534 HVLLSDKHNIEKEQNNQLRNQVAQLLRLEQDQKLQIQEQDSTIQSLQAKIRTLETQLNEA 593
Query: 361 LHSSEVRSTIRSEPMPAVSSVLRTTGDGMDSSAVSKKLEEELKKRDALIERLHEENEKLF 420
+ SSE RST SEP A S R TGDG+DSSAV+KKLEEELKKRDALIERLHEENEKLF
Sbjct: 594 IKSSESRSTFVSEPEFADQSNSRPTGDGIDSSAVTKKLEEELKKRDALIERLHEENEKLF 653
Query: 421 DRLTEKASSVSSPQLSSPLSKGSVNVQPRDMARNDNNNKGLPVDVAPLPLSADKTEGTVA 480
DRLT+KAS+ SP+LSSPL+ GS NVQPRD+ + + +DV P PL+ DK +GTVA
Sbjct: 654 DRLTQKASTAGSPKLSSPLAHGSANVQPRDIGSSRS------MDVLPSPLATDKNDGTVA 707
Query: 481 LVKSSSEKIKTTPAGEYLTAALNDFNPEQYDNLAVISDGANKLLMLVLAAVIKAGASREH 540
LVK+ SE +KTTPAGEYLTAALNDF+P+QY+ A ISDGANKLLMLVLAAVIKAGASREH
Sbjct: 708 LVKTGSEIVKTTPAGEYLTAALNDFDPDQYEGHAAISDGANKLLMLVLAAVIKAGASREH 767
Query: 541 EILAEIRDAVFAFIRKMEPTRVMDTMLVSRVRILYIRSLLARSPELQSIMVSPVECFLEK 600
EILAEIRD+VF+FIRKMEP +VMDTMLVSRVRILYIRSLLARSPELQSI V PVECFLEK
Sbjct: 768 EILAEIRDSVFSFIRKMEPKQVMDTMLVSRVRILYIRSLLARSPELQSIKVLPVECFLEK 827
Query: 601 SNTGRSRSSSRGSSPARSPVHYVDEKIQGFKINLKPEKKSKLSSVVLRMRGIDQDTWRHQ 660
+NTGRSRSSSRGSSP RSPV YVDE+IQGFK+NLKPEKKSK SSVVL++RGID+D WR Q
Sbjct: 828 TNTGRSRSSSRGSSPGRSPVLYVDEQIQGFKVNLKPEKKSKFSSVVLKIRGIDEDIWRQQ 887
Query: 661 VTGGKLREIQEEAKSFATGNKALAALFVHTPAGELQRQIRSWLAENFEFLSVTGDDASGG 720
VTGGKLREI EEAKSFA GN+ALAALFVHTPAGELQRQIRSWLAE+FEFLS+TG+DASGG
Sbjct: 888 VTGGKLREITEEAKSFAIGNRALAALFVHTPAGELQRQIRSWLAESFEFLSLTGEDASGG 947
Query: 721 TTGQLELLSTAIMDGWMAGLGGAVPPSTDALGQLLSEYAKRVYNSQLQHLKDIAGTLATE 780
+TGQLELLSTAIMDGWMAGLG A+PP TDALGQLL EY+KRVY SQLQHLKDIAGTLATE
Sbjct: 948 STGQLELLSTAIMDGWMAGLGAALPPHTDALGQLLFEYSKRVYTSQLQHLKDIAGTLATE 1007
Query: 781 DAEDASQVSKLRSALESVDHRRRKVLQQMRSDVALLTLEEGGSPIRNPSTAAEDARLASL 840
+AEDA+QV+KLRSALESVDH+RRK+LQQM+SD+ALLTLE GG PI+NPSTAAEDARLASL
Sbjct: 1008 EAEDAAQVAKLRSALESVDHKRRKILQQMKSDIALLTLENGGFPIQNPSTAAEDARLASL 1067
Query: 841 ISLDGILNQVKDAVRQSSVNTLSRSKKKAMLTSLDELAERMPSLLDIDHPCAQRQIADAR 900
ISLD IL Q+KD R SSVN L++SKKK ML SL+EL E+MPSLL+IDHPCAQR IADAR
Sbjct: 1068 ISLDSILKQIKDMTRLSSVNILTKSKKKTMLASLNELTEQMPSLLEIDHPCAQRHIADAR 1127
Query: 901 RMVE 904
MVE
Sbjct: 1128 YMVE 1131
|
Source: Glycine max Species: Glycine max Genus: Glycine Family: Fabaceae Order: Fabales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|449496402|ref|XP_004160125.1| PREDICTED: LOW QUALITY PROTEIN: geminivirus Rep-interacting motor protein-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449451393|ref|XP_004143446.1| PREDICTED: geminivirus Rep-interacting motor protein-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356567769|ref|XP_003552088.1| PREDICTED: geminivirus Rep-interacting motor protein-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356497704|ref|XP_003517699.1| PREDICTED: geminivirus Rep-interacting motor protein-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356501588|ref|XP_003519606.1| PREDICTED: geminivirus Rep-interacting motor protein-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|297811153|ref|XP_002873460.1| hypothetical protein ARALYDRAFT_487877 [Arabidopsis lyrata subsp. lyrata] gi|297319297|gb|EFH49719.1| hypothetical protein ARALYDRAFT_487877 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|15238169|ref|NP_196609.1| geminivirus Rep-interacting motor protein [Arabidopsis thaliana] gi|75311662|sp|Q9LX99.1|GRIMP_ARATH RecName: Full=Geminivirus Rep-interacting motor protein; AltName: Full=Geminivirus replication protein-interacting protein gi|7671456|emb|CAB89396.1| putative protein [Arabidopsis thaliana] gi|21428315|gb|AAM49809.1| geminivirus replication protein-interacting protein [Arabidopsis thaliana] gi|332004163|gb|AED91546.1| geminivirus Rep-interacting motor protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|145334367|ref|NP_001078565.1| geminivirus Rep-interacting motor protein [Arabidopsis thaliana] gi|332004164|gb|AED91547.1| geminivirus Rep-interacting motor protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|72255627|gb|AAZ66945.1| 117M18_26 [Brassica rapa] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 956 | ||||||
| UNIPROTKB|H3BTL6 | 280 | KIFC3 "Kinesin-like protein KI | 0.246 | 0.842 | 0.353 | 3.7e-28 | |
| TAIR|locus:2101645 | 1087 | KP1 "kinesin-like protein 1" [ | 0.261 | 0.229 | 0.338 | 1.3e-27 | |
| TAIR|locus:2148543 | 987 | ATK4 "kinesin 4" [Arabidopsis | 0.241 | 0.234 | 0.370 | 1.8e-27 | |
| UNIPROTKB|F1M8I8 | 778 | Kifc3 "Protein Kifc3" [Rattus | 0.246 | 0.303 | 0.357 | 3.7e-27 | |
| MGI|MGI:109202 | 824 | Kifc3 "kinesin family member C | 0.246 | 0.286 | 0.357 | 4.3e-27 | |
| UNIPROTKB|F1LPW9 | 824 | Kifc3 "Protein Kifc3" [Rattus | 0.246 | 0.286 | 0.357 | 4.3e-27 | |
| ZFIN|ZDB-GENE-060526-350 | 374 | si:dkey-96l17.6 "si:dkey-96l17 | 0.259 | 0.663 | 0.334 | 9.3e-27 | |
| UNIPROTKB|F1P110 | 399 | KIFC3 "Uncharacterized protein | 0.243 | 0.583 | 0.357 | 1.5e-26 | |
| TAIR|locus:2014129 | 1140 | AT1G18410 [Arabidopsis thalian | 0.264 | 0.221 | 0.35 | 1.7e-26 | |
| UNIPROTKB|E1BFA7 | 833 | LOC539231 "Uncharacterized pro | 0.246 | 0.283 | 0.361 | 2e-26 |
| UNIPROTKB|H3BTL6 KIFC3 "Kinesin-like protein KIFC3" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Score = 325 (119.5 bits), Expect = 3.7e-28, P = 3.7e-28
Identities = 87/246 (35%), Positives = 132/246 (53%)
Query: 1 MEGSSHDRGLYARCFEELFDLSNSDTTATARFNFAVTVFELYNEQLRELLPQTGNGLAKI 60
MEG++ + G+ R + LF + + + V+ E+YNE LR+LL + +I
Sbjct: 1 MEGTAENPGINQRALQLLFS-EVQEKASDWEYTITVSAAEIYNEVLRDLLGKEPQEKLEI 59
Query: 61 RL---QSLESSIE-LVQEKVDNPLEFSKVLKSAFQSRGNDVSKFNV----SHLIIMIHIY 112
RL S + + L + +V + + +KV + +R + + N SH ++++ +
Sbjct: 60 RLCPDGSGQLYVPGLTEFQVQSVDDINKVFEFGHTNRTTEFTNLNEHSSRSHALLIVTVR 119
Query: 113 YNNLITGENLYSKLSLVDLAGSEGLIAEDDSGERITDVLHVMKSLSALGDVLSSLTSRKD 172
+ TG KL+LVDLAGSE + G R+ + H+ KSLSALGDV+++L SR+
Sbjct: 120 GVDCSTGLRTTGKLNLVDLAGSERVGKSGAEGSRLREAQHINKSLSALGDVIAALRSRQG 179
Query: 173 IVPYENSMLTKVLADSLGESSKTLMIVNICPNAANMSETLSSLNFSSRARSTVLSLG-NR 231
VP+ NS LT +L DSL SKTLM+V + P N SETL SL F+ R RS L G R
Sbjct: 180 HVPFRNSKLTYLLQDSLSGDSKTLMVVQVSPVEKNTSETLYSLKFAERVRSVELGPGLRR 239
Query: 232 DTIKKW 237
+ W
Sbjct: 240 AELGSW 245
|
|
| TAIR|locus:2101645 KP1 "kinesin-like protein 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2148543 ATK4 "kinesin 4" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1M8I8 Kifc3 "Protein Kifc3" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:109202 Kifc3 "kinesin family member C3" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1LPW9 Kifc3 "Protein Kifc3" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-060526-350 si:dkey-96l17.6 "si:dkey-96l17.6" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1P110 KIFC3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2014129 AT1G18410 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BFA7 LOC539231 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| gw1.VII.4018.1 | SubName- Full=Putative uncharacterized protein; (1269 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 956 | |||
| cd00106 | 328 | cd00106, KISc, Kinesin motor domain | 1e-56 | |
| cd01366 | 329 | cd01366, KISc_C_terminal, Kinesin motor domain, KI | 3e-56 | |
| pfam00225 | 326 | pfam00225, Kinesin, Kinesin motor domain | 3e-55 | |
| smart00129 | 335 | smart00129, KISc, Kinesin motor, catalytic domain | 5e-44 | |
| cd01369 | 325 | cd01369, KISc_KHC_KIF5, Kinesin motor domain, kine | 1e-33 | |
| cd01371 | 333 | cd01371, KISc_KIF3, Kinesin motor domain, kinesins | 8e-30 | |
| cd01365 | 356 | cd01365, KISc_KIF1A_KIF1B, Kinesin motor domain, K | 8e-29 | |
| cd01372 | 341 | cd01372, KISc_KIF4, Kinesin motor domain, KIF4-lik | 2e-28 | |
| cd01370 | 338 | cd01370, KISc_KIP3_like, Kinesin motor domain, KIP | 1e-27 | |
| cd01364 | 352 | cd01364, KISc_BimC_Eg5, Kinesin motor domain, BimC | 8e-27 | |
| cd01376 | 319 | cd01376, KISc_KID_like, Kinesin motor domain, KIF2 | 3e-25 | |
| cd01373 | 337 | cd01373, KISc_KLP2_like, Kinesin motor domain, KLP | 5e-25 | |
| cd01375 | 334 | cd01375, KISc_KIF9_like, Kinesin motor domain, KIF | 1e-24 | |
| cd01367 | 322 | cd01367, KISc_KIF2_like, Kinesin motor domain, KIF | 3e-23 | |
| cd01374 | 321 | cd01374, KISc_CENP_E, Kinesin motor domain, CENP-E | 2e-22 | |
| COG5059 | 568 | COG5059, KIP1, Kinesin-like protein [Cytoskeleton] | 2e-22 | |
| cd01363 | 186 | cd01363, Motor_domain, Myosin and Kinesin motor do | 1e-17 | |
| cd01368 | 345 | cd01368, KISc_KIF23_like, Kinesin motor domain, KI | 6e-16 | |
| PLN03188 | 1320 | PLN03188, PLN03188, kinesin-12 family protein; Pro | 2e-15 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 3e-06 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 7e-05 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 1e-04 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 2e-04 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 3e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 4e-04 | |
| pfam13851 | 201 | pfam13851, GAS, Growth-arrest specific micro-tubul | 6e-04 | |
| COG1579 | 239 | COG1579, COG1579, Zn-ribbon protein, possibly nucl | 0.003 |
| >gnl|CDD|238054 cd00106, KISc, Kinesin motor domain | Back alignment and domain information |
|---|
Score = 198 bits (505), Expect = 1e-56
Identities = 85/233 (36%), Positives = 132/233 (56%), Gaps = 11/233 (4%)
Query: 1 MEGSSHDRGLYARCFEELFDLSNSDTTATARFNFAVTVFELYNEQLRELL-PQTGNGLAK 59
M GS D G+ R E+LF+L + F+ +V+ E+YNE++ +LL P+ +
Sbjct: 96 MFGSPKDPGIIPRALEDLFNLIDERKEKNKSFSVSVSYLEIYNEKVYDLLSPEPPSKPLS 155
Query: 60 IR-LQSLESSIE-LVQEKVDNPLEFSKVLKSAFQSRGNDVSKFN----VSHLIIMIHIYY 113
+R ++ L + +V + + +L+ ++R + N SH I IH+
Sbjct: 156 LREDPKGGVYVKGLTEVEVGSAEDALSLLQKGLKNRTTASTAMNERSSRSHAIFTIHVEQ 215
Query: 114 NNLITGENL--YSKLSLVDLAGSEGLIAEDDSGERITDVLHVMKSLSALGDVLSSLTS-- 169
N SKL+LVDLAGSE G+R+ + ++ KSLSALG+V+S+L+S
Sbjct: 216 RNTTNDGRSIKSSKLNLVDLAGSERAKKTGAEGDRLKEAKNINKSLSALGNVISALSSGQ 275
Query: 170 RKDIVPYENSMLTKVLADSLGESSKTLMIVNICPNAANMSETLSSLNFSSRAR 222
+K +PY +S LT++L DSLG +SKTLMI NI P++ N ETLS+L F+SRA+
Sbjct: 276 KKKHIPYRDSKLTRLLQDSLGGNSKTLMIANISPSSENYDETLSTLRFASRAK 328
|
This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type), in some its is found in the middle (M-type), or C-terminal (C-type). N-type and M-type kinesins are (+) end-directed motors, while C-type kinesins are (-) end-directed motors, i.e. they transport cargo towards the (-) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain, which repositions the other head domain through the coiled-coil domain close to a second tubulin dimer, about 80 Angstroms along the microtubule. Meanwhile, ATP hydrolysis takes place, and when the second head domain binds to the microtubule, the first domain again replaces ADP with ATP, triggering a conformational change that pulls the first domain forward. Length = 328 |
| >gnl|CDD|238662 cd01366, KISc_C_terminal, Kinesin motor domain, KIFC2/KIFC3/ncd-like carboxy-terminal kinesins | Back alignment and domain information |
|---|
| >gnl|CDD|215803 pfam00225, Kinesin, Kinesin motor domain | Back alignment and domain information |
|---|
| >gnl|CDD|214526 smart00129, KISc, Kinesin motor, catalytic domain | Back alignment and domain information |
|---|
| >gnl|CDD|238665 cd01369, KISc_KHC_KIF5, Kinesin motor domain, kinesin heavy chain (KHC) or KIF5-like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|238667 cd01371, KISc_KIF3, Kinesin motor domain, kinesins II or KIF3_like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|238661 cd01365, KISc_KIF1A_KIF1B, Kinesin motor domain, KIF1_like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|238668 cd01372, KISc_KIF4, Kinesin motor domain, KIF4-like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|238666 cd01370, KISc_KIP3_like, Kinesin motor domain, KIP3-like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|238660 cd01364, KISc_BimC_Eg5, Kinesin motor domain, BimC/Eg5 spindle pole proteins, participate in spindle assembly and chromosome segregation during cell division | Back alignment and domain information |
|---|
| >gnl|CDD|238672 cd01376, KISc_KID_like, Kinesin motor domain, KIF22/Kid-like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|238669 cd01373, KISc_KLP2_like, Kinesin motor domain, KLP2-like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|238671 cd01375, KISc_KIF9_like, Kinesin motor domain, KIF9-like subgroup; might play a role in cell shape remodeling | Back alignment and domain information |
|---|
| >gnl|CDD|238663 cd01367, KISc_KIF2_like, Kinesin motor domain, KIF2-like group | Back alignment and domain information |
|---|
| >gnl|CDD|238670 cd01374, KISc_CENP_E, Kinesin motor domain, CENP-E/KIP2-like subgroup, involved in chromosome movement and/or spindle elongation during mitosis | Back alignment and domain information |
|---|
| >gnl|CDD|227392 COG5059, KIP1, Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >gnl|CDD|238659 cd01363, Motor_domain, Myosin and Kinesin motor domain | Back alignment and domain information |
|---|
| >gnl|CDD|238664 cd01368, KISc_KIF23_like, Kinesin motor domain, KIF23-like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|215621 PLN03188, PLN03188, kinesin-12 family protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|222417 pfam13851, GAS, Growth-arrest specific micro-tubule binding | Back alignment and domain information |
|---|
| >gnl|CDD|224495 COG1579, COG1579, Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 956 | |||
| KOG0243 | 1041 | consensus Kinesin-like protein [Cytoskeleton] | 100.0 | |
| KOG0245 | 1221 | consensus Kinesin-like protein [Cytoskeleton] | 100.0 | |
| KOG0240 | 607 | consensus Kinesin (SMY1 subfamily) [Cytoskeleton] | 100.0 | |
| KOG4280 | 574 | consensus Kinesin-like protein [Cytoskeleton] | 100.0 | |
| KOG0247 | 809 | consensus Kinesin-like protein [Cytoskeleton] | 100.0 | |
| KOG0242 | 675 | consensus Kinesin-like protein [Cytoskeleton] | 100.0 | |
| PLN03188 | 1320 | kinesin-12 family protein; Provisional | 100.0 | |
| cd01370 | 338 | KISc_KIP3_like Kinesin motor domain, KIP3-like sub | 100.0 | |
| cd01373 | 337 | KISc_KLP2_like Kinesin motor domain, KLP2-like sub | 100.0 | |
| KOG0241 | 1714 | consensus Kinesin-like protein [Cytoskeleton] | 100.0 | |
| cd01368 | 345 | KISc_KIF23_like Kinesin motor domain, KIF23-like s | 100.0 | |
| cd01365 | 356 | KISc_KIF1A_KIF1B Kinesin motor domain, KIF1_like p | 100.0 | |
| cd01371 | 333 | KISc_KIF3 Kinesin motor domain, kinesins II or KIF | 100.0 | |
| cd01369 | 325 | KISc_KHC_KIF5 Kinesin motor domain, kinesin heavy | 100.0 | |
| cd01374 | 321 | KISc_CENP_E Kinesin motor domain, CENP-E/KIP2-like | 100.0 | |
| cd01364 | 352 | KISc_BimC_Eg5 Kinesin motor domain, BimC/Eg5 spind | 100.0 | |
| cd01376 | 319 | KISc_KID_like Kinesin motor domain, KIF22/Kid-like | 100.0 | |
| cd01367 | 322 | KISc_KIF2_like Kinesin motor domain, KIF2-like gro | 100.0 | |
| cd01366 | 329 | KISc_C_terminal Kinesin motor domain, KIFC2/KIFC3/ | 100.0 | |
| cd01372 | 341 | KISc_KIF4 Kinesin motor domain, KIF4-like subfamil | 100.0 | |
| cd01375 | 334 | KISc_KIF9_like Kinesin motor domain, KIF9-like sub | 100.0 | |
| PF00225 | 335 | Kinesin: Kinesin motor domain; InterPro: IPR001752 | 100.0 | |
| smart00129 | 335 | KISc Kinesin motor, catalytic domain. ATPase. Micr | 100.0 | |
| KOG0239 | 670 | consensus Kinesin (KAR3 subfamily) [Cytoskeleton] | 100.0 | |
| cd00106 | 328 | KISc Kinesin motor domain. This catalytic (head) d | 100.0 | |
| KOG0244 | 913 | consensus Kinesin-like protein [Cytoskeleton] | 100.0 | |
| COG5059 | 568 | KIP1 Kinesin-like protein [Cytoskeleton] | 100.0 | |
| KOG0246 | 676 | consensus Kinesin-like protein [Cytoskeleton] | 100.0 | |
| cd01363 | 186 | Motor_domain Myosin and Kinesin motor domain. Thes | 99.97 | |
| KOG0239 | 670 | consensus Kinesin (KAR3 subfamily) [Cytoskeleton] | 99.93 | |
| KOG1853 | 333 | consensus LIS1-interacting protein NUDE [Cytoskele | 97.45 | |
| PRK11637 | 428 | AmiB activator; Provisional | 97.25 | |
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 96.79 | |
| PRK11637 | 428 | AmiB activator; Provisional | 96.73 | |
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 96.67 | |
| TIGR02169 | 1164 | SMC_prok_A chromosome segregation protein SMC, pri | 96.48 | |
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 96.47 | |
| TIGR02169 | 1164 | SMC_prok_A chromosome segregation protein SMC, pri | 96.4 | |
| COG4942 | 420 | Membrane-bound metallopeptidase [Cell division and | 96.38 | |
| TIGR02168 | 1179 | SMC_prok_B chromosome segregation protein SMC, com | 96.3 | |
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 96.29 | |
| KOG0996 | 1293 | consensus Structural maintenance of chromosome pro | 96.13 | |
| TIGR02168 | 1179 | SMC_prok_B chromosome segregation protein SMC, com | 95.84 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 95.7 | |
| PF10481 | 307 | CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 | 95.68 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 95.62 | |
| COG4372 | 499 | Uncharacterized protein conserved in bacteria with | 95.62 | |
| PRK09039 | 343 | hypothetical protein; Validated | 95.56 | |
| PRK09039 | 343 | hypothetical protein; Validated | 95.51 | |
| PF14662 | 193 | CCDC155: Coiled-coil region of CCDC155 | 95.48 | |
| KOG0250 | 1074 | consensus DNA repair protein RAD18 (SMC family pro | 95.4 | |
| KOG0980 | 980 | consensus Actin-binding protein SLA2/Huntingtin-in | 95.39 | |
| PF14662 | 193 | CCDC155: Coiled-coil region of CCDC155 | 95.3 | |
| KOG0250 | 1074 | consensus DNA repair protein RAD18 (SMC family pro | 95.16 | |
| KOG0971 | 1243 | consensus Microtubule-associated protein dynactin | 95.08 | |
| KOG0971 | 1243 | consensus Microtubule-associated protein dynactin | 95.02 | |
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 95.01 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 94.83 | |
| PF13851 | 201 | GAS: Growth-arrest specific micro-tubule binding | 94.83 | |
| PF15254 | 861 | CCDC14: Coiled-coil domain-containing protein 14 | 94.8 | |
| PF05667 | 594 | DUF812: Protein of unknown function (DUF812); Inte | 94.78 | |
| PF09755 | 310 | DUF2046: Uncharacterized conserved protein H4 (DUF | 94.77 | |
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 94.69 | |
| PF09730 | 717 | BicD: Microtubule-associated protein Bicaudal-D; I | 94.67 | |
| KOG1853 | 333 | consensus LIS1-interacting protein NUDE [Cytoskele | 94.63 | |
| PF10168 | 717 | Nup88: Nuclear pore component; InterPro: IPR019321 | 94.62 | |
| KOG0996 | 1293 | consensus Structural maintenance of chromosome pro | 94.61 | |
| COG4942 | 420 | Membrane-bound metallopeptidase [Cell division and | 94.6 | |
| KOG0933 | 1174 | consensus Structural maintenance of chromosome pro | 94.57 | |
| PF05667 | 594 | DUF812: Protein of unknown function (DUF812); Inte | 94.54 | |
| PF00038 | 312 | Filament: Intermediate filament protein; InterPro: | 94.52 | |
| PF13851 | 201 | GAS: Growth-arrest specific micro-tubule binding | 94.36 | |
| KOG0161 | 1930 | consensus Myosin class II heavy chain [Cytoskeleto | 94.34 | |
| KOG0612 | 1317 | consensus Rho-associated, coiled-coil containing p | 94.34 | |
| KOG2129 | 552 | consensus Uncharacterized conserved protein H4 [Fu | 94.3 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 94.3 | |
| PF00261 | 237 | Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop | 94.16 | |
| KOG0161 | 1930 | consensus Myosin class II heavy chain [Cytoskeleto | 93.86 | |
| COG4372 | 499 | Uncharacterized protein conserved in bacteria with | 93.83 | |
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 93.78 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 93.77 | |
| KOG0977 | 546 | consensus Nuclear envelope protein lamin, intermed | 93.75 | |
| PF07926 | 132 | TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: | 93.73 | |
| KOG0999 | 772 | consensus Microtubule-associated protein Bicaudal- | 93.72 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 93.71 | |
| PF12718 | 143 | Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 | 93.66 | |
| KOG0977 | 546 | consensus Nuclear envelope protein lamin, intermed | 93.62 | |
| PF08317 | 325 | Spc7: Spc7 kinetochore protein; InterPro: IPR01325 | 93.57 | |
| KOG0978 | 698 | consensus E3 ubiquitin ligase involved in syntaxin | 93.47 | |
| KOG4643 | 1195 | consensus Uncharacterized coiled-coil protein [Fun | 93.37 | |
| COG3883 | 265 | Uncharacterized protein conserved in bacteria [Fun | 93.33 | |
| KOG1029 | 1118 | consensus Endocytic adaptor protein intersectin [S | 93.31 | |
| PF10174 | 775 | Cast: RIM-binding protein of the cytomatrix active | 93.29 | |
| KOG0995 | 581 | consensus Centromere-associated protein HEC1 [Cell | 93.22 | |
| COG5185 | 622 | HEC1 Protein involved in chromosome segregation, i | 93.21 | |
| KOG0999 | 772 | consensus Microtubule-associated protein Bicaudal- | 93.21 | |
| PRK03918 | 880 | chromosome segregation protein; Provisional | 93.13 | |
| PF04849 | 306 | HAP1_N: HAP1 N-terminal conserved region; InterPro | 93.02 | |
| KOG4673 | 961 | consensus Transcription factor TMF, TATA element m | 92.96 | |
| PF08317 | 325 | Spc7: Spc7 kinetochore protein; InterPro: IPR01325 | 92.95 | |
| KOG0933 | 1174 | consensus Structural maintenance of chromosome pro | 92.89 | |
| PF04849 | 306 | HAP1_N: HAP1 N-terminal conserved region; InterPro | 92.8 | |
| PF06785 | 401 | UPF0242: Uncharacterised protein family (UPF0242); | 92.79 | |
| PF15070 | 617 | GOLGA2L5: Putative golgin subfamily A member 2-lik | 92.78 | |
| PF10174 | 775 | Cast: RIM-binding protein of the cytomatrix active | 92.72 | |
| PF10168 | 717 | Nup88: Nuclear pore component; InterPro: IPR019321 | 92.64 | |
| KOG0980 | 980 | consensus Actin-binding protein SLA2/Huntingtin-in | 92.6 | |
| PF15619 | 194 | Lebercilin: Ciliary protein causing Leber congenit | 92.58 | |
| PF06785 | 401 | UPF0242: Uncharacterised protein family (UPF0242); | 92.57 | |
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 92.55 | |
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 92.5 | |
| PF09738 | 302 | DUF2051: Double stranded RNA binding protein (DUF2 | 92.48 | |
| PF12718 | 143 | Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 | 92.43 | |
| KOG0963 | 629 | consensus Transcription factor/CCAAT displacement | 92.43 | |
| PRK03918 | 880 | chromosome segregation protein; Provisional | 92.39 | |
| PRK10929 | 1109 | putative mechanosensitive channel protein; Provisi | 92.37 | |
| KOG0946 | 970 | consensus ER-Golgi vesicle-tethering protein p115 | 92.35 | |
| PF07058 | 351 | Myosin_HC-like: Myosin II heavy chain-like; InterP | 92.26 | |
| KOG0976 | 1265 | consensus Rho/Rac1-interacting serine/threonine ki | 92.2 | |
| PF05483 | 786 | SCP-1: Synaptonemal complex protein 1 (SCP-1); Int | 92.18 | |
| PF09728 | 309 | Taxilin: Myosin-like coiled-coil protein; InterPro | 92.12 | |
| PF09755 | 310 | DUF2046: Uncharacterized conserved protein H4 (DUF | 92.06 | |
| KOG2991 | 330 | consensus Splicing regulator [RNA processing and m | 91.87 | |
| PF12325 | 120 | TMF_TATA_bd: TATA element modulatory factor 1 TATA | 91.85 | |
| smart00787 | 312 | Spc7 Spc7 kinetochore protein. This domain is foun | 91.72 | |
| PF00261 | 237 | Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop | 91.7 | |
| KOG4674 | 1822 | consensus Uncharacterized conserved coiled-coil pr | 91.68 | |
| KOG4643 | 1195 | consensus Uncharacterized coiled-coil protein [Fun | 91.49 | |
| PF15070 | 617 | GOLGA2L5: Putative golgin subfamily A member 2-lik | 91.42 | |
| KOG0963 | 629 | consensus Transcription factor/CCAAT displacement | 91.42 | |
| KOG1850 | 391 | consensus Myosin-like coiled-coil protein [Cytoske | 91.35 | |
| PRK11281 | 1113 | hypothetical protein; Provisional | 91.06 | |
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 91.03 | |
| smart00787 | 312 | Spc7 Spc7 kinetochore protein. This domain is foun | 90.99 | |
| KOG0976 | 1265 | consensus Rho/Rac1-interacting serine/threonine ki | 90.95 | |
| KOG0804 | 493 | consensus Cytoplasmic Zn-finger protein BRAP2 (BRC | 90.93 | |
| KOG4809 | 654 | consensus Rab6 GTPase-interacting protein involved | 90.91 | |
| KOG0994 | 1758 | consensus Extracellular matrix glycoprotein Lamini | 90.67 | |
| PF15619 | 194 | Lebercilin: Ciliary protein causing Leber congenit | 90.65 | |
| KOG0982 | 502 | consensus Centrosomal protein Nuf [Cell cycle cont | 90.59 | |
| KOG0964 | 1200 | consensus Structural maintenance of chromosome pro | 90.51 | |
| PF09789 | 319 | DUF2353: Uncharacterized coiled-coil protein (DUF2 | 90.47 | |
| PRK04778 | 569 | septation ring formation regulator EzrA; Provision | 90.4 | |
| KOG0804 | 493 | consensus Cytoplasmic Zn-finger protein BRAP2 (BRC | 90.38 | |
| KOG0978 | 698 | consensus E3 ubiquitin ligase involved in syntaxin | 90.15 | |
| PF14915 | 305 | CCDC144C: CCDC144C protein coiled-coil region | 90.03 | |
| KOG1029 | 1118 | consensus Endocytic adaptor protein intersectin [S | 89.96 | |
| KOG4360 | 596 | consensus Uncharacterized coiled coil protein [Fun | 89.84 | |
| KOG4673 | 961 | consensus Transcription factor TMF, TATA element m | 89.69 | |
| KOG0612 | 1317 | consensus Rho-associated, coiled-coil containing p | 89.62 | |
| PF04156 | 191 | IncA: IncA protein; InterPro: IPR007285 Chlamydia | 89.04 | |
| PF11559 | 151 | ADIP: Afadin- and alpha -actinin-Binding; InterPro | 88.88 | |
| KOG4674 | 1822 | consensus Uncharacterized conserved coiled-coil pr | 88.73 | |
| COG5185 | 622 | HEC1 Protein involved in chromosome segregation, i | 88.59 | |
| PF05483 | 786 | SCP-1: Synaptonemal complex protein 1 (SCP-1); Int | 88.3 | |
| KOG0288 | 459 | consensus WD40 repeat protein TipD [General functi | 88.22 | |
| PRK04778 | 569 | septation ring formation regulator EzrA; Provision | 88.17 | |
| PF05010 | 207 | TACC: Transforming acidic coiled-coil-containing p | 88.11 | |
| KOG0995 | 581 | consensus Centromere-associated protein HEC1 [Cell | 87.64 | |
| PF12128 | 1201 | DUF3584: Protein of unknown function (DUF3584); In | 87.47 | |
| PF04156 | 191 | IncA: IncA protein; InterPro: IPR007285 Chlamydia | 87.47 | |
| KOG0018 | 1141 | consensus Structural maintenance of chromosome pro | 87.17 | |
| KOG0964 | 1200 | consensus Structural maintenance of chromosome pro | 87.06 | |
| KOG0994 | 1758 | consensus Extracellular matrix glycoprotein Lamini | 86.81 | |
| PF12128 | 1201 | DUF3584: Protein of unknown function (DUF3584); In | 86.72 | |
| KOG0946 | 970 | consensus ER-Golgi vesicle-tethering protein p115 | 86.68 | |
| PRK10884 | 206 | SH3 domain-containing protein; Provisional | 86.52 | |
| TIGR01005 | 754 | eps_transp_fam exopolysaccharide transport protein | 86.47 | |
| PF15066 | 527 | CAGE1: Cancer-associated gene protein 1 family | 86.31 | |
| PF08614 | 194 | ATG16: Autophagy protein 16 (ATG16); InterPro: IPR | 86.2 | |
| PRK01156 | 895 | chromosome segregation protein; Provisional | 85.99 | |
| KOG4360 | 596 | consensus Uncharacterized coiled coil protein [Fun | 85.91 | |
| PF00038 | 312 | Filament: Intermediate filament protein; InterPro: | 85.61 | |
| PF05701 | 522 | WEMBL: Weak chloroplast movement under blue light; | 85.31 | |
| PF10146 | 230 | zf-C4H2: Zinc finger-containing protein ; InterPro | 85.24 | |
| KOG0018 | 1141 | consensus Structural maintenance of chromosome pro | 85.13 | |
| PF13863 | 126 | DUF4200: Domain of unknown function (DUF4200) | 85.04 | |
| PF10498 | 359 | IFT57: Intra-flagellar transport protein 57 ; Inte | 85.04 | |
| PF00769 | 246 | ERM: Ezrin/radixin/moesin family; InterPro: IPR011 | 84.98 | |
| KOG2129 | 552 | consensus Uncharacterized conserved protein H4 [Fu | 84.81 | |
| TIGR03007 | 498 | pepcterm_ChnLen polysaccharide chain length determ | 84.81 | |
| PF10267 | 395 | Tmemb_cc2: Predicted transmembrane and coiled-coil | 84.68 | |
| KOG2991 | 330 | consensus Splicing regulator [RNA processing and m | 84.24 | |
| PF15294 | 278 | Leu_zip: Leucine zipper | 84.23 | |
| PF07926 | 132 | TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: | 84.22 | |
| PRK11281 | 1113 | hypothetical protein; Provisional | 84.15 | |
| PRK10884 | 206 | SH3 domain-containing protein; Provisional | 84.04 | |
| TIGR01843 | 423 | type_I_hlyD type I secretion membrane fusion prote | 84.04 | |
| PRK01156 | 895 | chromosome segregation protein; Provisional | 83.96 | |
| PF10186 | 302 | Atg14: UV radiation resistance protein and autopha | 83.86 | |
| PF10186 | 302 | Atg14: UV radiation resistance protein and autopha | 83.68 | |
| PF15397 | 258 | DUF4618: Domain of unknown function (DUF4618) | 83.57 | |
| KOG4807 | 593 | consensus F-actin binding protein, regulates actin | 83.13 | |
| PF00769 | 246 | ERM: Ezrin/radixin/moesin family; InterPro: IPR011 | 82.84 | |
| KOG4593 | 716 | consensus Mitotic checkpoint protein MAD1 [Cell cy | 82.72 | |
| TIGR02680 | 1353 | conserved hypothetical protein TIGR02680. Members | 82.6 | |
| TIGR03007 | 498 | pepcterm_ChnLen polysaccharide chain length determ | 82.51 | |
| COG1340 | 294 | Uncharacterized archaeal coiled-coil protein [Func | 82.35 | |
| PF08614 | 194 | ATG16: Autophagy protein 16 (ATG16); InterPro: IPR | 82.19 | |
| KOG4593 | 716 | consensus Mitotic checkpoint protein MAD1 [Cell cy | 81.85 | |
| PF05911 | 769 | DUF869: Plant protein of unknown function (DUF869) | 81.6 | |
| TIGR03017 | 444 | EpsF chain length determinant protein EpsF. Sequen | 81.28 | |
| PF11932 | 251 | DUF3450: Protein of unknown function (DUF3450); In | 80.75 | |
| TIGR03319 | 514 | YmdA_YtgF conserved hypothetical protein YmdA/YtgF | 80.7 | |
| PF13870 | 177 | DUF4201: Domain of unknown function (DUF4201) | 80.53 | |
| PF06818 | 202 | Fez1: Fez1; InterPro: IPR009638 This family repres | 80.3 | |
| PF09789 | 319 | DUF2353: Uncharacterized coiled-coil protein (DUF2 | 80.3 | |
| PF15254 | 861 | CCDC14: Coiled-coil domain-containing protein 14 | 80.29 | |
| PF10146 | 230 | zf-C4H2: Zinc finger-containing protein ; InterPro | 80.26 | |
| PF04111 | 314 | APG6: Autophagy protein Apg6; InterPro: IPR007243 | 80.17 | |
| TIGR03185 | 650 | DNA_S_dndD DNA sulfur modification protein DndD. T | 80.16 |
| >KOG0243 consensus Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
Probab=100.00 E-value=4.1e-56 Score=529.99 Aligned_cols=381 Identities=24% Similarity=0.330 Sum_probs=274.5
Q ss_pred CCCCCChHHHHHHHHHHhhccCCCCCceEEEEEEEEEEEcCcccccCCcCCCC--CceEeec-----ccc--cccceeEE
Q 002175 4 SSHDRGLYARCFEELFDLSNSDTTATARFNFAVTVFELYNEQLRELLPQTGNG--LAKIRLQ-----SLE--SSIELVQE 74 (956)
Q Consensus 4 s~~d~GIIPRal~dLF~~I~~~~~~~~~fsVsVSylEIYNE~V~DLL~~~~~~--~~~v~~~-----~~~--~V~gLtev 74 (956)
.+.+.|||||++.+||+.+.. .+.+|+|+|||+|+|||.++|||++.... ..++..+ +.+ .|.|+.++
T Consensus 157 l~~~aGIIPRal~~IFd~Le~---~~~EYsvKVSfLELYNEEl~DLLa~~~~~~~~~~~k~~~~~~~~kggV~vkGlEEi 233 (1041)
T KOG0243|consen 157 LPSEAGIIPRALRQIFDTLEA---QGAEYSVKVSFLELYNEELTDLLASEDTSDKKLRIKDDSTIVDGKGGVIVKGLEEI 233 (1041)
T ss_pred CCccCCcchHHHHHHHHHHHh---cCCeEEEEEEehhhhhHHHHHhcCCccccccccccccCCcccCCcCcEEEecceee
Confidence 678899999999999999974 44899999999999999999999986653 2222222 223 45599999
Q ss_pred EeCCHHHHHHHHHHHHhhccCcCCC----CCcceEEEEEEEEeeccCCC---ceeeeeeEEeeccCCCccccCCCcchhh
Q 002175 75 KVDNPLEFSKVLKSAFQSRGNDVSK----FNVSHLIIMIHIYYNNLITG---ENLYSKLSLVDLAGSEGLIAEDDSGERI 147 (956)
Q Consensus 75 ~V~S~eE~l~lL~~G~~~R~~asT~----SSRSH~IFtI~V~q~~~~~~---~~~~SkLsfVDLAGSER~~kt~s~G~rl 147 (956)
.|.|..|++.+|..|...|++++|. |||||+||+|+|.......+ -..+|||+||||||||.++++|+.+.|.
T Consensus 234 ~V~~A~ei~klLekGs~kRrtAaTl~N~~SSRSHsIFsItvhike~t~~geelvK~GKLNLVDLAGSENI~RSGA~~~RA 313 (1041)
T KOG0243|consen 234 IVTNADEIYKLLEKGSKKRRTAATLMNDQSSRSHSIFSITVHIKENTPEGEELVKIGKLNLVDLAGSENISRSGARNGRA 313 (1041)
T ss_pred eecchhHHHHHHHhhhhHhHHHHHHhhhhccccceEEEEEEEEecCCCcchhhHhhcccceeeccccccccccccccchh
Confidence 9999999999999999999999997 99999999999987644322 3567999999999999999999999999
Q ss_pred HhHHHHhhhHHHHHHHHHHhhcCCCCcCCCCCchhhhhccccCCCCeEEEEEeeCCCCCCHHHhHHHHHHHHHhcccccc
Q 002175 148 TDVLHVMKSLSALGDVLSSLTSRKDIVPYENSMLTKVLADSLGESSKTLMIVNICPNAANMSETLSSLNFSSRARSTVLS 227 (956)
Q Consensus 148 kEa~~INkSL~aLg~VI~aLs~k~~~VPYRdSKLTrLLqDsLgGNSkT~mIv~VSPs~~~~eETLsTLrFAsrAK~I~~~ 227 (956)
+||+.||+||++||+||+||.++..|||||+|||||||||+|||.++|+||+||||+..+++||++||.||.|||+|+++
T Consensus 314 rEAG~INqSLLTLGRVInALVe~s~HIPYRESKLTRLLQDSLGGkTKT~iIATiSPa~~~lEETlSTLEYA~RAKnIkNK 393 (1041)
T KOG0243|consen 314 REAGEINQSLLTLGRVINALVEHSGHIPYRESKLTRLLQDSLGGKTKTCIIATISPAKHNLEETLSTLEYAHRAKNIKNK 393 (1041)
T ss_pred HHhhhhhHHHHHHHHHHHHHHccCCCCCchHHHHHHHHHHHhCCCceeEEEEEeCCCcccHHHHHHHHHHHHHhhhccCC
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999887
Q ss_pred cCccchhhhhhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHhhHHHHHH--HHHHHHHHhhhHHHHHHHHH
Q 002175 228 LGNRDTIKKWRDIANDARKELYEREKEIQDLKQEILGLRQALKEANDQCVLLYNEVQK--AWKVSFTLQSDLKSENYMLA 305 (956)
Q Consensus 228 ~~n~~~i~k~k~~~~~~r~el~~~~~eI~~Lq~EI~~Lk~~L~~~~~q~~~l~~Elq~--~~k~~~eLE~eL~~e~~~Le 305 (956)
|..+..+. +...+++|-.||++|+..+....+.+-.+..+-.- ..........++.+....++
T Consensus 394 PevNQkl~---------------K~~llKd~~~EIerLK~dl~AaReKnGvyisee~y~~~e~e~~~~~~~ieele~el~ 458 (1041)
T KOG0243|consen 394 PEVNQKLM---------------KKTLLKDLYEEIERLKRDLAAAREKNGVYISEERYTQEEKEKKEMAEQIEELEEELE 458 (1041)
T ss_pred CccchHHH---------------HHHHHHHHHHHHHHHHHHHHHhHhhCceEechHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 76665443 34566777777888887777776665443322111 00001111122222222222
Q ss_pred HHHHHHHHHHHHH---HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcccccccccCCCCccccccc
Q 002175 306 DKHKIEKEQNAQL---RNQVAQLLQLEQEQKMQIQQRDSTIKTLQAKINSIESQRNEALHSSEVRSTIRSEPMPAVSSVL 382 (956)
Q Consensus 306 ek~k~~kee~~qL---q~ql~~l~~~eeElk~qlqe~e~eIe~LqeEik~LE~qL~el~~s~~~rs~~~~es~~~s~s~~ 382 (956)
...+..+...+.+ ......+....+.++.+++....++..+++++.+++.+|.+.....+.
T Consensus 459 ~~~~~l~~~~e~~~~~~~~~~~l~~~~~~~k~~L~~~~~el~~~~ee~~~~~~~l~~~e~ii~~---------------- 522 (1041)
T KOG0243|consen 459 NLEKQLKDLTELYMNQLEIKELLKEEKEKLKSKLQNKNKELESLKEELQQAKATLKEEEEIISQ---------------- 522 (1041)
T ss_pred HHHHHHHHHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH----------------
Confidence 2222211111111 112223333444466666666666777777777766665433322221
Q ss_pred cccccccChhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhh
Q 002175 383 RTTGDGMDSSAVSKKLEEELKKRDALIERLHEENEKLFDRLTEK 426 (956)
Q Consensus 383 k~~ee~~d~s~l~kkLeEELkkree~LErL~eE~ekL~qrL~eK 426 (956)
......++.....++...++.-..+...|+.+|..+
T Consensus 523 --------~~~se~~l~~~a~~l~~~~~~s~~d~s~l~~kld~~ 558 (1041)
T KOG0243|consen 523 --------QEKSEEKLVDRATKLRRSLEESQDDLSSLFEKLDRK 558 (1041)
T ss_pred --------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhh
Confidence 111122333334445555566666777777777777
|
|
| >KOG0245 consensus Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0240 consensus Kinesin (SMY1 subfamily) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG4280 consensus Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0247 consensus Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0242 consensus Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >PLN03188 kinesin-12 family protein; Provisional | Back alignment and domain information |
|---|
| >cd01370 KISc_KIP3_like Kinesin motor domain, KIP3-like subgroup | Back alignment and domain information |
|---|
| >cd01373 KISc_KLP2_like Kinesin motor domain, KLP2-like subgroup | Back alignment and domain information |
|---|
| >KOG0241 consensus Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >cd01368 KISc_KIF23_like Kinesin motor domain, KIF23-like subgroup | Back alignment and domain information |
|---|
| >cd01365 KISc_KIF1A_KIF1B Kinesin motor domain, KIF1_like proteins | Back alignment and domain information |
|---|
| >cd01371 KISc_KIF3 Kinesin motor domain, kinesins II or KIF3_like proteins | Back alignment and domain information |
|---|
| >cd01369 KISc_KHC_KIF5 Kinesin motor domain, kinesin heavy chain (KHC) or KIF5-like subgroup | Back alignment and domain information |
|---|
| >cd01374 KISc_CENP_E Kinesin motor domain, CENP-E/KIP2-like subgroup, involved in chromosome movement and/or spindle elongation during mitosis | Back alignment and domain information |
|---|
| >cd01364 KISc_BimC_Eg5 Kinesin motor domain, BimC/Eg5 spindle pole proteins, participate in spindle assembly and chromosome segregation during cell division | Back alignment and domain information |
|---|
| >cd01376 KISc_KID_like Kinesin motor domain, KIF22/Kid-like subgroup | Back alignment and domain information |
|---|
| >cd01367 KISc_KIF2_like Kinesin motor domain, KIF2-like group | Back alignment and domain information |
|---|
| >cd01366 KISc_C_terminal Kinesin motor domain, KIFC2/KIFC3/ncd-like carboxy-terminal kinesins | Back alignment and domain information |
|---|
| >cd01372 KISc_KIF4 Kinesin motor domain, KIF4-like subfamily | Back alignment and domain information |
|---|
| >cd01375 KISc_KIF9_like Kinesin motor domain, KIF9-like subgroup; might play a role in cell shape remodeling | Back alignment and domain information |
|---|
| >PF00225 Kinesin: Kinesin motor domain; InterPro: IPR001752 Kinesin [, , ] is a microtubule-associated force-producing protein that may play a role in organelle transport | Back alignment and domain information |
|---|
| >smart00129 KISc Kinesin motor, catalytic domain | Back alignment and domain information |
|---|
| >KOG0239 consensus Kinesin (KAR3 subfamily) [Cytoskeleton] | Back alignment and domain information |
|---|
| >cd00106 KISc Kinesin motor domain | Back alignment and domain information |
|---|
| >KOG0244 consensus Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >COG5059 KIP1 Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0246 consensus Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >cd01363 Motor_domain Myosin and Kinesin motor domain | Back alignment and domain information |
|---|
| >KOG0239 consensus Kinesin (KAR3 subfamily) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1853 consensus LIS1-interacting protein NUDE [Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PF14662 CCDC155: Coiled-coil region of CCDC155 | Back alignment and domain information |
|---|
| >KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF14662 CCDC155: Coiled-coil region of CCDC155 | Back alignment and domain information |
|---|
| >KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >PF13851 GAS: Growth-arrest specific micro-tubule binding | Back alignment and domain information |
|---|
| >PF15254 CCDC14: Coiled-coil domain-containing protein 14 | Back alignment and domain information |
|---|
| >PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain | Back alignment and domain information |
|---|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] | Back alignment and domain information |
|---|
| >KOG1853 consensus LIS1-interacting protein NUDE [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs | Back alignment and domain information |
|---|
| >KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope | Back alignment and domain information |
|---|
| >PF13851 GAS: Growth-arrest specific micro-tubule binding | Back alignment and domain information |
|---|
| >KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2129 consensus Uncharacterized conserved protein H4 [Function unknown] | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] | Back alignment and domain information |
|---|
| >PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) | Back alignment and domain information |
|---|
| >KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] | Back alignment and domain information |
|---|
| >PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] | Back alignment and domain information |
|---|
| >KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >COG3883 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] | Back alignment and domain information |
|---|
| >KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK03918 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues | Back alignment and domain information |
|---|
| >KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription] | Back alignment and domain information |
|---|
| >PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] | Back alignment and domain information |
|---|
| >KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues | Back alignment and domain information |
|---|
| >PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function | Back alignment and domain information |
|---|
| >PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 | Back alignment and domain information |
|---|
| >PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] | Back alignment and domain information |
|---|
| >PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs | Back alignment and domain information |
|---|
| >KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease | Back alignment and domain information |
|---|
| >PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >PF09738 DUF2051: Double stranded RNA binding protein (DUF2051); InterPro: IPR019139 This entry represents transcriptional repressors which preferentially bind to the GC-rich consensus sequence (5'-AGCCCCCGGCG-3') and may regulate expression of TNF, EGFR and PDGFA | Back alignment and domain information |
|---|
| >PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription] | Back alignment and domain information |
|---|
| >PRK03918 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PRK10929 putative mechanosensitive channel protein; Provisional | Back alignment and domain information |
|---|
| >KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF07058 Myosin_HC-like: Myosin II heavy chain-like; InterPro: IPR009768 This family represents a conserved region within a number of myosin II heavy chain-like proteins that seem to be specific to Arabidopsis thaliana | Back alignment and domain information |
|---|
| >KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex | Back alignment and domain information |
|---|
| >PF09728 Taxilin: Myosin-like coiled-coil protein; InterPro: IPR019132 Taxilin contains an extraordinarily long coiled-coil domain in its C-terminal half and is ubiquitously expressed | Back alignment and domain information |
|---|
| >PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain | Back alignment and domain information |
|---|
| >KOG2991 consensus Splicing regulator [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] | Back alignment and domain information |
|---|
| >smart00787 Spc7 Spc7 kinetochore protein | Back alignment and domain information |
|---|
| >PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 | Back alignment and domain information |
|---|
| >KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription] | Back alignment and domain information |
|---|
| >KOG1850 consensus Myosin-like coiled-coil protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK11281 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >smart00787 Spc7 Spc7 kinetochore protein | Back alignment and domain information |
|---|
| >KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4809 consensus Rab6 GTPase-interacting protein involved in endosome-to-TGN transport [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] | Back alignment and domain information |
|---|
| >PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease | Back alignment and domain information |
|---|
| >KOG0982 consensus Centrosomal protein Nuf [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function | Back alignment and domain information |
|---|
| >PRK04778 septation ring formation regulator EzrA; Provisional | Back alignment and domain information |
|---|
| >KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14915 CCDC144C: CCDC144C protein coiled-coil region | Back alignment and domain information |
|---|
| >KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG4360 consensus Uncharacterized coiled coil protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription] | Back alignment and domain information |
|---|
| >KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion | Back alignment and domain information |
|---|
| >PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch | Back alignment and domain information |
|---|
| >KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex | Back alignment and domain information |
|---|
| >KOG0288 consensus WD40 repeat protein TipD [General function prediction only] | Back alignment and domain information |
|---|
| >PRK04778 septation ring formation regulator EzrA; Provisional | Back alignment and domain information |
|---|
| >PF05010 TACC: Transforming acidic coiled-coil-containing protein (TACC); InterPro: IPR007707 This family contains the proteins TACC 1, 2 and 3, found concentrated in the centrosomes of eukaryotes which may play a conserved role in organising centrosomal microtubules | Back alignment and domain information |
|---|
| >KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion | Back alignment and domain information |
|---|
| >KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] | Back alignment and domain information |
|---|
| >PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK10884 SH3 domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01005 eps_transp_fam exopolysaccharide transport protein family | Back alignment and domain information |
|---|
| >PF15066 CAGE1: Cancer-associated gene protein 1 family | Back alignment and domain information |
|---|
| >PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >PRK01156 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >KOG4360 consensus Uncharacterized coiled coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope | Back alignment and domain information |
|---|
| >PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function | Back alignment and domain information |
|---|
| >PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF13863 DUF4200: Domain of unknown function (DUF4200) | Back alignment and domain information |
|---|
| >PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms | Back alignment and domain information |
|---|
| >PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] | Back alignment and domain information |
|---|
| >KOG2129 consensus Uncharacterized conserved protein H4 [Function unknown] | Back alignment and domain information |
|---|
| >TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >PF10267 Tmemb_cc2: Predicted transmembrane and coiled-coil 2 protein; InterPro: IPR019394 This family of transmembrane coiled-coil containing proteins is conserved from worms to humans | Back alignment and domain information |
|---|
| >KOG2991 consensus Splicing regulator [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF15294 Leu_zip: Leucine zipper | Back alignment and domain information |
|---|
| >PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) | Back alignment and domain information |
|---|
| >PRK11281 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK10884 SH3 domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >PRK01156 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking | Back alignment and domain information |
|---|
| >PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking | Back alignment and domain information |
|---|
| >PF15397 DUF4618: Domain of unknown function (DUF4618) | Back alignment and domain information |
|---|
| >KOG4807 consensus F-actin binding protein, regulates actin cytoskeletal organization [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] | Back alignment and domain information |
|---|
| >KOG4593 consensus Mitotic checkpoint protein MAD1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR02680 conserved hypothetical protein TIGR02680 | Back alignment and domain information |
|---|
| >TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >KOG4593 consensus Mitotic checkpoint protein MAD1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants | Back alignment and domain information |
|---|
| >TIGR03017 EpsF chain length determinant protein EpsF | Back alignment and domain information |
|---|
| >PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function | Back alignment and domain information |
|---|
| >TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF | Back alignment and domain information |
|---|
| >PF13870 DUF4201: Domain of unknown function (DUF4201) | Back alignment and domain information |
|---|
| >PF06818 Fez1: Fez1; InterPro: IPR009638 This family represents the eukaryotic Fez1 protein | Back alignment and domain information |
|---|
| >PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function | Back alignment and domain information |
|---|
| >PF15254 CCDC14: Coiled-coil domain-containing protein 14 | Back alignment and domain information |
|---|
| >PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 956 | ||||
| 2h58_A | 330 | Crystal Structure Of The Kifc3 Motor Domain In Comp | 1e-27 | ||
| 1sdm_A | 369 | Crystal Structure Of Kinesin-Like Calmodulin Bindin | 5e-25 | ||
| 3h4s_A | 386 | Structure Of The Complex Of A Mitotic Kinesin With | 6e-25 | ||
| 2vvg_A | 350 | Crystal Structure Of The G.Intestinalis Kinesin 2 G | 2e-23 | ||
| 3t0q_A | 349 | Motor Domain Structure Of The Kar3-Like Kinesin Fro | 4e-23 | ||
| 1goj_A | 355 | Structure Of A Fast Kinesin: Implications For Atpas | 7e-23 | ||
| 4etp_A | 403 | C-Terminal Motor And Motor Homology Domain Of Kar3v | 3e-22 | ||
| 4atx_C | 340 | Rigor Kinesin Motor Domain With An Ordered Neck-Lin | 4e-22 | ||
| 1mkj_A | 349 | Human Kinesin Motor Domain With Docked Neck Linker | 5e-22 | ||
| 1bg2_A | 325 | Human Ubiquitous Kinesin Motor Domain Length = 325 | 7e-22 | ||
| 2y5w_A | 365 | Crystal Structure Of Drosophila Melanogaster Kinesi | 2e-21 | ||
| 3gbj_A | 354 | Crystal Structure Of The Motor Domain Of Kinesin Ki | 2e-21 | ||
| 1f9v_A | 347 | Crystal Structures Of Mutants Reveal A Signalling P | 3e-21 | ||
| 1f9u_A | 347 | Crystal Structures Of Mutants Reveal A Signalling P | 5e-21 | ||
| 4h1g_A | 715 | Structure Of Candida Albicans Kar3 Motor Domain Fus | 5e-21 | ||
| 1f9t_A | 358 | Crystal Structures Of Kinesin Mutants Reveal A Sign | 5e-21 | ||
| 3kar_A | 346 | The Motor Domain Of Kinesin-Like Protein Kar3, A Sa | 8e-21 | ||
| 3b6u_A | 372 | Crystal Structure Of The Motor Domain Of Human Kine | 1e-20 | ||
| 4gkr_A | 371 | Structure Of The C-Terminal Motor Domain Of Kar3 Fr | 3e-20 | ||
| 2rep_A | 376 | Crystal Structure Of The Motor Domain Of Human Kine | 3e-20 | ||
| 1f9w_A | 347 | Crystal Structures Of Mutants Reveal A Signalling P | 4e-20 | ||
| 2wbe_C | 373 | Kinesin-5-Tubulin Complex With Amppnp Length = 373 | 7e-20 | ||
| 2owm_A | 443 | Motor Domain Of Neurospora Crassa Kinesin-3 (Nckin3 | 2e-19 | ||
| 4aqv_C | 373 | Model Of Human Kinesin-5 Motor Domain (3hqd) And Ma | 1e-18 | ||
| 4a14_A | 344 | Human Kif7, A Kinesin Involved In Hedgehog Signalli | 1e-18 | ||
| 1ii6_A | 368 | Crystal Structure Of The Mitotic Kinesin Eg5 In Com | 2e-18 | ||
| 4a28_A | 368 | Eg5-2 Length = 368 | 2e-18 | ||
| 1q0b_A | 367 | Crystal Structure Of The Motor Protein Ksp In Compl | 2e-18 | ||
| 4ap0_A | 370 | The Mitotic Kinesin Eg5 In Complex With Mg-Adp And | 2e-18 | ||
| 4a1z_A | 368 | Eg5-1 Length = 368 | 2e-18 | ||
| 3hqd_A | 369 | Human Kinesin Eg5 Motor Domain In Complex With Ampp | 2e-18 | ||
| 1x88_A | 359 | Human Eg5 Motor Domain Bound To Mg-Adp And Monastro | 2e-18 | ||
| 3zcw_A | 348 | Eg5 - New Allosteric Binding Site Length = 348 | 3e-18 | ||
| 2xt3_A | 344 | Human Kif7, A Kinesin Involved In Hedgehog Signalli | 7e-17 | ||
| 1ia0_K | 394 | Kif1a Head-Microtubule Complex Structure In Atp-For | 1e-16 | ||
| 1i5s_A | 367 | Crystal Structure Of The Kif1a Motor Domain Complex | 2e-16 | ||
| 1i6i_A | 366 | Crystal Structure Of The Kif1a Motor Domain Complex | 2e-16 | ||
| 1vfv_A | 366 | Crystal Structure Of The Kif1a Motor Domain Complex | 3e-16 | ||
| 3bfn_A | 388 | Crystal Structure Of The Motor Domain Of Human Kine | 1e-15 | ||
| 1n6m_A | 409 | Rotation Of The StalkNECK AND ONE HEAD IN A NEW CRY | 1e-15 | ||
| 3lre_A | 355 | Crystal Structure Analysis Of Human Kinesin-8 Motor | 1e-15 | ||
| 2ncd_A | 420 | Ncd (Non-Claret Disjunctional) Dimer From D. Melano | 1e-15 | ||
| 1cz7_A | 406 | The Crystal Structure Of A Minus-End Directed Micro | 2e-15 | ||
| 3u06_A | 412 | Crystal Structure Of The Kinesin-14 Ncdg347d Length | 2e-15 | ||
| 3l1c_A | 383 | Kinesin-14 Protein Ncd, T436s Mutant Length = 383 | 3e-15 | ||
| 3nwn_A | 359 | Crystal Structure Of The Human Kif9 Motor Domain In | 2e-14 | ||
| 2heh_A | 387 | Crystal Structure Of The Kif2c Motor Domain (Casp T | 3e-14 | ||
| 1v8j_A | 410 | The Crystal Structure Of The Minimal Functional Dom | 5e-14 | ||
| 3b6v_A | 395 | Crystal Structure Of The Motor Domain Of Human Kine | 1e-13 | ||
| 3edl_D | 331 | Kinesin13-Microtubule Ring Complex Length = 331 | 1e-13 | ||
| 2gry_A | 420 | Crystal Structure Of The Human Kif2 Motor Domain In | 3e-12 | ||
| 3dc4_A | 344 | Crystal Structure Of The Drosophila Kinesin Family | 2e-11 | ||
| 1ry6_A | 360 | Crystal Structure Of Internal Kinesin Motor Domain | 5e-11 | ||
| 3pxn_A | 344 | Crystal Structure Of The Drosophila Kinesin Family | 5e-11 | ||
| 1t5c_A | 349 | Crystal Structure Of The Motor Domain Of Human Kine | 1e-09 | ||
| 3kin_B | 117 | Kinesin (Dimeric) From Rattus Norvegicus Length = 1 | 7e-09 | ||
| 2kin_B | 100 | Kinesin (Monomeric) From Rattus Norvegicus Length = | 7e-08 | ||
| 2kin_A | 238 | Kinesin (Monomeric) From Rattus Norvegicus Length = | 2e-06 |
| >pdb|2H58|A Chain A, Crystal Structure Of The Kifc3 Motor Domain In Complex With Adp Length = 330 | Back alignment and structure |
|
| >pdb|1SDM|A Chain A, Crystal Structure Of Kinesin-Like Calmodulin Binding Protein Length = 369 | Back alignment and structure |
| >pdb|3H4S|A Chain A, Structure Of The Complex Of A Mitotic Kinesin With Its Calcium Binding Regulator Length = 386 | Back alignment and structure |
| >pdb|2VVG|A Chain A, Crystal Structure Of The G.Intestinalis Kinesin 2 Gikin2a Motor Domain Length = 350 | Back alignment and structure |
| >pdb|3T0Q|A Chain A, Motor Domain Structure Of The Kar3-Like Kinesin From Ashbya Gossypii Length = 349 | Back alignment and structure |
| >pdb|1GOJ|A Chain A, Structure Of A Fast Kinesin: Implications For Atpase Mechanism And Interactions With Microtubules Length = 355 | Back alignment and structure |
| >pdb|4ETP|A Chain A, C-Terminal Motor And Motor Homology Domain Of Kar3vik1 Fused To A Synthetic Heterodimeric Coiled Coil Length = 403 | Back alignment and structure |
| >pdb|4ATX|C Chain C, Rigor Kinesin Motor Domain With An Ordered Neck-Linker, Docked On Tubulin Dimer, Modelled Into The 8a Cryo-Em Map Of Doublecortin-Microtubules Decorated With Kinesin Length = 340 | Back alignment and structure |
| >pdb|1MKJ|A Chain A, Human Kinesin Motor Domain With Docked Neck Linker Length = 349 | Back alignment and structure |
| >pdb|1BG2|A Chain A, Human Ubiquitous Kinesin Motor Domain Length = 325 | Back alignment and structure |
| >pdb|2Y5W|A Chain A, Crystal Structure Of Drosophila Melanogaster Kinesin-1 Motor Domain Dimer Length = 365 | Back alignment and structure |
| >pdb|3GBJ|A Chain A, Crystal Structure Of The Motor Domain Of Kinesin Kif13b Bound With Adp Length = 354 | Back alignment and structure |
| >pdb|1F9V|A Chain A, Crystal Structures Of Mutants Reveal A Signalling Pathway For Activation Of The Kinesin Motor Atpase Length = 347 | Back alignment and structure |
| >pdb|1F9U|A Chain A, Crystal Structures Of Mutants Reveal A Signalling Pathway For Activation Of The Kinesin Motor Atpase Length = 347 | Back alignment and structure |
| >pdb|4H1G|A Chain A, Structure Of Candida Albicans Kar3 Motor Domain Fused To Maltose- Binding Protein Length = 715 | Back alignment and structure |
| >pdb|1F9T|A Chain A, Crystal Structures Of Kinesin Mutants Reveal A Signalling Pathway For Activation Of The Motor Atpase Length = 358 | Back alignment and structure |
| >pdb|3KAR|A Chain A, The Motor Domain Of Kinesin-Like Protein Kar3, A Saccharomyces Cerevisiae Kinesin-Related Protein Length = 346 | Back alignment and structure |
| >pdb|3B6U|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member 3b In Complex With Adp Length = 372 | Back alignment and structure |
| >pdb|4GKR|A Chain A, Structure Of The C-Terminal Motor Domain Of Kar3 From Candida Glabrata Length = 371 | Back alignment and structure |
| >pdb|2REP|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member C1 Length = 376 | Back alignment and structure |
| >pdb|1F9W|A Chain A, Crystal Structures Of Mutants Reveal A Signalling Pathway For Activation Of The Kinesin Motor Atpase Length = 347 | Back alignment and structure |
| >pdb|2WBE|C Chain C, Kinesin-5-Tubulin Complex With Amppnp Length = 373 | Back alignment and structure |
| >pdb|2OWM|A Chain A, Motor Domain Of Neurospora Crassa Kinesin-3 (Nckin3) Length = 443 | Back alignment and structure |
| >pdb|4AQV|C Chain C, Model Of Human Kinesin-5 Motor Domain (3hqd) And Mammalian Tubulin Heterodimer (1jff) Docked Into The 9.7-angstrom Cryo-em Map Of Microtubule-bound Kinesin-5 Motor Domain In The Ampppnp State. Length = 373 | Back alignment and structure |
| >pdb|4A14|A Chain A, Human Kif7, A Kinesin Involved In Hedgehog Signalling Length = 344 | Back alignment and structure |
| >pdb|1II6|A Chain A, Crystal Structure Of The Mitotic Kinesin Eg5 In Complex With Mg-Adp. Length = 368 | Back alignment and structure |
| >pdb|4A28|A Chain A, Eg5-2 Length = 368 | Back alignment and structure |
| >pdb|1Q0B|A Chain A, Crystal Structure Of The Motor Protein Ksp In Complex With Adp And Monastrol Length = 367 | Back alignment and structure |
| >pdb|4AP0|A Chain A, The Mitotic Kinesin Eg5 In Complex With Mg-Adp And Ispinesib Length = 370 | Back alignment and structure |
| >pdb|4A1Z|A Chain A, Eg5-1 Length = 368 | Back alignment and structure |
| >pdb|3HQD|A Chain A, Human Kinesin Eg5 Motor Domain In Complex With Amppnp And Mg2+ Length = 369 | Back alignment and structure |
| >pdb|1X88|A Chain A, Human Eg5 Motor Domain Bound To Mg-Adp And Monastrol Length = 359 | Back alignment and structure |
| >pdb|3ZCW|A Chain A, Eg5 - New Allosteric Binding Site Length = 348 | Back alignment and structure |
| >pdb|2XT3|A Chain A, Human Kif7, A Kinesin Involved In Hedgehog Signalling Length = 344 | Back alignment and structure |
| >pdb|1IA0|K Chain K, Kif1a Head-Microtubule Complex Structure In Atp-Form Length = 394 | Back alignment and structure |
| >pdb|1I5S|A Chain A, Crystal Structure Of The Kif1a Motor Domain Complexed With Mg-Adp Length = 367 | Back alignment and structure |
| >pdb|1I6I|A Chain A, Crystal Structure Of The Kif1a Motor Domain Complexed With Mg-Amppcp Length = 366 | Back alignment and structure |
| >pdb|1VFV|A Chain A, Crystal Structure Of The Kif1a Motor Domain Complexed With Mg-Amppnp Length = 366 | Back alignment and structure |
| >pdb|3BFN|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member 22 Length = 388 | Back alignment and structure |
| >pdb|1N6M|A Chain A, Rotation Of The StalkNECK AND ONE HEAD IN A NEW CRYSTAL Structure Of The Kinesin Motor Protein, Ncd Length = 409 | Back alignment and structure |
| >pdb|3LRE|A Chain A, Crystal Structure Analysis Of Human Kinesin-8 Motor Domain Length = 355 | Back alignment and structure |
| >pdb|2NCD|A Chain A, Ncd (Non-Claret Disjunctional) Dimer From D. Melanogaster Length = 420 | Back alignment and structure |
| >pdb|1CZ7|A Chain A, The Crystal Structure Of A Minus-End Directed Microtubule Motor Protein Ncd Reveals Variable Dimer Conformations Length = 406 | Back alignment and structure |
| >pdb|3U06|A Chain A, Crystal Structure Of The Kinesin-14 Ncdg347d Length = 412 | Back alignment and structure |
| >pdb|3L1C|A Chain A, Kinesin-14 Protein Ncd, T436s Mutant Length = 383 | Back alignment and structure |
| >pdb|3NWN|A Chain A, Crystal Structure Of The Human Kif9 Motor Domain In Complex With Adp Length = 359 | Back alignment and structure |
| >pdb|2HEH|A Chain A, Crystal Structure Of The Kif2c Motor Domain (Casp Target) Length = 387 | Back alignment and structure |
| >pdb|1V8J|A Chain A, The Crystal Structure Of The Minimal Functional Domain Of The Microtubule Destabilizer Kif2c Complexed With Mg-adp Length = 410 | Back alignment and structure |
| >pdb|3B6V|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member 3c In Complex With Adp Length = 395 | Back alignment and structure |
| >pdb|3EDL|D Chain D, Kinesin13-Microtubule Ring Complex Length = 331 | Back alignment and structure |
| >pdb|2GRY|A Chain A, Crystal Structure Of The Human Kif2 Motor Domain In Complex With Adp Length = 420 | Back alignment and structure |
| >pdb|3DC4|A Chain A, Crystal Structure Of The Drosophila Kinesin Family Member Nod In Complex With Adp Length = 344 | Back alignment and structure |
| >pdb|1RY6|A Chain A, Crystal Structure Of Internal Kinesin Motor Domain Length = 360 | Back alignment and structure |
| >pdb|3PXN|A Chain A, Crystal Structure Of The Drosophila Kinesin Family Member Kin10NOD IN Complex With Divalent Manganese And Adp Length = 344 | Back alignment and structure |
| >pdb|1T5C|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinetochore Protein Cenp-E Length = 349 | Back alignment and structure |
| >pdb|3KIN|B Chain B, Kinesin (Dimeric) From Rattus Norvegicus Length = 117 | Back alignment and structure |
| >pdb|2KIN|B Chain B, Kinesin (Monomeric) From Rattus Norvegicus Length = 100 | Back alignment and structure |
| >pdb|2KIN|A Chain A, Kinesin (Monomeric) From Rattus Norvegicus Length = 238 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 956 | |||
| 3cob_A | 369 | Kinesin heavy chain-like protein; motor, switch II | 5e-58 | |
| 2h58_A | 330 | Kinesin-like protein KIFC3 variant; motor domain, | 2e-55 | |
| 2rep_A | 376 | Kinesin-like protein KIFC1; structural genomics co | 7e-54 | |
| 3u06_A | 412 | Protein claret segregational; motor domain, stalk | 1e-53 | |
| 3t0q_A | 349 | AGR253WP; kinesin, alpha and beta proteins, P-loop | 3e-52 | |
| 1f9v_A | 347 | Kinesin-like protein KAR3; kinesin-related protein | 1e-51 | |
| 4etp_A | 403 | Kinesin-like protein KAR3; kinesin motor protein, | 1e-50 | |
| 1bg2_A | 325 | Kinesin; motor protein, ATPase, microtubule associ | 3e-45 | |
| 3bfn_A | 388 | Kinesin-like protein KIF22; limited proteolysis, s | 2e-43 | |
| 2nr8_A | 358 | Kinesin-like protein KIF9; motor domain, ADP, stru | 8e-42 | |
| 2vvg_A | 350 | Kinesin-2; motor protein, nucleotide-binding, micr | 2e-41 | |
| 2y65_A | 365 | Kinesin, kinesin heavy chain; motor protein; HET: | 1e-40 | |
| 1goj_A | 355 | Kinesin, kinesin heavy chain; motor protein, ATPas | 7e-40 | |
| 3dc4_A | 344 | Kinesin-like protein NOD; catalytic domain, ATPase | 1e-39 | |
| 3gbj_A | 354 | KIF13B protein; kinesin, motor domain, ADP, struct | 2e-39 | |
| 3lre_A | 355 | Kinesin-like protein KIF18A; motor protein, nucleo | 3e-37 | |
| 2zfi_A | 366 | Kinesin-like protein KIF1A, kinesin heavy chain is | 3e-37 | |
| 1x88_A | 359 | Kinesin-like protein KIF11; switch II, motor domai | 3e-36 | |
| 2owm_A | 443 | Nckin3-434, related to kinesin-like protein KIF1C; | 5e-36 | |
| 1ry6_A | 360 | Internal kinesin; kinesin motor domain, nucleotide | 9e-36 | |
| 2wbe_C | 373 | Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mit | 1e-35 | |
| 3b6u_A | 372 | Kinesin-like protein KIF3B; structural genomics co | 3e-35 | |
| 1t5c_A | 349 | CENP-E protein, centromeric protein E; kinesin mot | 5e-35 | |
| 2heh_A | 387 | KIF2C protein; kinesin, motor domain, ADP, structu | 1e-34 | |
| 4a14_A | 344 | Kinesin, kinesin-like protein KIF7; motor protein, | 3e-34 | |
| 1v8k_A | 410 | Kinesin-like protein KIF2C; microtubule destabiliz | 6e-34 | |
| 3kin_B | 117 | Kinesin heavy chain; motor protein, cytoskeleton; | 2e-22 | |
| 2kin_B | 100 | Kinesin; motor protein, cytoskeleton; HET: ADP; 2. | 9e-21 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 6e-13 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-10 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-09 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 5e-08 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 2e-08 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 1e-04 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 7e-04 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 9e-04 | |
| 1sjj_A | 863 | Actinin; 3-helix bundle, calponin homology domain, | 2e-04 |
| >3cob_A Kinesin heavy chain-like protein; motor, switch II, loop L11, conformation, nucleotide, ATP-binding, microtubule, motor protein; HET: ADP; 2.20A {Solanum tuberosum} SCOP: c.37.1.9 PDB: 3cnz_A* 1sdm_A* 3h4s_A* Length = 369 | Back alignment and structure |
|---|
Score = 202 bits (517), Expect = 5e-58
Identities = 85/283 (30%), Positives = 133/283 (46%), Gaps = 27/283 (9%)
Query: 1 MEGSSHDRGLYARCFEELFDLSNSDTTATARFNFAVTVFELYNEQLRELLPQTGNGLAKI 60
+ G+ + GL R ELF + D+ F+ + ELY + L +LL K+
Sbjct: 97 IYGADSNPGLTPRAMSELFRIMKKDS-NKFSFSLKAYMVELYQDTLVDLLLPKQAKRLKL 155
Query: 61 RL-QSLESSIE---LVQEKVDNPLEFSKVLKSAFQSRGNDVSKFNV----SHLIIMIHIY 112
+ + + + + + E +++ + R + N SHLI+ + I
Sbjct: 156 DIKKDSKGMVSVENVTVVSISTYEELKTIIQRGSEQRHTTGTLMNEQSSRSHLIVSVIIE 215
Query: 113 YNNLITGENLYSKLSLVDLAGSEGLIAEDDSGERITDVLHVMKSLSALGDVLSSLTSRKD 172
NL T KLS VDLAGSE + +G ++ + + KSLSALGDV+S+L+S
Sbjct: 216 STNLQTQAIARGKLSFVDLAGSERVKKSGSAGNQLKEAQSINKSLSALGDVISALSSGNQ 275
Query: 173 IVPYENSMLTKVLADSLGESSKTLMIVNICPNAANMSETLSSLNFSSRARSTVLSLGNRD 232
+PY N LT +++DSLG ++KTLM VNI P +N+ ET +SL ++SR RS
Sbjct: 276 HIPYRNHKLTMLMSDSLGGNAKTLMFVNISPAESNLDETHNSLTYASRVRS--------- 326
Query: 233 TIKKWRDIANDARKELYEREKEIQDLKQEILGLRQALKEANDQ 275
I ND K KE+ LK+ + ++ D
Sbjct: 327 -------IVNDPSKN--VSSKEVARLKKLVSYWKEQAGRKGDD 360
|
| >2h58_A Kinesin-like protein KIFC3 variant; motor domain, ADP, structural genomics, structur Al genomics consortium, SGC; HET: ADP; 1.85A {Homo sapiens} Length = 330 | Back alignment and structure |
|---|
| >2rep_A Kinesin-like protein KIFC1; structural genomics consortium, motor domain, ADP, binding, cell cycle, cell division, endosome, microtubule; HET: ADP; 2.60A {Homo sapiens} Length = 376 | Back alignment and structure |
|---|
| >3u06_A Protein claret segregational; motor domain, stalk rotation, power stroke, kinesin-14, MICR binding, NCD, transport, molecular motor; HET: ADP GOL; 2.35A {Drosophila melanogaster} PDB: 2ncd_A* 1n6m_A* 1cz7_A* 3l1c_A* Length = 412 | Back alignment and structure |
|---|
| >3t0q_A AGR253WP; kinesin, alpha and beta proteins, P-loop containing nucleosi triphosphate hydrolases, microtubule motor protein; HET: ADP; 2.35A {Ashbya gossypii} Length = 349 | Back alignment and structure |
|---|
| >1f9v_A Kinesin-like protein KAR3; kinesin-related protein, motor protein, microtubinding proteinbule, contractIle protein; HET: ADP; 1.30A {Saccharomyces cerevisiae} SCOP: c.37.1.9 PDB: 1f9t_A* 1f9w_A* 1f9u_A* 3kar_A* Length = 347 | Back alignment and structure |
|---|
| >4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} Length = 403 | Back alignment and structure |
|---|
| >1bg2_A Kinesin; motor protein, ATPase, microtubule associated; HET: ADP; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 2p4n_K* 1mkj_A* 2kin_A* 3kin_A* Length = 325 | Back alignment and structure |
|---|
| >3bfn_A Kinesin-like protein KIF22; limited proteolysis, structural genomics consortium domain, ADP, SGC, ATP-binding, DNA-binding, microtubule, MO protein; HET: ADP; 2.30A {Homo sapiens} Length = 388 | Back alignment and structure |
|---|
| >2vvg_A Kinesin-2; motor protein, nucleotide-binding, microtubule, ATP-binding; HET: ADP; 1.60A {Giardia intestinalis} Length = 350 | Back alignment and structure |
|---|
| >2y65_A Kinesin, kinesin heavy chain; motor protein; HET: ADP; 2.20A {Drosophila melanogaster} PDB: 2y5w_A* Length = 365 | Back alignment and structure |
|---|
| >1goj_A Kinesin, kinesin heavy chain; motor protein, ATPase; HET: ADP; 2.3A {Neurospora crassa} SCOP: c.37.1.9 Length = 355 | Back alignment and structure |
|---|
| >3dc4_A Kinesin-like protein NOD; catalytic domain, ATPase, microtubule, ADP, nucleotide-binding protein, ATP-binding, coiled coil, motor protein; HET: ADP; 1.90A {Drosophila melanogaster} PDB: 3dcb_A* 3dco_N* 3pxn_A* Length = 344 | Back alignment and structure |
|---|
| >3gbj_A KIF13B protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, ATP-binding, microtubule, motor protein; HET: ADP; 2.10A {Homo sapiens} Length = 354 | Back alignment and structure |
|---|
| >3lre_A Kinesin-like protein KIF18A; motor protein, nucleotide binding, microtubule binding, ATP- cell projection, cytoskeleton, glycoprotein, microtubule; HET: ADP; 2.20A {Homo sapiens} Length = 355 | Back alignment and structure |
|---|
| >2zfi_A Kinesin-like protein KIF1A, kinesin heavy chain isoform 5C; alpha and beta protein, enzyme, ATPase, P-loop, motor protein, ATP-binding, coiled coil; HET: ADP; 1.55A {Mus musculus} SCOP: c.37.1.9 PDB: 1vfw_A* 1vfx_A* 1vfz_A* 1vfv_A* 2zfj_A* 2zfk_A* 2zfl_A* 2zfm_A* 1i5s_A* 1i6i_A* 2hxf_C* 1ia0_K* 2hxh_C* Length = 366 | Back alignment and structure |
|---|
| >1x88_A Kinesin-like protein KIF11; switch II, motor domain, NECK linker, cell cycle; HET: ADP NAT; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 3hqd_A* 3ken_A* 2pg2_A* 1yrs_A* 2fme_A* 2g1q_A* 2gm1_A* 1ii6_A* 2uyi_A* 2uym_A* 2wog_A* 2x2r_A* 2x7c_A* 2x7d_A* 2x7e_A* 2xae_A* 3k3b_A* 3k5e_A* 3l9h_A* 1q0b_A* ... Length = 359 | Back alignment and structure |
|---|
| >2owm_A Nckin3-434, related to kinesin-like protein KIF1C; motor domain, ADP, NECK linker, motor PR; HET: ADP; 3.25A {Neurospora crassa} Length = 443 | Back alignment and structure |
|---|
| >1ry6_A Internal kinesin; kinesin motor domain, nucleotide-free, transport protein; 1.60A {Plasmodium falciparum} SCOP: c.37.1.9 Length = 360 | Back alignment and structure |
|---|
| >2wbe_C Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mitosis, GTP-binding, motor protein, cell division, cell cycle, microtubule, ATP-binding; HET: GTP ANP GDP TA1; 9.40A {Drosophila melanogaster} Length = 373 | Back alignment and structure |
|---|
| >3b6u_A Kinesin-like protein KIF3B; structural genomics consortium, motor domain, ADP, SGC, ATP-binding, coiled coil, microtubule, motor protein; HET: ADP; 1.80A {Homo sapiens} PDB: 3b6v_A* Length = 372 | Back alignment and structure |
|---|
| >1t5c_A CENP-E protein, centromeric protein E; kinesin motor-domain-ADP complex, stranded beta-sheet core with solvent exposed alpha-helices; HET: ADP PIN; 2.50A {Homo sapiens} Length = 349 | Back alignment and structure |
|---|
| >2heh_A KIF2C protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, structural protein; HET: ADP; 2.15A {Homo sapiens} PDB: 3edl_D* Length = 387 | Back alignment and structure |
|---|
| >4a14_A Kinesin, kinesin-like protein KIF7; motor protein, motor domain; HET: ADP; 1.60A {Homo sapiens} PDB: 2xt3_A* Length = 344 | Back alignment and structure |
|---|
| >1v8k_A Kinesin-like protein KIF2C; microtubule destabilizer, structural P; HET: ANP; 2.25A {Mus musculus} SCOP: c.37.1.9 PDB: 1v8j_A* 2gry_A* Length = 410 | Back alignment and structure |
|---|
| >3kin_B Kinesin heavy chain; motor protein, cytoskeleton; HET: ADP; 3.10A {Rattus norvegicus} SCOP: c.37.1.9 Length = 117 | Back alignment and structure |
|---|
| >2kin_B Kinesin; motor protein, cytoskeleton; HET: ADP; 2.00A {Rattus norvegicus} SCOP: c.37.1.9 Length = 100 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Length = 863 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 956 | |||
| 3cob_A | 369 | Kinesin heavy chain-like protein; motor, switch II | 100.0 | |
| 2h58_A | 330 | Kinesin-like protein KIFC3 variant; motor domain, | 100.0 | |
| 2y65_A | 365 | Kinesin, kinesin heavy chain; motor protein; HET: | 100.0 | |
| 2vvg_A | 350 | Kinesin-2; motor protein, nucleotide-binding, micr | 100.0 | |
| 2zfi_A | 366 | Kinesin-like protein KIF1A, kinesin heavy chain is | 100.0 | |
| 1bg2_A | 325 | Kinesin; motor protein, ATPase, microtubule associ | 100.0 | |
| 3bfn_A | 388 | Kinesin-like protein KIF22; limited proteolysis, s | 100.0 | |
| 1goj_A | 355 | Kinesin, kinesin heavy chain; motor protein, ATPas | 100.0 | |
| 1f9v_A | 347 | Kinesin-like protein KAR3; kinesin-related protein | 100.0 | |
| 2rep_A | 376 | Kinesin-like protein KIFC1; structural genomics co | 100.0 | |
| 1t5c_A | 349 | CENP-E protein, centromeric protein E; kinesin mot | 100.0 | |
| 2wbe_C | 373 | Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mit | 100.0 | |
| 2owm_A | 443 | Nckin3-434, related to kinesin-like protein KIF1C; | 100.0 | |
| 3t0q_A | 349 | AGR253WP; kinesin, alpha and beta proteins, P-loop | 100.0 | |
| 3lre_A | 355 | Kinesin-like protein KIF18A; motor protein, nucleo | 100.0 | |
| 3gbj_A | 354 | KIF13B protein; kinesin, motor domain, ADP, struct | 100.0 | |
| 3b6u_A | 372 | Kinesin-like protein KIF3B; structural genomics co | 100.0 | |
| 1x88_A | 359 | Kinesin-like protein KIF11; switch II, motor domai | 100.0 | |
| 4etp_A | 403 | Kinesin-like protein KAR3; kinesin motor protein, | 100.0 | |
| 4a14_A | 344 | Kinesin, kinesin-like protein KIF7; motor protein, | 100.0 | |
| 1ry6_A | 360 | Internal kinesin; kinesin motor domain, nucleotide | 100.0 | |
| 2nr8_A | 358 | Kinesin-like protein KIF9; motor domain, ADP, stru | 100.0 | |
| 3nwn_A | 359 | Kinesin-like protein KIF9; motor domain, ADP, stru | 100.0 | |
| 3u06_A | 412 | Protein claret segregational; motor domain, stalk | 100.0 | |
| 2heh_A | 387 | KIF2C protein; kinesin, motor domain, ADP, structu | 100.0 | |
| 3dc4_A | 344 | Kinesin-like protein NOD; catalytic domain, ATPase | 100.0 | |
| 4h1g_A | 715 | Maltose binding protein-cakar3 motor domain fusio; | 100.0 | |
| 1v8k_A | 410 | Kinesin-like protein KIF2C; microtubule destabiliz | 100.0 | |
| 2kin_B | 100 | Kinesin; motor protein, cytoskeleton; HET: ADP; 2. | 99.9 | |
| 3kin_B | 117 | Kinesin heavy chain; motor protein, cytoskeleton; | 99.9 | |
| 2o0a_A | 298 | S.cerevisiae chromosome XVI reading frame ORF YPL2 | 97.43 | |
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 96.91 | |
| 2v71_A | 189 | Nuclear distribution protein NUDE-like 1; developm | 96.51 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 96.46 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 96.36 | |
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 96.01 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 96.0 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 95.76 | |
| 3ghg_A | 562 | Fibrinogen alpha chain; triple-stranded coiled coi | 95.66 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 95.66 | |
| 2v71_A | 189 | Nuclear distribution protein NUDE-like 1; developm | 95.48 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 95.11 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 95.04 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 94.94 | |
| 3o0z_A | 168 | RHO-associated protein kinase 1; coiled-coil, tran | 94.47 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 93.7 | |
| 2fxo_A | 129 | Myosin heavy chain, cardiac muscle beta isoform; c | 93.46 | |
| 1deq_A | 390 | Fibrinogen (alpha chain); coiled-coil, blood clott | 91.41 | |
| 1deq_A | 390 | Fibrinogen (alpha chain); coiled-coil, blood clott | 90.63 | |
| 1m1j_A | 491 | Fibrinogen alpha subunit; coiled coils, disulfide | 90.44 | |
| 3mq7_A | 121 | Bone marrow stromal antigen 2; HIV, antiviral prot | 85.01 | |
| 3ghg_A | 562 | Fibrinogen alpha chain; triple-stranded coiled coi | 84.56 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 84.21 | |
| 2ocy_A | 154 | RAB guanine nucleotide exchange factor SEC2; RAB, | 83.31 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 83.15 | |
| 3hnw_A | 138 | Uncharacterized protein; coiled-coil, structural g | 83.04 | |
| 3mq9_A | 471 | Bone marrow stromal antigen 2 fused to maltose-BI | 80.6 |
| >3cob_A Kinesin heavy chain-like protein; motor, switch II, loop L11, conformation, nucleotide, ATP-binding, microtubule, motor protein; HET: ADP; 2.20A {Solanum tuberosum} SCOP: c.37.1.9 PDB: 3cnz_A* 1sdm_A* 3h4s_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=2.5e-55 Score=488.92 Aligned_cols=251 Identities=33% Similarity=0.447 Sum_probs=221.6
Q ss_pred CCCCCCCCChHHHHHHHHHHhhccCCCCCceEEEEEEEEEEEcCcccccCCcCCC--CCceEeeccc--ccccceeEEEe
Q 002175 1 MEGSSHDRGLYARCFEELFDLSNSDTTATARFNFAVTVFELYNEQLRELLPQTGN--GLAKIRLQSL--ESSIELVQEKV 76 (956)
Q Consensus 1 M~Gs~~d~GIIPRal~dLF~~I~~~~~~~~~fsVsVSylEIYNE~V~DLL~~~~~--~~~~v~~~~~--~~V~gLtev~V 76 (956)
|+|+++++|||||++++||+.+... .....|.|+|||+|||||+|||||.+... ....++.+.. .+|.|++++.|
T Consensus 97 M~G~~~~~Giipr~~~~lF~~i~~~-~~~~~~~v~vS~~EIYnE~i~DLL~~~~~~~~~l~i~e~~~~~~~v~gl~~~~v 175 (369)
T 3cob_A 97 IYGADSNPGLTPRAMSELFRIMKKD-SNKFSFSLKAYMVELYQDTLVDLLLPKQAKRLKLDIKKDSKGMVSVENVTVVSI 175 (369)
T ss_dssp HTBCSSSBCHHHHHHHHHHHHHHHT-TTTEEEEEEEEEEEECSSCEEESSCCSSSCCCCCEEEECTTSCEEEETCCCEEE
T ss_pred ecCCCCCCchhHHHHHHHHHHHHhh-ccCceeEEEEEEEEEeCceeeecCCCcccCCcceEEEECCCCCEEccCCEEEEe
Confidence 7899999999999999999999864 34479999999999999999999988543 3445666554 35679999999
Q ss_pred CCHHHHHHHHHHHHhhccCcCCC----CCcceEEEEEEEEeeccCCCceeeeeeEEeeccCCCccccCCCcchhhHhHHH
Q 002175 77 DNPLEFSKVLKSAFQSRGNDVSK----FNVSHLIIMIHIYYNNLITGENLYSKLSLVDLAGSEGLIAEDDSGERITDVLH 152 (956)
Q Consensus 77 ~S~eE~l~lL~~G~~~R~~asT~----SSRSH~IFtI~V~q~~~~~~~~~~SkLsfVDLAGSER~~kt~s~G~rlkEa~~ 152 (956)
.|++|++.+|..|.++|++++|. |||||+||+|+|.+.+...+....|+|+|||||||||..++++.|.+++|+.+
T Consensus 176 ~s~~e~~~ll~~g~~~R~~~~T~~N~~SSRSH~if~i~v~~~~~~~~~~~~skL~lVDLAGSEr~~~t~~~g~rl~E~~~ 255 (369)
T 3cob_A 176 STYEELKTIIQRGSEQRHTTGTLMNEQSSRSHLIVSVIIESTNLQTQAIARGKLSFVDLAGSERVKKSGSAGNQLKEAQS 255 (369)
T ss_dssp CSHHHHHHHHHHHHHHTCCCSCCTTCHHHHSEEEEEEEEEEEETTTCCEEEEEEEEEECCCSSCCCCCSSCSHHHHHHHH
T ss_pred CCHHHHHHHHHHHhhcceeecccCCCCCCcceEEEEEEEEEecCCCCcEEEEEEEEEeCCCCCcccccCccchhhHHHHH
Confidence 99999999999999999999987 99999999999999988888888999999999999999999999999999999
Q ss_pred HhhhHHHHHHHHHHhhcCCCCcCCCCCchhhhhccccCCCCeEEEEEeeCCCCCCHHHhHHHHHHHHHhcccccccCccc
Q 002175 153 VMKSLSALGDVLSSLTSRKDIVPYENSMLTKVLADSLGESSKTLMIVNICPNAANMSETLSSLNFSSRARSTVLSLGNRD 232 (956)
Q Consensus 153 INkSL~aLg~VI~aLs~k~~~VPYRdSKLTrLLqDsLgGNSkT~mIv~VSPs~~~~eETLsTLrFAsrAK~I~~~~~n~~ 232 (956)
||+||++||+||.+|++++.|||||+||||+||+|+|||||+|+||+||||+..+++||++||+||+||++|++.+..+.
T Consensus 256 INkSL~aLg~vI~aL~~~~~hvPyRdSkLT~lLqdsLgGnskt~mIa~isP~~~~~~ETl~TLrfA~rak~i~~~~~~n~ 335 (369)
T 3cob_A 256 INKSLSALGDVISALSSGNQHIPYRNHKLTMLMSDSLGGNAKTLMFVNISPAESNLDETHNSLTYASRVRSIVNDPSKNV 335 (369)
T ss_dssp HTHHHHHHHHHHHHHHTTCSCCCGGGCHHHHHTTTTTTSSSEEEEEEEECCBGGGHHHHHHHHHHHHHHHTCBCCCCCCE
T ss_pred HHHHHHHHHHHHHHHhcCCCcCCCcCCHHHHHHHHhcCCCccEEEEEEeCCccccHHHHHHHHHHHHHHhhcccCCcccC
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999887665543
Q ss_pred hhhhhhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 002175 233 TIKKWRDIANDARKELYEREKEIQDLKQEILGLRQALK 270 (956)
Q Consensus 233 ~i~k~k~~~~~~r~el~~~~~eI~~Lq~EI~~Lk~~L~ 270 (956)
.. .+|.+|+.++..++++..
T Consensus 336 ~~------------------~ei~~L~~~l~~~~~~~~ 355 (369)
T 3cob_A 336 SS------------------KEVARLKKLVSYWKEQAG 355 (369)
T ss_dssp EC------------------HHHHHHHHHTTCC-----
T ss_pred CH------------------HHHHHHHHHHHHHHHhcC
Confidence 22 456667777766665543
|
| >2h58_A Kinesin-like protein KIFC3 variant; motor domain, ADP, structural genomics, structur Al genomics consortium, SGC; HET: ADP; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >2y65_A Kinesin, kinesin heavy chain; motor protein; HET: ADP; 2.20A {Drosophila melanogaster} PDB: 2y5w_A* | Back alignment and structure |
|---|
| >2vvg_A Kinesin-2; motor protein, nucleotide-binding, microtubule, ATP-binding; HET: ADP; 1.60A {Giardia intestinalis} | Back alignment and structure |
|---|
| >2zfi_A Kinesin-like protein KIF1A, kinesin heavy chain isoform 5C; alpha and beta protein, enzyme, ATPase, P-loop, motor protein, ATP-binding, coiled coil; HET: ADP; 1.55A {Mus musculus} SCOP: c.37.1.9 PDB: 1vfw_A* 1vfx_A* 1vfz_A* 1vfv_A* 2zfj_A* 2zfk_A* 2zfl_A* 2zfm_A* 1i5s_A* 1i6i_A* 2hxf_C* 1ia0_K* 2hxh_C* | Back alignment and structure |
|---|
| >1bg2_A Kinesin; motor protein, ATPase, microtubule associated; HET: ADP; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 2p4n_K* 1mkj_A* 2kin_A* 3kin_A* | Back alignment and structure |
|---|
| >3bfn_A Kinesin-like protein KIF22; limited proteolysis, structural genomics consortium domain, ADP, SGC, ATP-binding, DNA-binding, microtubule, MO protein; HET: ADP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1goj_A Kinesin, kinesin heavy chain; motor protein, ATPase; HET: ADP; 2.3A {Neurospora crassa} SCOP: c.37.1.9 | Back alignment and structure |
|---|
| >1f9v_A Kinesin-like protein KAR3; kinesin-related protein, motor protein, microtubinding proteinbule, contractIle protein; HET: ADP; 1.30A {Saccharomyces cerevisiae} SCOP: c.37.1.9 PDB: 1f9t_A* 1f9w_A* 1f9u_A* 3kar_A* | Back alignment and structure |
|---|
| >2rep_A Kinesin-like protein KIFC1; structural genomics consortium, motor domain, ADP, binding, cell cycle, cell division, endosome, microtubule; HET: ADP; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1t5c_A CENP-E protein, centromeric protein E; kinesin motor-domain-ADP complex, stranded beta-sheet core with solvent exposed alpha-helices; HET: ADP PIN; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2wbe_C Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mitosis, GTP-binding, motor protein, cell division, cell cycle, microtubule, ATP-binding; HET: GTP ANP GDP TA1; 9.40A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2owm_A Nckin3-434, related to kinesin-like protein KIF1C; motor domain, ADP, NECK linker, motor PR; HET: ADP; 3.25A {Neurospora crassa} | Back alignment and structure |
|---|
| >3t0q_A AGR253WP; kinesin, alpha and beta proteins, P-loop containing nucleosi triphosphate hydrolases, microtubule motor protein; HET: ADP; 2.35A {Ashbya gossypii} | Back alignment and structure |
|---|
| >3lre_A Kinesin-like protein KIF18A; motor protein, nucleotide binding, microtubule binding, ATP- cell projection, cytoskeleton, glycoprotein, microtubule; HET: ADP; 2.20A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >3gbj_A KIF13B protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, ATP-binding, microtubule, motor protein; HET: ADP; 2.10A {Homo sapiens} SCOP: c.37.1.9 | Back alignment and structure |
|---|
| >3b6u_A Kinesin-like protein KIF3B; structural genomics consortium, motor domain, ADP, SGC, ATP-binding, coiled coil, microtubule, motor protein; HET: ADP; 1.80A {Homo sapiens} PDB: 3b6v_A* | Back alignment and structure |
|---|
| >1x88_A Kinesin-like protein KIF11; switch II, motor domain, NECK linker, cell cycle; HET: ADP NAT; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 3hqd_A* 3ken_A* 2pg2_A* 1yrs_A* 2fme_A* 2g1q_A* 2gm1_A* 1ii6_A* 2uyi_A* 2uym_A* 2wog_A* 2x2r_A* 2x7c_A* 2x7d_A* 2x7e_A* 2xae_A* 3k3b_A* 3k5e_A* 3l9h_A* 1q0b_A* ... | Back alignment and structure |
|---|
| >4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4a14_A Kinesin, kinesin-like protein KIF7; motor protein, motor domain; HET: ADP; 1.60A {Homo sapiens} SCOP: c.37.1.0 PDB: 2xt3_A* | Back alignment and structure |
|---|
| >1ry6_A Internal kinesin; kinesin motor domain, nucleotide-free, transport protein; 1.60A {Plasmodium falciparum} SCOP: c.37.1.9 | Back alignment and structure |
|---|
| >3nwn_A Kinesin-like protein KIF9; motor domain, ADP, structural genomics, structural consortium, SGC, contractIle protein; HET: ADP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3u06_A Protein claret segregational; motor domain, stalk rotation, power stroke, kinesin-14, MICR binding, NCD, transport, molecular motor; HET: ADP GOL; 2.35A {Drosophila melanogaster} PDB: 2ncd_A* 1n6m_A* 1cz7_A* 3l1c_A* | Back alignment and structure |
|---|
| >2heh_A KIF2C protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, structural protein; HET: ADP; 2.15A {Homo sapiens} PDB: 3edl_D* | Back alignment and structure |
|---|
| >3dc4_A Kinesin-like protein NOD; catalytic domain, ATPase, microtubule, ADP, nucleotide-binding protein, ATP-binding, coiled coil, motor protein; HET: ADP; 1.90A {Drosophila melanogaster} PDB: 3dcb_A* 3dco_N* 3pxn_A* | Back alignment and structure |
|---|
| >4h1g_A Maltose binding protein-cakar3 motor domain fusio; kinesin motor domain, motor protein, chimera; HET: MTT ADP EDO; 2.15A {Escherichia coli} | Back alignment and structure |
|---|
| >1v8k_A Kinesin-like protein KIF2C; microtubule destabilizer, structural P; HET: ANP; 2.25A {Mus musculus} SCOP: c.37.1.9 PDB: 1v8j_A* 2gry_A* | Back alignment and structure |
|---|
| >2kin_B Kinesin; motor protein, cytoskeleton; HET: ADP; 2.00A {Rattus norvegicus} SCOP: c.37.1.9 | Back alignment and structure |
|---|
| >3kin_B Kinesin heavy chain; motor protein, cytoskeleton; HET: ADP; 3.10A {Rattus norvegicus} SCOP: c.37.1.9 | Back alignment and structure |
|---|
| >2o0a_A S.cerevisiae chromosome XVI reading frame ORF YPL253C; VIK1, motor homology domain, kinesin, motor domain, microtubule-binding; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} | Back alignment and structure |
|---|
| >2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A | Back alignment and structure |
|---|
| >3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A | Back alignment and structure |
|---|
| >1m1j_A Fibrinogen alpha subunit; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: h.1.8.1 PDB: 1ei3_A | Back alignment and structure |
|---|
| >3mq7_A Bone marrow stromal antigen 2; HIV, antiviral protein; 2.28A {Homo sapiens} PDB: 3mqc_A 3mqb_A 3mkx_A 3nwh_A 2xg7_A* 2x7a_A | Back alignment and structure |
|---|
| >3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} | Back alignment and structure |
|---|
| >3mq9_A Bone marrow stromal antigen 2 fused to maltose-BI periplasmic protein; HIV, antiviral protein; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 956 | ||||
| d1bg2a_ | 323 | c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId | 2e-35 | |
| d2ncda_ | 368 | c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjun | 2e-34 | |
| d1x88a1 | 345 | c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), | 3e-34 | |
| d2zfia1 | 349 | c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), | 2e-33 | |
| d1f9va_ | 342 | c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjun | 2e-33 | |
| d1v8ka_ | 362 | c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c | 2e-31 | |
| d1sdma_ | 364 | c.37.1.9 (A:) Kinesin heavy chain-like protein {Po | 3e-31 | |
| d1ry6a_ | 330 | c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodiu | 6e-31 | |
| d1goja_ | 354 | c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5 | 4e-30 |
| >d1bg2a_ c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId: 9606]} Length = 323 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Motor proteins domain: Kinesin species: Human (Homo sapiens) [TaxId: 9606]
Score = 135 bits (340), Expect = 2e-35
Identities = 72/231 (31%), Positives = 120/231 (51%), Gaps = 9/231 (3%)
Query: 1 MEGSSH---DRGLYARCFEELFDLSNSDTTATARFNFAVTVFELYNEQLRELLPQTGNGL 57
MEG H G+ R +++F+ S F+ V+ FE+Y +++R+LL + L
Sbjct: 93 MEGKLHDPEGMGIIPRIVQDIFNYIYSMDENL-EFHIKVSYFEIYLDKIRDLLDVSKTNL 151
Query: 58 AKIRLQSLESSIELVQE-KVDNPLEFSKVLKSAFQSR----GNDVSKFNVSHLIIMIHIY 112
+ ++ ++ E V +P E + +R N + SH I +I++
Sbjct: 152 SVHEDKNRVPYVKGCTERFVCSPDEVMDTIDEGKSNRHVAVTNMNEHSSRSHSIFLINVK 211
Query: 113 YNNLITGENLYSKLSLVDLAGSEGLIAEDDSGERITDVLHVMKSLSALGDVLSSLTSRKD 172
N T + L KL LVDLAGSE + G + + ++ KSLSALG+V+S+L
Sbjct: 212 QENTQTEQKLSGKLYLVDLAGSEKVSKTGAEGAVLDEAKNINKSLSALGNVISALAEGST 271
Query: 173 IVPYENSMLTKVLADSLGESSKTLMIVNICPNAANMSETLSSLNFSSRARS 223
VPY +S +T++L DSLG + +T +++ P++ N SET S+L F RA++
Sbjct: 272 YVPYRDSKMTRILQDSLGGNCRTTIVICCSPSSYNESETKSTLLFGQRAKT 322
|
| >d2ncda_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 368 | Back information, alignment and structure |
|---|
| >d1x88a1 c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), mitotic kinesin eg5 [TaxId: 9606]} Length = 345 | Back information, alignment and structure |
|---|
| >d2zfia1 c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090]} Length = 349 | Back information, alignment and structure |
|---|
| >d1f9va_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Baker's yeast (Saccharomyces cerevisiae), Kar [TaxId: 4932]} Length = 342 | Back information, alignment and structure |
|---|
| >d1v8ka_ c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090]} Length = 362 | Back information, alignment and structure |
|---|
| >d1sdma_ c.37.1.9 (A:) Kinesin heavy chain-like protein {Potato (Solanum tuberosum) [TaxId: 4113]} Length = 364 | Back information, alignment and structure |
|---|
| >d1ry6a_ c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 330 | Back information, alignment and structure |
|---|
| >d1goja_ c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5141]} Length = 354 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 956 | |||
| d1sdma_ | 364 | Kinesin heavy chain-like protein {Potato (Solanum | 100.0 | |
| d2zfia1 | 349 | Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090 | 100.0 | |
| d1goja_ | 354 | Kinesin {Neurospora crassa [TaxId: 5141]} | 100.0 | |
| d1bg2a_ | 323 | Kinesin {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| d1x88a1 | 345 | Kinesin {Human (Homo sapiens), mitotic kinesin eg5 | 100.0 | |
| d1ry6a_ | 330 | Kinesin {Malaria parasite (Plasmodium falciparum) | 100.0 | |
| d1v8ka_ | 362 | Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090 | 100.0 | |
| d1f9va_ | 342 | Kinesin motor Ncd (non-claret disjunctional) {Bake | 100.0 | |
| d2ncda_ | 368 | Kinesin motor Ncd (non-claret disjunctional) {Frui | 100.0 |
| >d1sdma_ c.37.1.9 (A:) Kinesin heavy chain-like protein {Potato (Solanum tuberosum) [TaxId: 4113]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Motor proteins domain: Kinesin heavy chain-like protein species: Potato (Solanum tuberosum) [TaxId: 4113]
Probab=100.00 E-value=2.5e-51 Score=452.83 Aligned_cols=230 Identities=34% Similarity=0.477 Sum_probs=202.5
Q ss_pred CCCCCCCCChHHHHHHHHHHhhccCCCCCceEEEEEEEEEEEcCcccccCCcCCCCC--ceEeeccc--ccccceeEEEe
Q 002175 1 MEGSSHDRGLYARCFEELFDLSNSDTTATARFNFAVTVFELYNEQLRELLPQTGNGL--AKIRLQSL--ESSIELVQEKV 76 (956)
Q Consensus 1 M~Gs~~d~GIIPRal~dLF~~I~~~~~~~~~fsVsVSylEIYNE~V~DLL~~~~~~~--~~v~~~~~--~~V~gLtev~V 76 (956)
|+|+.+++|||||++++||..+... .....|.|++||+|||||+|||||.+..... ..+..+.. .++.|++++.|
T Consensus 92 m~G~~~~~Giipr~~~~lf~~i~~~-~~~~~~~v~~S~~EIyne~i~DLL~~~~~~~~~l~~~~~~~~~~~v~~l~~~~v 170 (364)
T d1sdma_ 92 IYGADSNPGLTPRAMSELFRIMKKD-SNKFSFSLKAYMVELYQDTLVDLLLPKQAKRLKLDIKKDSKGMVSVENVTVVSI 170 (364)
T ss_dssp HTBCSSSBCHHHHHHHHHHHHHHHG-GGTEEEEEEEEEEEESSSCEEETTSCTTSCCCCCEEEECTTSCEEEETCCCEEE
T ss_pred cccCccccchhHHHHHHHHhhhhhc-cccccceEEEEEEEEeccccccccCcccccccccceeecccCccccccceeeee
Confidence 7899999999999999999999764 4568999999999999999999998865443 24444443 45679999999
Q ss_pred CCHHHHHHHHHHHHhhccCcCCC----CCcceEEEEEEEEeeccCCCceeeeeeEEeeccCCCccccCCCcchhhHhHHH
Q 002175 77 DNPLEFSKVLKSAFQSRGNDVSK----FNVSHLIIMIHIYYNNLITGENLYSKLSLVDLAGSEGLIAEDDSGERITDVLH 152 (956)
Q Consensus 77 ~S~eE~l~lL~~G~~~R~~asT~----SSRSH~IFtI~V~q~~~~~~~~~~SkLsfVDLAGSER~~kt~s~G~rlkEa~~ 152 (956)
.|++|++.++..|.++|.++.|. |||||+||+|++.+.+..+.....|+|+|||||||||..++++.|.+++|+.+
T Consensus 171 ~s~~~~~~~l~~g~~~R~~~~t~~n~~ssRsH~i~~i~v~~~~~~~~~~~~~kl~~vDLAGsEr~~~~~~~g~~~~E~~~ 250 (364)
T d1sdma_ 171 STYEELKTIIQRGSEQRHTTGTLMNEQSSRSHLIVSVIIESTNLQTQAIARGKLSFVDLAGSERVKKSGSAGNQLKEAQS 250 (364)
T ss_dssp CSHHHHHHHHHHHHHHHCCCSSCTTCHHHHSEEEEEEEEEEEETTTCCEEEEEEEEEECCCCSCCCC---------CCCT
T ss_pred CCHHHHHHHhhccceeeccccccccccccccceEEEEEEEEeccCcceeeeEEEEeechhhccccccccccCceeeeccc
Confidence 99999999999999999999887 89999999999999998888889999999999999999999999999999999
Q ss_pred HhhhHHHHHHHHHHhhcCCCCcCCCCCchhhhhccccCCCCeEEEEEeeCCCCCCHHHhHHHHHHHHHhcccccccCcc
Q 002175 153 VMKSLSALGDVLSSLTSRKDIVPYENSMLTKVLADSLGESSKTLMIVNICPNAANMSETLSSLNFSSRARSTVLSLGNR 231 (956)
Q Consensus 153 INkSL~aLg~VI~aLs~k~~~VPYRdSKLTrLLqDsLgGNSkT~mIv~VSPs~~~~eETLsTLrFAsrAK~I~~~~~n~ 231 (956)
||+||++|++||.+|+++..|||||+||||+||+|+|||||+|+||+||||+..+++||++||+||++|++|++.|..+
T Consensus 251 iN~SL~~L~~vi~aL~~~~~~ipyR~SkLT~lL~d~Lggns~t~~I~~isp~~~~~~eTl~TL~fa~~ak~i~n~p~~n 329 (364)
T d1sdma_ 251 INKSLSALGDVISALSSGNQHIPYRNHKLTMLMSDSLGGNAKTLMFVNISPAESNLDETHNSLTYASRVRSIVNDPSKN 329 (364)
T ss_dssp TCHHHHHHHHHHHHHHHTCSCCCGGGCHHHHHTTTTTTSSSEEEEEEEECCBGGGHHHHHHHHHHHHHHTTCCCCCCCC
T ss_pred cccchhhHHHHHHHHHcCCCcCCchhhhhhHHHHhhcCCCceEEEEEEeCCCcchHHHHHHHHHHHHHHhhcccCCccc
Confidence 9999999999999999999999999999999999999999999999999999999999999999999999988766543
|
| >d2zfia1 c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1goja_ c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5141]} | Back information, alignment and structure |
|---|
| >d1bg2a_ c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x88a1 c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), mitotic kinesin eg5 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ry6a_ c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1v8ka_ c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1f9va_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Baker's yeast (Saccharomyces cerevisiae), Kar [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ncda_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|