Citrus Sinensis ID: 002227

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950
MAIVTGDRYLEKLVKFVEQQAGPLIEGSIVLKLNPAGLHYVQSRLEALRELERLLAGAPLDYLRAYVSDLGDHRALEQLRRILKLLTSLKVVSALPPPARDPTPLSLLPFCRLKVLELRGCDLSTSAAKGLLELRHTLEKIICHNSTNALRHVFASRIVEIKDSPQWNRLSFVSCSCNRLVIMDESLQLLPAVETLDLSRNKFAKVDNLRKCVNLKHLDLGFNNLRSIAAFSEVSCHIVKLVLRNNALTTLRGIENLKSLEGLDISYNIISTFSELEFLASLPYLLNLWLEGNPLCCSRWYRAQVFSYFAHPAKLKVDGKEISTRELWERQLIIARRQKRPAGFGFYSPAKGNADGDGNANRKRKKACRLASIESEEESTCVGSDRESVSCDNEIESKEENVASDDDAEIIDLMSRVEHMKRERSILWLREFKEWMDHTSENFVDGSICSGATLMNCEEDNYIKNKRSQPHLAESSKYVSGSVQASGDESSTNILESENSYADMPTGLHAYQSFDHIGSLGITGGFSLPGIGRMELRQENEKPYLHDGAGAATVQSKSFHQDTFTIQDRRMVENIHESPLTPIDDITDAFSSSARPGSPPHYREDILHRRHNLVAEILQLSAESYSVVSSDSKTSCSDDDFREYGPSMLEVDQSINPEHEYSSAEVHSLLNLFEEDHNDQPHEIDCQRENCKNNGFSAGGNDGEVDSSVNQEAHLLEKNKRKHTRRVISLLKEQNTVAKTEALQNLNGNLNISEADNVGEQGKHIFGLNYLLRTSDKKQTRENAVMTPYISGIGSVAKFLSSVKEDFVEDYFNKNVADSKSHETCMQYTVCWILEQDFMHRGREVAVLRSSENKFYVLLFGVTVDGTGSILNLLGCHKIEDIREVLIGLGLQVLRVSTEMGATYLLMTRSIEKSRQLFCTLQIFYLVSANDKCSLRRFRLSCLRNKSVEA
cccccccHHHHHHHHHHHHccccccccccEEEcccccHHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHccccccccccccccccccccccccccccEEEEEcccccccccccccccHHHHHHHHHHcccHHHHHHHHccccccccccccccccEEEccccccccccccccccccccEEEcccccccEEccccccccccEEEccccccccccccccccccccEEEcccccccccccccccccccEEEcccccccccHHcHHccccccccEEEEccccccccccHHHHHHHHcccccEEEcccccccHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHcccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHccccccEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHcccccccHHHHHccccEEEEEEcccccccEEEEEEEEccccEEEEEEEEEEccccccEEEEEcccccHHHHHHHHcccEEEEEEEEcccEEEEEEccHHHHHHHHHHHEEccccccccccEEEcccccccccccccc
cccccccHHHHHHHHHHHHcccEEEccccEEEccHHHHHHHHHHHHHHHccccccccccEEEccccccccHHHHHHHHHHHHHHHHcccEEEEcccccccccccEEEccHHcccEEEEccccccHHHHHHHHHHHHHHHHEEHHccHHHHHHHHHHcccccccccHHHHccEEcccccHHHHHHHHHHHcHccEEEEccccccEEHHcHHHcccccEEEcccccccccccccccccccEEEEEccccHHcHccHHHHHHHcEcccccccHHcHHHHHHHHccHHHcEEEcccccccccHHHHHHHHHHHccccEEEcccccccHHHHHHHHHHHHHHHHcccccccccHHHcccccccccHHHccccccccccccccccccccccccccccccHHccccccccccccccHHccccHHHHHHccccHHHHHHHHHHHHHHHHcccccccEEEEEccccccccEEEEcccccccccccccccccHccccccccccEEEcccccccccccccccccccccccccccccccccccccEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHcccccEEEEccccccccccccccccccccccccccccccccccccccccccHcccccccccccccccccccccccccccccccHHcccccHHHcHHHcccccccccEEEEEEccccccccccccccccccccccccccccccccccccccccEEEccccccccEEccccHccccccEEccccccccHHHHHcccccccccccHHHHHHEEEEEEEcccccccEEEEEEEcccccEEEEEEEEEEcccccccEEEccccHHHHHHHEEHccEEEEEEEEccccEEEEEEccHHHHHHHHHHHHHHHHHcccccccEcEEEEHHHHHEEEcc
MAIVTGDRYLEKLVKFVEQqagpliegsivlklnpaglHYVQSRLEALRELERLLAGAPLDYLRAYVSDLGDHRALEQLRRILKLLTSLkvvsalpppardptplsllpfcrlkvlelrgcdlstSAAKGLLELRHTLEKIICHNSTNALRHVFASRIVEikdspqwnrlsfvscscnRLVIMDESlqllpavetldlsrnkfakvdnlrkcvnlkhldlgFNNLRSIAAFSEVSCHIVKLVLRNNAlttlrgienlkslegldisYNIISTFSELEFLASLPYLLNlwlegnplccsrwyRAQVFSYfahpaklkvdgkeisTRELWERQLIIARRqkrpagfgfyspakgnadgdgnanrkRKKACRlasieseeestcvgsdresvscdneieskeenvasdddaEIIDLMSRVEHMKRERSILWLREFKEWMdhtsenfvdgsicsgatlmnceednyiknkrsqphlaesskyvsgsvqasgdesstnilesensyadmptglhayqsfdhigslgitggfslpgigrmelrqenekpylhdgagaatvqsksfhqdtftiqdrrmvenihespltpidditdafsssarpgspphyredILHRRHNLVAEILQLSAESYsvvssdsktscsdddfreygpsmlevdqsinpeheyssAEVHSLLNLFeedhndqpheidcqrencknngfsaggndgevdssvNQEAHLLEKNKRKHTRRVISLLKEQNTVAKTEALQNLngnlniseadnvgeqgkhifglnyllrtsdkkqtrenavmtpYISGIGSVAKFLSSVKEDFVEDyfnknvadskshetCMQYTVCWILEQDFMHRGREVAVLRSSENKFYVLLFGVTVDGTGSILNLLGCHKIEDIREVLIGLGLQVLRVSTEMGATYLLMTRSIEKSRQLFCTLQIFYLVSANDKCSLRRFRLSCLRNKSVEA
maivtgdrYLEKLVKFVEQQAGPLIEGSIVLKLNPAGLHYVQSRLEALRELERLLAGAPLDYLRAYVSDLGDHRALEQLRRILKLLTSLKVVsalpppardptplsLLPFCRLKVLELRGCDLSTSAAKGLLELRHTLEKIICHNSTNALRHVFASRIVEikdspqwnrlSFVSCSCNRLVIMDESLQLLPAVETLDLSRNKFAKVDNLRKCVNLKHLDLGFNNLRSIAAFSEVSCHIVKLVLrnnalttlrgienlksleglDISYNIISTFSELEFLASLPYLLNLWLEGNPLCCSRWYRAQVFSYFAHPaklkvdgkeistRELWERQLIIArrqkrpagfgfyspakgnadgdgnanrKRKKACRlasieseeestcvgsdresvscdneieskeenvasdddaeIIDLMSRVEHMKRERSILWLREFKEWMDHTSENFVDGSICSGATLMNCEEDNYIKNKRSQPHLAEsskyvsgsvqasgdeSSTNILESENSYADMPTGLHAYQSFDHIGSLGITGGFSLPGIGRMELRQENEKPYLHDGAGAATVQSKSFHQDTFTIQDRRMVENIHespltpidditdaFSSSARPGSPPHYREDILHRRHNLVAEILQLSAESYsvvssdsktscsddDFREYGPSMLEVDQSINPEHEYSSAEVHSLLNLFEEDHNDQPHEIDCQRENCKNNGFSAGGNDGEVDSSVNQEAHLleknkrkhtrRVISLLKEQNTVAKTEALQNLNGNLNISEADNVGEQGKHIFGLNYLLRTSDKKQTRENAVMTPYISGIGSVAKFLSSVKEDFVEDYFNknvadskshetCMQYTVCWILEQDFMHRGREVAVLRSSENKFYVLLFGVTVDGTGSILNLLGCHKIEDIREVLIGLGLQVLRVSTEMGATYLLMTRSIEKSRQLFCTLQIFYLVSANDKCSLRRFrlsclrnksvea
MAIVTGDRYLEKLVKFVEQQAGPLIEGSIVLKLNPAGLHYVQSrlealrelerllagaplDYLRAYVSDLGDHRALEQLRRILKLLTSLKVVSALPPPARDPTPLSLLPFCRLKVLELRGCDLSTSAAKGLLELRHTLEKIICHNSTNALRHVFASRIVEIKDSPQWNRLSFVSCSCNRLVIMDESLQLLPAVETLDLSRNKFAKVDNLRKCVNLKHLDLGFNNLRSIAAFSEVSCHIVKLVLRNNALTTLRGIENLKSLEGLDISYNIISTFSELEFLASLPYLLNLWLEGNPLCCSRWYRAQVFSYFAHPAKLKVDGKEISTRELWERQLIIARRQKRPAGFGFYSPAKGNADGDGNANRKRKKACRLASIESEEESTCVGSDRESVSCDNEIESKEENVASDDDAEIIDLMSRVEHMKRERSILWLREFKEWMDHTSENFVDGSICSGATLMNCEEDNYIKNKRSQPHLAESSKYVSGSVQASGDESSTNILESENSYADMPTGLHAYQSFDHIGSLGITGGFSLPGIGRMELRQENEKPYLHDGAGAATVQSKSFHQDTFTIQDRRMVENIHESPLTPIDDITDAFSSSARPGSPPHYREDILHRRHNLVAEILQLsaesysvvssdsktscsdddFREYGPSMLEVDQSINPEHEYSSAEVHSLLNLFEEDHNDQPHEIDCQRENCKNNGFSAGGNDGEVDSSVNQEAHLLEKNKRKHTRRVISLLKEQNTVAKTEALQNLNGNLNISEADNVGEQGKHIFGLNYLLRTSDKKQTRENAVMTPYISGIGSVAKFLSSVKEDFVEDYFNKNVADSKSHETCMQYTVCWILEQDFMHRGREVAVLRSSENKFYVLLFGVTVDGTGSILNLLGCHKIEDIREVLIGLGLQVLRVSTEMGATYLLMTRSIEKSRQLFCTLQIFYLVSANDKcslrrfrlsclrNKSVEA
***VTGDRYLEKLVKFVEQQAGPLIEGSIVLKLNPAGLHYVQSRLEALRELERLLAGAPLDYLRAYVSDLGDHRALEQLRRILKLLTSLKVVSALPP****PTPLSLLPFCRLKVLELRGCDLSTSAAKGLLELRHTLEKIICHNSTNALRHVFASRIVEIKDSPQWNRLSFVSCSCNRLVIMDESLQLLPAVETLDLSRNKFAKVDNLRKCVNLKHLDLGFNNLRSIAAFSEVSCHIVKLVLRNNALTTLRGIENLKSLEGLDISYNIISTFSELEFLASLPYLLNLWLEGNPLCCSRWYRAQVFSYFAHPAKLKVDGKEISTRELWERQLIIARRQKRPAGFGFY**************************************************************IIDLMSRVEHMKRERSILWLREFKEWMDHTSENFVDGSICSGATLMNCEEDNY*******************************************TGLHAYQSFDHIGSLGITGGFSLPGIGRM*****************************FTI***************************************ILHRRHNLVAEILQLS*************************************************************************************************************************LQNLNGNLNISEADNVGEQGKHIFGLNYLLRTSD****RENAVMTPYISGIGSVAKFLSSVKEDFVEDYFNKNVADSKSHETCMQYTVCWILEQDFMHRGREVAVLRSSENKFYVLLFGVTVDGTGSILNLLGCHKIEDIREVLIGLGLQVLRVSTEMGATYLLMTRSIEKSRQLFCTLQIFYLVSANDKCSLRRFRLSCL*******
****TGDRYLEKLVKFVEQQAGPLIEGSIVLKLNPAGLHYVQSRLEALRELERLLAGAPLDYLRAYVSDLGDHRALEQLRRILKLLTSLKVVSALPPPARDPTPLSLLPFCRLKVLELRGCDLSTSAAKGLLELRHTLEKIICHNSTNALRHVFASRIVEIKDSPQWNRLSFVSCSCNRLVIMDESLQLLPAVETLDLSRNKFAKVDNLRKCVNLKHLDLGFNNLRSIAAFSEVSCHIVKLVLRNNALTTLRGIENLKSLEGLDISYNIISTFSELEFLASLPYLLNLWLEGNPLCCSRWYRAQVFSYFAHPAKLKVDGKEISTREL**************************************************************************************************************************************************************************************************************************************************************************************ILHRRHNLVAEILQLS**********************************************************************************************************************************ISEADNVGEQGKHIFGLNYLL*****************ISGIGSVAKFLSSVKEDFVEDYFNKNVADSKSHETCMQYTVCWILEQDFMHRGREVAVLRSSENKFYVLLFGVTVDGTGSILNLLGCHKIEDIREVLIGLGLQVLRVSTEMGATYLLMTRSIEKSRQLFCTLQIFYLVSANDKCSLRRFRLSCLRNKS***
MAIVTGDRYLEKLVKFVEQQAGPLIEGSIVLKLNPAGLHYVQSRLEALRELERLLAGAPLDYLRAYVSDLGDHRALEQLRRILKLLTSLKVVSALPPPARDPTPLSLLPFCRLKVLELRGCDLSTSAAKGLLELRHTLEKIICHNSTNALRHVFASRIVEIKDSPQWNRLSFVSCSCNRLVIMDESLQLLPAVETLDLSRNKFAKVDNLRKCVNLKHLDLGFNNLRSIAAFSEVSCHIVKLVLRNNALTTLRGIENLKSLEGLDISYNIISTFSELEFLASLPYLLNLWLEGNPLCCSRWYRAQVFSYFAHPAKLKVDGKEISTRELWERQLIIARRQKRPAGFGFYSPAKGN***************************************NEIESKEENVASDDDAEIIDLMSRVEHMKRERSILWLREFKEWMDHTSENFVDGSICSGATLMNCEEDNYIKNK*************************TNILESENSYADMPTGLHAYQSFDHIGSLGITGGFSLPGIGRMELRQENEKPYLHDGAGAATVQSKSFHQDTFTIQDRRMVENIHESPLTPIDDITDAFSSSARPGSPPHYREDILHRRHNLVAEILQLSAE***************DDFREYGPSMLEVDQSINPEHEYSSAEVHSLLNLFEEDHNDQPHEIDCQRENCKNNGFSAGGNDGEVDSSVNQEAHLLEKNKRKHTRRVISLLKEQNTVAKTEALQNLNGNLNISEADNVGEQGKHIFGLNYLLRTSDKKQTRENAVMTPYISGIGSVAKFLSSVKEDFVEDYFNKNVADSKSHETCMQYTVCWILEQDFMHRGREVAVLRSSENKFYVLLFGVTVDGTGSILNLLGCHKIEDIREVLIGLGLQVLRVSTEMGATYLLMTRSIEKSRQLFCTLQIFYLVSANDKCSLRRFRLSCLRNKSVEA
***VTGDRYLEKLVKFVEQQAGPLIEGSIVLKLNPAGLHYVQSRLEALRELERLLAGAPLDYLRAYVSDLGDHRALEQLRRILKLLTSLKVVSALPPPARDPTPLSLLPFCRLKVLELRGCDLSTSAAKGLLELRHTLEKIICHNSTNALRHVFASRIVEIKDSPQWNRLSFVSCSCNRLVIMDESLQLLPAVETLDLSRNKFAKVDNLRKCVNLKHLDLGFNNLRSIAAFSEVSCHIVKLVLRNNALTTLRGIENLKSLEGLDISYNIISTFSELEFLASLPYLLNLWLEGNPLCCSRWYRAQVFSYFAHPAKLKVDGKEISTRELWERQLIIARRQKR*******************************************************************AEIIDLMSRVEHMKRERSILWLREFKEWMDHTSENFVDGSICSGATLMNCEEDNYIKNKRS***************Q**************NSYADMPTGLHAYQ***********G**S****GR***************************************************************GSPPHYREDILHRRHNLVAEILQLSAESYSVVSS*************************N*************************HEIDCQ**NCKNNGFSAGGNDGEVDSSVNQEAHLLEKNKRKHTRRVISLLKEQNTVAKT*A**NLNGNLNISEADNVGEQGKHIFGLNYLLRTSDKKQTRENAVMTPYISGIGSVAKFLSSVKEDFVEDYFNKNVADSKSHETCMQYTVCWILEQDFMHRGREVAVLRSSENKFYVLLFGVTVDGTGSILNLLGCHKIEDIREVLIGLGLQVLRVSTEMGATYLLMTRSIEKSRQLFCTLQIFYLVSANDKCSLRRFRLSCLRNKSVEA
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAIVTGDRYLEKLVKFVEQQAGPLIEGSIVLKLNPAGLHYVQSRLEALRELERLLAGAPLDYLRAYVSDLGDHRALEQLRRILKLLTSLKVVSALPPPARDPTPLSLLPFCRLKVLELRGCDLSTSAAKGLLELRHTLEKIICHNSTNALRHVFASRIVEIKDSPQWNRLSFVSCSCNRLVIMDESLQLLPAVETLDLSRNKFAKVDNLRKCVNLKHLDLGFNNLRSIAAFSEVSCHIVKLVLRNNALTTLRGIENLKSLEGLDISYNIISTFSELEFLASLPYLLNLWLEGNPLCCSRWYRAQVFSYFAHPAKLKVDGKEISTRELWERQLIIARRQKRPAGFGFYSPAKGNADGDGNANRKRKKACRLASIESEEESTCVGSDRESVSCDNEIESKEENVASDDDAEIIDLMSRVEHMKRERSILWLREFKEWMDHTSENFVDGSICSGATLMNCEEDNYIKNKRSQPHLAESSKYVSGSVQASGDESSTNILESENSYADMPTGLHAYQSFDHIGSLGITGGFSLPGIGRMELRQENEKPYLHDGAGAATVQSKSFHQDTFTIQDRRMVENIHESPLTPIDDITDAFSSSARPGSPPHYREDILHRRHNLVAEILQLSAESYSVVSSDSKTSCSDDDFREYGPSMLEVDQSINPEHEYSSAEVHSLLNLFEEDHNDQPHEIDCQRENCKNNGFSAGGNDGEVDSSVNQEAHLLEKNKRKHTRRVISLLKEQNTVAKTEALQNLNGNLNISEADNVGEQGKHIFGLNYLLRTSDKKQTRENAVMTPYISGIGSVAKFLSSVKEDFVEDYFNKNVADSKSHETCMQYTVCWILEQDFMHRGREVAVLRSSENKFYVLLFGVTVDGTGSILNLLGCHKIEDIREVLIGLGLQVLRVSTEMGATYLLMTRSIEKSRQLFCTLQIFYLVSANDKCSLRRFRLSCLRNKSVEA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query950 2.2.26 [Sep-21-2011]
Q6P4K6 1129 Serine/threonine-protein yes no 0.376 0.317 0.293 3e-25
Q8N1F8 1099 Serine/threonine-protein yes no 0.255 0.221 0.333 3e-21
Q5F479 1073 Serine/threonine-protein yes no 0.232 0.205 0.307 1e-20
Q6IRN0 1137 Serine/threonine-protein N/A no 0.362 0.302 0.291 3e-20
Q80TM9 1593 Nischarin OS=Mus musculus yes no 0.233 0.139 0.311 3e-19
Q3TAA7 1072 Serine/threonine-protein no no 0.335 0.297 0.300 7e-19
Q9Y2I1 1504 Nischarin OS=Homo sapiens no no 0.215 0.136 0.315 1e-18
Q4G017 1502 Nischarin OS=Rattus norve no no 0.233 0.147 0.304 6e-18
Q4LDG9190 Dynein light chain 1, axo no no 0.118 0.594 0.371 8e-10
Q6DHB1192 Dynein light chain 1, axo no no 0.118 0.588 0.380 8e-10
>sp|Q6P4K6|S11IP_XENTR Serine/threonine-protein kinase 11-interacting protein OS=Xenopus tropicalis GN=stk11ip PE=2 SV=1 Back     alignment and function desciption
 Score =  118 bits (295), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 114/388 (29%), Positives = 191/388 (49%), Gaps = 30/388 (7%)

Query: 10  LEKLVKFVEQQAGPLIEGSIVLKLNPAGLHYVQSRLEALRELERLLAGAPLDYLRAYVSD 69
           ++ L + + +    +++GS +L L    L  V       R  E+L    P    +A  + 
Sbjct: 10  VQALAQILHEHGDKVLDGSRILALLTPCLQVVT------RLFEQLFPRGPGTGFQALPAH 63

Query: 70  LGDHRALEQLRRILKLL---TSLKVVSALPPPARDPTP--LSLLPFCRLKVLELRGCDLS 124
             D   + + + +L +L    SLK+V     PA  P    +++ PF  L+ LELR C L 
Sbjct: 64  PADSVPILRAQFMLDMLQKTPSLKLVH----PAECPRQFDVNIFPFKSLRSLELR-C-LP 117

Query: 125 TSAAKGLLELRHTLEKIICHNSTNALRHVFASRIVEIKDSPQWNRLSFVSCSCNRLVIMD 184
               +GL  +   LE + C+   ++L  V A    ++  +  W  L  +  S N L  +D
Sbjct: 118 PHCLRGLRSVYSQLEVLTCYRCVSSLEEVIALCGGDLSSALPWLVLHTLDFSYNTLKNLD 177

Query: 185 ESLQLLPAVETLDLSRNKFAKVDNLRKCVN-LKHLDLGFNNLRSIAAFS-EVSCHIVKLV 242
            SL+LL +++ LDLS N+  +  +  K ++ L++L+LG+N+L ++   S   +  +  L+
Sbjct: 178 GSLELLNSLKILDLSHNQITECGSYLKVLSELQYLNLGYNHLTAVPELSVGNTAKLHSLI 237

Query: 243 LRNNALTTLRGIENLKSLEGLDISYNIISTFSELEFLASLPYLLNLWLEGNPLCCSRWYR 302
           L++N L+   G+ENL +L+ LD+SYN++   S+L  LA L  L  L+LEGNPL   + YR
Sbjct: 238 LKHNQLSGTSGLENLPNLQHLDLSYNLLLEHSQLSGLARLHNLKQLFLEGNPLYFQKDYR 297

Query: 303 AQVFSYFAHPAKLKV--DGKEISTRELWERQLIIARRQKRPAGFGFYSPAKGNADGDGNA 360
           A    + +H A   V  DGK +S+ E+   Q    + + +P+     S   G+     +A
Sbjct: 298 ALTAQHLSHKASDNVLLDGKLLSSSEIMNAQAFGEKVRLQPSSSATESSCTGDLTDSYSA 357

Query: 361 NRK------RKKA---CRLASIESEEES 379
             K      RKK+    R ASI    +S
Sbjct: 358 AEKSAPRLPRKKSRVKVRTASISERSDS 385

Xenopus tropicalis (taxid: 8364)
>sp|Q8N1F8|S11IP_HUMAN Serine/threonine-protein kinase 11-interacting protein OS=Homo sapiens GN=STK11IP PE=1 SV=3 Back     alignment and function description
>sp|Q5F479|S11IP_CHICK Serine/threonine-protein kinase 11-interacting protein OS=Gallus gallus GN=STK11IP PE=2 SV=1 Back     alignment and function description
>sp|Q6IRN0|S11IP_XENLA Serine/threonine-protein kinase 11-interacting protein OS=Xenopus laevis GN=stk11ip PE=2 SV=1 Back     alignment and function description
>sp|Q80TM9|NISCH_MOUSE Nischarin OS=Mus musculus GN=Nisch PE=1 SV=2 Back     alignment and function description
>sp|Q3TAA7|S11IP_MOUSE Serine/threonine-protein kinase 11-interacting protein OS=Mus musculus GN=Stk11ip PE=1 SV=1 Back     alignment and function description
>sp|Q9Y2I1|NISCH_HUMAN Nischarin OS=Homo sapiens GN=NISCH PE=1 SV=3 Back     alignment and function description
>sp|Q4G017|NISCH_RAT Nischarin OS=Rattus norvegicus GN=Nisch PE=2 SV=2 Back     alignment and function description
>sp|Q4LDG9|DNAL1_HUMAN Dynein light chain 1, axonemal OS=Homo sapiens GN=DNAL1 PE=1 SV=1 Back     alignment and function description
>sp|Q6DHB1|DNAL1_DANRE Dynein light chain 1, axonemal OS=Danio rerio GN=dnal1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query950
359491520 1089 PREDICTED: uncharacterized protein LOC10 0.921 0.803 0.585 0.0
356524698 1091 PREDICTED: uncharacterized protein LOC10 0.938 0.817 0.555 0.0
449527667977 PREDICTED: LOW QUALITY PROTEIN: uncharac 0.930 0.904 0.538 0.0
449439162 1090 PREDICTED: uncharacterized protein LOC10 0.934 0.814 0.540 0.0
297734346992 unnamed protein product [Vitis vinifera] 0.853 0.817 0.541 0.0
357521685 1238 hypothetical protein MTR_8g107440 [Medic 0.854 0.655 0.568 0.0
297847122 1066 leucine-rich repeat family protein [Arab 0.942 0.839 0.502 0.0
42571803 1051 Outer arm dynein light chain 1 protein [ 0.944 0.853 0.496 0.0
42562612 1063 Outer arm dynein light chain 1 protein [ 0.944 0.843 0.496 0.0
2978304301009 hypothetical protein ARALYDRAFT_898146 [ 0.874 0.823 0.482 0.0
>gi|359491520|ref|XP_002278916.2| PREDICTED: uncharacterized protein LOC100250985 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  995 bits (2573), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 566/967 (58%), Positives = 678/967 (70%), Gaps = 92/967 (9%)

Query: 1   MAIVTGDRYLEKLVKFVEQQAGPLIEGSIVLKLNPAGLHYVQSRLEALRELERLLAGAPL 60
           MAIVTGDRYLE LVKFVE+QAGPLIEGS+VLKLNP GLHYVQSRLEAL ELE LLAGAP+
Sbjct: 1   MAIVTGDRYLESLVKFVEKQAGPLIEGSVVLKLNPVGLHYVQSRLEALHELESLLAGAPV 60

Query: 61  DYLRAYVSDLGDHRALEQLRRILKLLTSLKVVSALPPPARDPTPLSLLPFCRLKVLELRG 120
           DYLRAY+SDLGDHRALEQLRRIL+LLTSLKVVS LPP  RDPT LSLLPF RL+VLELRG
Sbjct: 61  DYLRAYISDLGDHRALEQLRRILRLLTSLKVVSVLPPSVRDPTRLSLLPFGRLRVLELRG 120

Query: 121 CDLSTSAAKGLLELRHTLEKIICHNSTNALRHVFASRIVEIKDSPQWNRLSFVSCSCNRL 180
           CDLSTSAA+GLLELRHTLEKIICHNST+ALRH+FASRIV IKDSPQW RLSFVSC+CN L
Sbjct: 121 CDLSTSAARGLLELRHTLEKIICHNSTDALRHLFASRIVAIKDSPQWKRLSFVSCACNGL 180

Query: 181 VIMDESLQLLPAVETLDLSRNKFAKVDNLRKCVNLKHLDLGFNNLRSIAAFSEVSCHIVK 240
           ++MDESLQLLPAVETLDLSRNKF+KVDNLRKC  LKHLDLGFN+LR+I++FSEVSCHIVK
Sbjct: 181 LLMDESLQLLPAVETLDLSRNKFSKVDNLRKCTKLKHLDLGFNHLRTISSFSEVSCHIVK 240

Query: 241 LVLRNNALTTLRGIENLKSLEGLDISYNIISTFSELEFLASLPYLLNLWLEGNPLCCSRW 300
           LV+RNNALTTLRGIENLKSLE LD+SYN+IS FSE+E LA LP L  LWLEGNP+CC+RW
Sbjct: 241 LVMRNNALTTLRGIENLKSLEDLDLSYNVISNFSEIEILAGLPSLRRLWLEGNPICCARW 300

Query: 301 YRAQVFSYFAHPAKLKVDGKEISTRELWERQLIIARRQKRPAGFGFYSPAKGNADGDGNA 360
           YRAQVFS+FAHP K+K+D  EISTRE W+RQ+IIA RQKRPA FGFY PA+ +A G+G  
Sbjct: 301 YRAQVFSFFAHPDKVKLDEMEISTREFWKRQIIIASRQKRPASFGFYYPAREDA-GEGGI 359

Query: 361 NRKRKKACRLASIESEEESTCVGSDRESVSCDNEIESKEENVASDDDAEIIDLMSRVEHM 420
           + KRKK  RLA IE+ E S  + SD++SVSCDNE+ SKE+N  SDD+AEI+DLM RVE M
Sbjct: 360 STKRKKLSRLACIET-EGSMYICSDQDSVSCDNEVRSKEDNAISDDEAEIVDLMKRVELM 418

Query: 421 KRERSILWLREFKEWMDHTSENFVDGSICSGATLMNCEEDNYIKNKRSQPHLAESSKYVS 480
           K+ERS+LWLREFKEWMD  S++F +G+     ++++   +NY++ K  Q HL ESS+YVS
Sbjct: 419 KKERSVLWLREFKEWMDLASDSFAEGN--KYGSVLDSGTENYMRKKAGQRHLGESSRYVS 476

Query: 481 GSVQASGDESSTNILESENSYADMPTGLHAYQSFDHIGSLGITGGFSLPGIGRMELRQEN 540
            SVQASGDES T+ILES NS+AD+  GL   Q  D  G  G                   
Sbjct: 477 DSVQASGDESGTDILESNNSFADISIGL-VPQYVDRSGESG------------------- 516

Query: 541 EKPYLHDGAGAATVQSKSFHQDTFTIQDRRMVENIHESPLTPIDDITDAFSSSARPGSPP 600
                                  F ++D            T +D I D  S S  PGSPP
Sbjct: 517 ---------------------SMFALRD------------TGVDAIQDQ-SKSYSPGSPP 542

Query: 601 HYREDILHRRHNLVAEILQLSAESYSVVSSDSKTSCSDDDFREYGPSMLEVDQSINPEHE 660
           HY+ED+LHRRH LV +ILQLSAESYSV SSDS TS   +D  E   S+ EV+QS+N E  
Sbjct: 543 HYQEDLLHRRHILVEDILQLSAESYSVASSDSNTS-DSNDLCEVESSVSEVEQSVNEEIS 601

Query: 661 YSSAEVHSLLNLFEEDHNDQPHEIDCQRENCK--------------------------NN 694
             S   HSL   F   + +Q H+I   REN +                          +N
Sbjct: 602 NRSVG-HSLTTFFGNIYYEQRHQIPLVRENGRYLLDSHAGQASATLKLLKPEQSLQLCSN 660

Query: 695 GFSAGGNDGEVDSSVNQEAHLLEKNKRKHTRRVISLLKEQNTVAKTEALQNLNGNLNISE 754
            F AG +DGE+ S  N+EA  L+K K K   R I  + + N V + E  Q L GN +   
Sbjct: 661 DFCAGAHDGEIASLSNEEADWLDKKKCKRKPRKIVSVSQNNMVGRAEDSQTLVGNPDFCG 720

Query: 755 ADNVGEQGKHIFGLNYLLRTSDKKQTRENAVMTPYISGIGSVAKFL---SSVKEDFVEDY 811
            D   EQG+ IFG N+     D +QT  +A +TP I   G +   L   ++  +DF+++Y
Sbjct: 721 GDMEDEQGEQIFGWNFWDGFVDGEQTCASATITPLIDDAGRILSGLRGPTTGADDFIKNY 780

Query: 812 FNKNVADSKSHETCMQY--TVCWILEQDFMHRGREVAVLRSSENKFYVLLFGVTVDGTGS 869
           FN N+ADS  +ETC QY  + C+ LE +  +  REVA+L SSE+K YVLL  VT DG+G+
Sbjct: 781 FNLNIADSSVNETCKQYMRSSCF-LELESRYTEREVAILLSSEHKLYVLLVDVTFDGSGT 839

Query: 870 ILNLLGCHKIEDIREVLIGLGLQVLRVSTEMGATYLLMTRSIEKSRQLFCTLQIFYLVSA 929
           IL LLGCH++ED+REVL+G+GLQV+RV  E  A Y+ +TRS+EKSRQL CTLQ+      
Sbjct: 840 ILKLLGCHRLEDVREVLVGVGLQVVRVYIERDAAYMFLTRSMEKSRQLLCTLQVVDSNET 899

Query: 930 NDKCSLR 936
             KCSLR
Sbjct: 900 CSKCSLR 906

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356524698|ref|XP_003530965.1| PREDICTED: uncharacterized protein LOC100788364 [Glycine max] Back     alignment and taxonomy information
>gi|449527667|ref|XP_004170831.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101228525 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449439162|ref|XP_004137356.1| PREDICTED: uncharacterized protein LOC101203626 [Cucumis sativus] Back     alignment and taxonomy information
>gi|297734346|emb|CBI15593.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|357521685|ref|XP_003631131.1| hypothetical protein MTR_8g107440 [Medicago truncatula] gi|355525153|gb|AET05607.1| hypothetical protein MTR_8g107440 [Medicago truncatula] Back     alignment and taxonomy information
>gi|297847122|ref|XP_002891442.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. lyrata] gi|297337284|gb|EFH67701.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|42571803|ref|NP_973992.1| Outer arm dynein light chain 1 protein [Arabidopsis thaliana] gi|332194191|gb|AEE32312.1| Outer arm dynein light chain 1 protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|42562612|ref|NP_175287.2| Outer arm dynein light chain 1 protein [Arabidopsis thaliana] gi|332194190|gb|AEE32311.1| Outer arm dynein light chain 1 protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297830430|ref|XP_002883097.1| hypothetical protein ARALYDRAFT_898146 [Arabidopsis lyrata subsp. lyrata] gi|297328937|gb|EFH59356.1| hypothetical protein ARALYDRAFT_898146 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query950
TAIR|locus:2198065 1063 AT1G48540 [Arabidopsis thalian 0.64 0.571 0.582 1.5e-210
TAIR|locus:20885251010 AT3G17920 [Arabidopsis thalian 0.504 0.474 0.675 2.2e-209
UNIPROTKB|Q5F479 1073 STK11IP "Serine/threonine-prot 0.254 0.225 0.306 2.8e-23
RGD|1305046 1072 Stk11ip "serine/threonine kina 0.261 0.231 0.329 1.5e-22
UNIPROTKB|F1ML95 1073 STK11IP "Uncharacterized prote 0.261 0.231 0.321 2.3e-22
ZFIN|ZDB-GENE-040426-1022 1160 stk11ip "serine/threonine kina 0.330 0.270 0.276 1.4e-21
MGI|MGI:1918978 1072 Stk11ip "serine/threonine kina 0.261 0.231 0.329 1.4e-21
UNIPROTKB|C9JQV3 1088 STK11IP "Serine/threonine-prot 0.255 0.223 0.333 1.8e-21
UNIPROTKB|Q8N1F8 1099 STK11IP "Serine/threonine-prot 0.255 0.221 0.333 1.9e-21
UNIPROTKB|F1P3Y6 1001 F1P3Y6 "Uncharacterized protei 0.232 0.220 0.307 3.7e-21
TAIR|locus:2198065 AT1G48540 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1806 (640.8 bits), Expect = 1.5e-210, Sum P(2) = 1.5e-210
 Identities = 362/621 (58%), Positives = 455/621 (73%)

Query:     1 MAIVTGDRYLEKLVKFVEQQAGPLIEGSIVLKLNPAGLHYVQSXXXXXXXXXXXXXXXXX 60
             MAIVTGDRY+EKL KF+E +A  L+E +++LKLNPAGLHY+                   
Sbjct:     1 MAIVTGDRYVEKLQKFLEDEAESLLEETMILKLNPAGLHYLHLRLDSLRELERMLSNAPV 60

Query:    61 DYLRAYVSDLGDHRALEQLRRILKLLTSLKVVSALPPPARDPTPLSLLPFCRLKVLELRG 120
             DYLRAYVSDLGD+RALEQLRRIL++LTSLKVVS LP PARDPTPLSL PF  LKVLELR 
Sbjct:    61 DYLRAYVSDLGDYRALEQLRRILRILTSLKVVSTLPSPARDPTPLSLFPFGSLKVLELRR 120

Query:   121 CDLSTSAAKGLLELRHTLEKIICHNSTNALRHVFASRIVEIKDSPQWNRLSFVSCSCNRL 180
             CDLSTS AKGL+ELRHTLEKIICHNST+ALRHVFASRI EI +SP+WN+L+ +SC+CNRL
Sbjct:   121 CDLSTSPAKGLIELRHTLEKIICHNSTDALRHVFASRIAEITNSPEWNKLAVISCACNRL 180

Query:   181 VIMDESLQLLPAVETLDLSRNKFAKVDNLRKCVNLKHLDLGFNNLRSIAAFSEVSCHIVK 240
             V+MDESLQLLPA E+LDLSRNKF KVDNLR+C  LKHLDLGFN+LR+++  S+VSCH+VK
Sbjct:   181 VLMDESLQLLPAAESLDLSRNKFVKVDNLRRCTKLKHLDLGFNHLRTVSYLSQVSCHLVK 240

Query:   241 LVLRNNALTTLRGIENLKSLEGLDISYNIISTFSELEFLASLPYLLNLWLEGNPLCCSRW 300
             LVLRNNALTTLRGIENLKSL+GLD+SYNIIS FSELEFL SL  L  LWLEGNP+CC+RW
Sbjct:   241 LVLRNNALTTLRGIENLKSLQGLDVSYNIISNFSELEFLWSLSQLKELWLEGNPVCCARW 300

Query:   301 YRAQVFSYFAHPAKLKVDGKEISTRELWERQLIIARRQKRPAGFGFYSPAKGNADGDGNA 360
             YRA VFSY A P +LK+DGK+I TRE W+RQ+I+A RQ  PA +GFYSPA+   + +G+ 
Sbjct:   301 YRAHVFSYVALPDELKLDGKQIGTREFWKRQIIVAHRQSEPASYGFYSPAREEDNEEGSC 360

Query:   361 NRKRKKACRLASIESEEESTCVGSDRESVSCDNEIESKEENVASDDDAEIIDLMSRVEHM 420
             NRK+KK CRLASI SE EST V SD ES +CD+E    +EN+  + +A+I  L+S+VEH+
Sbjct:   361 NRKKKKICRLASIHSEAESTYVNSDHESATCDHE---NKENMKFNQEADIFGLISKVEHL 417

Query:   421 KRERSILWLREFKEWMDHTSENFVDGSICSGATLMNCEEDNYIKNKR-SQPHLAESSKYV 479
             K+ERS+LWLREFKEWMD ++E+F D  +C  +  +N E+  Y K +  S+ H   + +Y 
Sbjct:   418 KKERSVLWLREFKEWMDRSTEDFAD--VCKDSQGINLEKKYYTKIREISRHHGGGTPRYT 475

Query:   480 SGSVQASGDESSTNILESENSYADMPTGLHAYQSFDHIGSLGITGGFSLPGIGRMELRQE 539
             SGS++AS  +S    LE   S  D   G+   +  +   +  IT   S   +   +  Q+
Sbjct:   476 SGSLRASRAKSYRKNLECNGSCVDHKAGMDYMKYVEGNETQKITDDISSISLQSTDRNQK 535

Query:   540 NEKPYLHDGAGAATVQSKSFHQDTFTIQDRRMVENIHESPLTPIDDITDAFSSSARPGSP 599
             +++  +HD   + +V+       T  +   ++ EN + S L    DIT   + S  PGSP
Sbjct:   536 HQE-CVHDEMESLSVEPNDLLPTT--LAKEKLAENGNMSTL----DITQHMTGSTYPGSP 588

Query:   600 PHYREDILHRRHNLVAEILQL 620
             PHY++D+L+RRHNLV EILQL
Sbjct:   589 PHYQKDVLYRRHNLVEEILQL 609
GO:0005737 "cytoplasm" evidence=ISM
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2088525 AT3G17920 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q5F479 STK11IP "Serine/threonine-protein kinase 11-interacting protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
RGD|1305046 Stk11ip "serine/threonine kinase 11 interacting protein" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1ML95 STK11IP "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-1022 stk11ip "serine/threonine kinase 11 interacting protein" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:1918978 Stk11ip "serine/threonine kinase 11 interacting protein" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|C9JQV3 STK11IP "Serine/threonine-protein kinase 11-interacting protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q8N1F8 STK11IP "Serine/threonine-protein kinase 11-interacting protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1P3Y6 F1P3Y6 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query950
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 2e-07
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 8e-06
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 1e-04
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 1e-04
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 2e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 6e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.001
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.001
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.002
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information 
 Score = 53.8 bits (129), Expect = 2e-07
 Identities = 60/207 (28%), Positives = 87/207 (42%), Gaps = 18/207 (8%)

Query: 102 PTPLSLLPFCRLKVLELRGCDLST-----SAAKGLLELRH---TLEKIICHNST-NALRH 152
           P+PL  LP   LK L+L   DLS      S    L  L      +  +       +AL  
Sbjct: 156 PSPLRNLPN--LKNLDLSFNDLSDLPKLLSNLSNLNNLDLSGNKISDLPPEIELLSALEE 213

Query: 153 VFASR---IVEIKDSPQWNRLSFVSCSCNRLVIMDESLQLLPAVETLDLSRNKFAKVDNL 209
           +  S    I  +        LS +  S N+L  + ES+  L  +ETLDLS N+ + + +L
Sbjct: 214 LDLSNNSIIELLSSLSNLKNLSGLELSNNKLEDLPESIGNLSNLETLDLSNNQISSISSL 273

Query: 210 RKCVNLKHLDLGFNNLRSIAAFSEVSCHIVKLVLRNNALTTLR-GIENLKSLEGLDISYN 268
               NL+ LDL  N+L S A        ++  +L N  LT     ++    L   +I  N
Sbjct: 274 GSLTNLRELDLSGNSL-SNALPLIALLLLLLELLLNLLLTLKALELKLNSILLNNNILSN 332

Query: 269 IISTFSELEFLASLPYLLNLWLEGNPL 295
             ++  E   L+ L  L NLW   N L
Sbjct: 333 GETSSPEA--LSILESLNNLWTLDNAL 357

Length = 394
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 950
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 100.0
KOG4194873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.86
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.86
PLN00113968 leucine-rich repeat receptor-like protein kinase; 99.84
PLN00113968 leucine-rich repeat receptor-like protein kinase; 99.83
KOG4194873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.82
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.76
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.76
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.68
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.67
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.67
KOG06181081 consensus Serine/threonine phosphatase 2C containi 99.65
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.65
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.65
KOG4237498 consensus Extracellular matrix protein slit, conta 99.64
KOG06181081 consensus Serine/threonine phosphatase 2C containi 99.6
PLN032101153 Resistant to P. syringae 6; Provisional 99.56
KOG0617264 consensus Ras suppressor protein (contains leucine 99.55
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.54
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.54
PLN032101153 Resistant to P. syringae 6; Provisional 99.53
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.5
KOG4237498 consensus Extracellular matrix protein slit, conta 99.5
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.49
KOG0617264 consensus Ras suppressor protein (contains leucine 99.48
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.43
KOG0532722 consensus Leucine-rich repeat (LRR) protein, conta 99.26
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.16
KOG2982418 consensus Uncharacterized conserved protein [Funct 99.15
KOG0532722 consensus Leucine-rich repeat (LRR) protein, conta 99.1
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.02
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.01
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.96
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.92
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.88
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.81
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.8
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.76
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.65
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.46
PLN03150623 hypothetical protein; Provisional 98.34
PLN03150623 hypothetical protein; Provisional 98.29
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.26
KOG2123388 consensus Uncharacterized conserved protein [Funct 98.2
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.12
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.07
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.05
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.95
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 97.9
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 97.84
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.72
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.59
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.59
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.57
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.53
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.44
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 97.42
PRK15386426 type III secretion protein GogB; Provisional 97.29
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 97.24
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.05
PRK15386426 type III secretion protein GogB; Provisional 97.04
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 96.69
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.43
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 95.91
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 95.64
KOG3763585 consensus mRNA export factor TAP/MEX67 [RNA proces 94.96
KOG4308478 consensus LRR-containing protein [Function unknown 94.05
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 93.8
KOG4308478 consensus LRR-containing protein [Function unknown 91.62
KOG1947482 consensus Leucine rich repeat proteins, some prote 90.64
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 88.37
KOG0473326 consensus Leucine-rich repeat protein [Function un 87.5
KOG4341483 consensus F-box protein containing LRR [General fu 87.31
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 86.03
KOG0473326 consensus Leucine-rich repeat protein [Function un 80.72
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information 
Probab=100.00  E-value=1.3e-93  Score=816.20  Aligned_cols=878  Identities=43%  Similarity=0.628  Sum_probs=744.0

Q ss_pred             cchhhHHHHHHHHhhcccccccCCcEEEec-CCCccchhhhhhhccccccccCCCCccccccccccCCCCccchhHHHHh
Q 002227            5 TGDRYLEKLVKFVEQQAGPLIEGSIVLKLN-PAGLHYVQSRLEALRELERLLAGAPLDYLRAYVSDLGDHRALEQLRRIL   83 (950)
Q Consensus         5 ~G~~yl~~li~~l~~~~~slL~~l~~L~L~-~~~L~~Lp~~L~~L~~Le~L~~~~~L~~L~l~vLdLs~n~~l~~Lp~~L   83 (950)
                      +|++|++.+.+|++.+++.++.+..+|.|+ +..++....++..+.+|+....+.+.+++++.+.+.++.+.+.++..++
T Consensus         1 ~~d~~l~kLa~lLre~gD~lLsg~~tL~L~~p~l~~lnh~~l~s~~EL~lg~~g~~~~~f~a~~s~~ads~vl~qLq~i~   80 (1096)
T KOG1859|consen    1 TGDRYLEKLANLLRENGDKLLSGTFTLKLNGPALLHLNHLRLISLRELELGLSGAPVDYFRAYVSDNADSRVLEQLQRIL   80 (1096)
T ss_pred             CccHHHHHHHHHHHhcccceecceeEEEeccHHHHHHHHHHHHhhHHHhhccCCCCCceeEEecCCcccchHHHHHHHHH
Confidence            589999999999999999999999999999 4455555666788888888888999999999999999999999998888


Q ss_pred             cCCCCCcEEEccCCCCCCCC-CccCCCCCCCcEEEeeCCCCCccchhhHHhhhhhhhhhhccCCCccchhhhcccccccc
Q 002227           84 KLLTSLKVVSALPPPARDPT-PLSLLPFCRLKVLELRGCDLSTSAAKGLLELRHTLEKIICHNSTNALRHVFASRIVEIK  162 (950)
Q Consensus        84 ~~L~~L~~LdLs~N~L~~~i-P~sL~~L~nL~~LdLS~N~Ls~~lP~sL~~L~~Ll~LlL~~N~L~sL~~l~~~~i~~L~  162 (950)
                      .-+++++.|.+-.-.-.+.. |-.|..+..|+.|.|.++.|..  ..++..+.+.++.++|+|.++++++++..++.++.
T Consensus        81 d~lqkt~~lkl~~~pa~~pt~pi~ifpF~sLr~LElrg~~L~~--~~GL~~lr~qLe~LIC~~Sl~Al~~v~ascggd~~  158 (1096)
T KOG1859|consen   81 DFLQKTKVLKLLPSPARDPTEPISIFPFRSLRVLELRGCDLST--AKGLQELRHQLEKLICHNSLDALRHVFASCGGDIS  158 (1096)
T ss_pred             HHHhhheeeeecccCCCCCCCCceeccccceeeEEecCcchhh--hhhhHHHHHhhhhhhhhccHHHHHHHHHHhccccc
Confidence            88888888887666555544 7789999999999999999976  77899999999999999999999999999999999


Q ss_pred             CCCCCCCccEEEccCCcCccchhhcCCCCCCcEEEccCCCCCCCcCcCCCCCCcEEECCCCCccccccccccccceeEEE
Q 002227          163 DSPQWNRLSFVSCSCNRLVIMDESLQLLPAVETLDLSRNKFAKVDNLRKCVNLKHLDLGFNNLRSIAAFSEVSCHIVKLV  242 (950)
Q Consensus       163 ~L~~L~~L~~L~Ls~N~Lt~LP~sL~~L~~L~~LdLS~N~Lt~l~~L~~L~~L~~LdLS~N~L~~L~~l~~~L~~L~~L~  242 (950)
                      +-+.|..|...++++|.|..+..++.-++.|+.|+|++|+++.+..+..|+.|++|||++|.++.+|.+...-..|+.|.
T Consensus       159 ns~~Wn~L~~a~fsyN~L~~mD~SLqll~ale~LnLshNk~~~v~~Lr~l~~LkhLDlsyN~L~~vp~l~~~gc~L~~L~  238 (1096)
T KOG1859|consen  159 NSPVWNKLATASFSYNRLVLMDESLQLLPALESLNLSHNKFTKVDNLRRLPKLKHLDLSYNCLRHVPQLSMVGCKLQLLN  238 (1096)
T ss_pred             cchhhhhHhhhhcchhhHHhHHHHHHHHHHhhhhccchhhhhhhHHHHhcccccccccccchhccccccchhhhhheeee
Confidence            99999999999999999999999999999999999999999999999999999999999999999998765445699999


Q ss_pred             ecCCCCCCcccCCCCCCCCEEEccCCCCCCCchhhhcCCCCCCcEEEecCCCCCCCcccchhHhhccC---CCcccccCC
Q 002227          243 LRNNALTTLRGIENLKSLEGLDISYNIISTFSELEFLASLPYLLNLWLEGNPLCCSRWYRAQVFSYFA---HPAKLKVDG  319 (950)
Q Consensus       243 Ls~N~Ls~Lp~L~~L~sL~~LdLs~N~Ls~l~~l~~L~~L~~L~~L~LsgNpLt~~~~~r~~~~~~L~---~L~~L~Ldg  319 (950)
                      |++|.++.+.++.++.+|+.|||++|.|.+...+..++.|..|+.|+|.|||++|.+|+|...+.++.   .+..+.|||
T Consensus       239 lrnN~l~tL~gie~LksL~~LDlsyNll~~hseL~pLwsLs~L~~L~LeGNPl~c~p~hRaataqYl~~~~a~~~f~LDg  318 (1096)
T KOG1859|consen  239 LRNNALTTLRGIENLKSLYGLDLSYNLLSEHSELEPLWSLSSLIVLWLEGNPLCCAPWHRAATAQYLHKNSAPVKFKLDG  318 (1096)
T ss_pred             ecccHHHhhhhHHhhhhhhccchhHhhhhcchhhhHHHHHHHHHHHhhcCCccccCHHHHHHHHhHhccccCCcceEecc
Confidence            99999999999999999999999999999998888899999999999999999999999999988887   677899999


Q ss_pred             CcCChhHHHHHHHHHHhhcCCCCCccccCCCCCCCCCCCchhhhhhhhhhhccccccccccccC--CCCCCcCCCccccc
Q 002227          320 KEISTRELWERQLIIARRQKRPAGFGFYSPAKGNADGDGNANRKRKKACRLASIESEEESTCVG--SDRESVSCDNEIES  397 (950)
Q Consensus       320 N~Is~~e~~~~~~l~~~~~~~p~~~~~~~p~~~~~~~e~~~~~k~k~~~Rla~i~~ee~~~~~~--SdqeS~~c~~~s~s  397 (950)
                      ..++..++++.+.....+...|..|+.|+|+......++++.++++++.+++.+..++...++.  |++++..|+.+..+
T Consensus       319 k~l~~~efwk~~s~~~hr~~~p~s~~~~S~a~~~~~~dgS~~~s~gki~tl~~ihs~~~s~~v~r~S~~e~at~DpE~~s  398 (1096)
T KOG1859|consen  319 KALGGREFWKRQSGVSHRSSRPASYGFYSPARSENTSDGSQFRSKGKIYTLASIHSEDESTYVNRISDCESATCDPEESS  398 (1096)
T ss_pred             eeccchhhhhhhhheecCCCCCCCCCCCCchhccCCCccchhhhcCceeecccccchhhhheeccccccccccCCccccc
Confidence            9999999999999999999999999999999999999999999999999999999999988887  89999999888665


Q ss_pred             c--cccCCCcchHHHHHHHHHHhhhhhccchhhHHHHHHhhhcccccccCcceeeCcccccccchhhhhhccCCccc-cc
Q 002227          398 K--EENVASDDDAEIIDLMSRVEHMKRERSILWLREFKEWMDHTSENFVDGSICSGATLMNCEEDNYIKNKRSQPHL-AE  474 (950)
Q Consensus       398 ~--ee~~~sd~d~ei~dl~~~vE~Lkke~s~~Wl~ef~ew~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~  474 (950)
                      .  .+.+....+..+.++++++++++++++..|+|+|+|||+.....++++.+.+..+.++++  +|.+.....++| +.
T Consensus       399 ~~~t~a~~f~q~~pe~el~s~~~hl~~~r~vl~lR~~~Ew~~~p~~~~~~~s~~sqpt~seq~--~~tk~rn~p~~e~~g  476 (1096)
T KOG1859|consen  399 EINTEAAKFSQEAPEFELISKVEHLKKERSVLWLREFKEWLDSPNEDFMDVSKTSQPTESEQK--YYTKLRNEPLHEGSG  476 (1096)
T ss_pred             cCCCccccccCCCchhhhccchHHHhhhhhHHHHHHHhhhhcCCchhhccccCCCCCcchhcC--cccccCCCCcccccC
Confidence            5  556666677778999999999999999999999999999999999999999999999986  344444444444 48


Q ss_pred             ccccccccccccCCCCcccccccCCccccCcccccccccccccCccccccCcccCCcccccccccccCCccCCCCCcccc
Q 002227          475 SSKYVSGSVQASGDESSTNILESENSYADMPTGLHAYQSFDHIGSLGITGGFSLPGIGRMELRQENEKPYLHDGAGAATV  554 (950)
Q Consensus       475 ~s~~~~~~~~~~~~~~~~~~~e~~~s~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  554 (950)
                      +.||++|+..++-..+.+|.+|..++|.|+-+|+..+++.....++-+|.....+.-.-.|+||.+   +.+++||....
T Consensus       477 ~p~~tp~sl~~~i~~~p~~n~e~~~~~~~~~~g~~~e~~~e~~et~~et~~e~~~~~~et~ln~~~---~~c~legpp~~  553 (1096)
T KOG1859|consen  477 TPRYTPGSLHHNISSTPTNNVELASTFDATITGIKSEANDESGETLYETCTEGEETNQETDLNQKH---QLCTLEGPPDR  553 (1096)
T ss_pred             CCcCCCCccchhhccCcccchhhcccccccccchhhhcccccccccccccccchhhhhhhhccccc---eeccccCCccc
Confidence            999999999999999999999999999999999999999999999999988888888899999666   89999999988


Q ss_pred             c-------ccccccccccccccccccccccCCCccccccccCCCCCCCCCCCCcchhhhhhhhhhhHHHHHhhccce---
Q 002227          555 Q-------SKSFHQDTFTIQDRRMVENIHESPLTPIDDITDAFSSSARPGSPPHYREDILHRRHNLVAEILQLSAES---  624 (950)
Q Consensus       555 ~-------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~spp~~~~d~l~rr~~~~~e~lq~~~~~---  624 (950)
                      +       +.|-+-.++.+++.+..|||+|+.+.    +.++---+.+|+||||||+|+|+||+||++||||++||+   
T Consensus       554 ~~~~~~l~vss~~l~e~~l~~a~~dE~~~m~tle----a~q~e~~s~~~sSp~~~~kD~L~~r~~lsl~il~ic~d~~~~  629 (1096)
T KOG1859|consen  554 HEELLRLYVSSSNLQEDPLSDAESDENGNMSTLE----AKQSETGSLTPSSPPHYQKDVLTRRANLSLEILQICADSRSI  629 (1096)
T ss_pred             chhhheeecccccccccchhhhhhhcccceeeee----cccccccccCCCCCCCccccccccchhHHHHHHHhCcccccc
Confidence            8       88888889999999999999999984    444434448999999999999999999999999999999   


Q ss_pred             -eeeeeCCCCCcCCccCCCCCCC--CcccccccCCcccccCccccccccchhc-------cccC--CC-CC--Cccccc-
Q 002227          625 -YSVVSSDSKTSCSDDDFREYGP--SMLEVDQSINPEHEYSSAEVHSLLNLFE-------EDHN--DQ-PH--EIDCQR-  688 (950)
Q Consensus       625 -~~~~s~~~~~s~s~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~-------~~~~--~~-~~--~~~~~~-  688 (950)
                       |+|+|+|+.++|++++.++.+.  ++.|+          ....+.+..|++.       .--|  +| +.  .|--.+ 
T Consensus       630 ~y~v~~~D~~ss~~e~en~ls~~~~~~~eq----------~~~~rdL~~~r~~i~~C~~cgt~F~~eqp~kg~~~kelr~  699 (1096)
T KOG1859|consen  630 NYSVASSDKQSSCSEVENYLSEELESNLEQ----------ILLQRDLTENRISIYRCVNCGTQFLIEQPEKGSKIKELRC  699 (1096)
T ss_pred             cceeecccccchhhhhhhcccHhhhhhHhh----------hhhhhhhhccccceeeeccccccccccCcccccchhhhcC
Confidence             9999999999999999998877  56553          3334444444431       0001  11 11  122222 


Q ss_pred             cc-cc--cccccCCCCCCCccccchhhhhHHHhcc--ccccceeeehhhccccchhhhhhhhccCCcccCccccccCCcc
Q 002227          689 EN-CK--NNGFSAGGNDGEVDSSVNQEAHLLEKNK--RKHTRRVISLLKEQNTVAKTEALQNLNGNLNISEADNVGEQGK  763 (950)
Q Consensus       689 ~~-~~--~~~f~~~~~~~~~~~~~~~~~~~~~~~~--~k~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  763 (950)
                      ++ +|  +++|.+|.|.-+-.++|||+.+|..|+-  |||++|.+..+++..-+    -++|--|+- .+.+|..+    
T Consensus       700 pd~~k~~t~~v~~~~~s~~~~~~v~a~~rl~p~~~~~rkp~e~~~ap~~~es~~----ci~kg~~sh-l~~ad~s~----  770 (1096)
T KOG1859|consen  700 PDSRKVYTTNVTSGLHSLKPSGGVNAEPRLSPKMIVERKPVERLVAPINEESSN----CIGKGEASH-LSDADISD----  770 (1096)
T ss_pred             cchhhcccccccccccccCCccceecccccCcchhhhccchhhhcccccccccc----ccCccchhh-hhhcccCC----
Confidence            33 34  7899999999777789999999999988  99999999988876510    011111221 22222222    


Q ss_pred             eeeeccccccccchhc-ccccc-ccccccc--cccccccccccch-----hhh-HHHhhhccccCCchhHhhccceEE-E
Q 002227          764 HIFGLNYLLRTSDKKQ-TRENA-VMTPYIS--GIGSVAKFLSSVK-----EDF-VEDYFNKNVADSKSHETCMQYTVC-W  832 (950)
Q Consensus       764 ~~~~~~~~~~~~~~~~-~~~~~-~~~~~~~--~~~~~~~~~~~~~-----~~~-~~~~f~~~~~~~~~~e~~~~~~~~-~  832 (950)
                            .+-..++.++ ..+|. -...|-.  -..|...|.+|+.     ..| ++.||-+..|+++..|+|+.||.| +
T Consensus       771 ------~~e~~~~rDh~fw~ns~lp~~c~~~~~~~rs~~FLe~E~~~~~~e~~q~~~~~paklav~S~~~~c~~~vS~~~  844 (1096)
T KOG1859|consen  771 ------SDEDNTIRDHEFWENSSLPHLCTSHDEVARSKSFLETEFGLLLAEQAQVEELFPAKLAVSSHVETCRSYVSCDV  844 (1096)
T ss_pred             ------ccccccccccchhccCCCCcccccchhhHHHHHHHHHHhhhhhhhhcccccccchhhccCCCCceeEEEecccc
Confidence                  1111122222 12222 1111111  0111223444433     344 899999999999999999999999 9


Q ss_pred             EEecCCccccee-------EEEEeecCCeeEEEEEeeeecCCcccccccccccchhhHHHhhhccceEEEEE--------
Q 002227          833 ILEQDFMHRGRE-------VAVLRSSENKFYVLLFGVTVDGTGSILNLLGCHKIEDIREVLIGLGLQVLRVS--------  897 (950)
Q Consensus       833 ~~~~~~~~~~~e-------~~~l~ss~~k~~~ll~~~~~~~~~~~~~~l~~~~~~~~~~v~~g~glq~~r~~--------  897 (950)
                      |+|.+++|+|||       ++||++||||+||+|++|+.|-+++.++++|.|-+.|+|.|.||||+|++++.        
T Consensus       845 i~~~~sTyeqre~~a~~lq~~Ll~~sqd~l~~gl~g~S~~le~sa~s~~c~~~~~d~q~~~~~l~~~~~~Les~~~~~~~  924 (1096)
T KOG1859|consen  845 ILQICSTYEQRETDAPQLQNVLLLSSQDKLYVGLVGVSTDLEKSALSALCSHFISDFQDVSVGLGLQKVLLESEATVFQP  924 (1096)
T ss_pred             hhhhhchhhhcCCCchhhhheeecccccceeeeeccccchhhhhhcccccccchhhhhhhhhHHHHHHHHHhccchhhhc
Confidence            999999999999       99999999999999999999999999999999999999999999999998765        


Q ss_pred             ----------eecCcEEEEEeccHHHHHHHh
Q 002227          898 ----------TEMGATYLLMTRSIEKSRQLF  918 (950)
Q Consensus       898 ----------~~~~~~~~~~t~~~~~~~~~~  918 (950)
                                +-..-.|+|.+|+++|+++++
T Consensus       925 ~~~~~~~~~~i~hrl~~~f~~~~fkE~~e~f  955 (1096)
T KOG1859|consen  925 YKFNYSDFNDIDHRLKLYFYQRKFKEDGELF  955 (1096)
T ss_pred             cccccccccchhhhhhhhhhhhhhhhhhHHH
Confidence                      345567899999999999995

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG3763 consensus mRNA export factor TAP/MEX67 [RNA processing and modification] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query950
1m9l_A199 Relaxation-Based Refined Structure Of Chlamydomonas 3e-10
1ds9_A198 Solution Structure Of Chlamydomonas Outer Arm Dynei 3e-10
1ltx_A567 Structure Of Rab Escort Protein-1 In Complex With R 9e-05
1dce_A567 Crystal Structure Of Rab Geranylgeranyltransferase 1e-04
2z80_A353 Crystal Structure Of The Tlr1-Tlr2 Heterodimer Indu 2e-04
2z7x_A549 Crystal Structure Of The Tlr1-Tlr2 Heterodimer Indu 4e-04
>pdb|1M9L|A Chain A, Relaxation-Based Refined Structure Of Chlamydomonas Outer Arm Dynein Light Chain 1 Length = 199 Back     alignment and structure 
Iteration: 1

 Score = 64.3 bits (155), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 50/151 (33%), Positives = 75/151 (49%), Gaps = 9/151 (5%)
Query: 183 MDESLQLLPAVETLDLSRNKFAKVDNLRKCVNLKHLDLGFNNLRSIAAFSEVSCHIVKLV 242
           MD +L  L A + L LS N   K+ +L    NL+ L LG N ++ I     V+  + +L 
Sbjct: 41  MDATLSTLKACKHLALSTNNIEKISSLSGMENLRILSLGRNLIKKIENLDAVADTLEELW 100
Query: 243 LRNNALTTLRGIENLKSLEGLDISYNIISTFSELEFLASLPYLLNLWLEGNPLC------ 296
           +  N + +L GIE L +L  L +S N I+ + E++ LA+L  L +L L GNPL       
Sbjct: 101 ISYNQIASLSGIEKLVNLRVLYMSNNKITNWGEIDKLAALDKLEDLLLAGNPLYNDYKEN 160
Query: 297 -CSRWYRAQVFSYFAHPAKLKVDGKEISTRE 326
             +  YR +V      P   K+DG  +   E
Sbjct: 161 NATSEYRIEVVKRL--PNLKKLDGMPVDVDE 189
>pdb|1DS9|A Chain A, Solution Structure Of Chlamydomonas Outer Arm Dynein Light Chain 1 Length = 198 Back     alignment and structure
>pdb|1LTX|A Chain A, Structure Of Rab Escort Protein-1 In Complex With Rab Geranylgeranyl Transferase And Isoprenoid Length = 567 Back     alignment and structure
>pdb|1DCE|A Chain A, Crystal Structure Of Rab Geranylgeranyltransferase From Rat Brain Length = 567 Back     alignment and structure
>pdb|2Z80|A Chain A, Crystal Structure Of The Tlr1-Tlr2 Heterodimer Induced By Binding Of A Tri-Acylated Lipopeptide Length = 353 Back     alignment and structure
>pdb|2Z7X|A Chain A, Crystal Structure Of The Tlr1-Tlr2 Heterodimer Induced By Binding Of A Tri-Acylated Lipopeptide Length = 549 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query950
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-37
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 7e-26
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-22
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-21
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-16
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-15
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-11
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 6e-21
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 5e-18
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-12
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-20
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-20
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-20
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-19
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-15
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-14
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 2e-20
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 3e-19
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 1e-12
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-20
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-19
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-12
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-08
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 5e-19
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 5e-08
1o6v_A466 Internalin A; bacterial infection, extracellular r 7e-19
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-18
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-17
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-12
1o6v_A466 Internalin A; bacterial infection, extracellular r 6e-10
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-19
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-06
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-18
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-10
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-06
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 6e-18
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-13
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-10
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-17
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 9e-15
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-14
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-12
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-08
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-07
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 8e-17
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-13
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-11
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 9e-08
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-07
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-06
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-16
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 8e-10
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-16
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-14
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-12
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-06
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-16
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-13
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-05
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-16
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-12
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-10
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-05
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-16
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-09
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 9e-08
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-06
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-16
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-15
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-14
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-13
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-13
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-09
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-09
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-07
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-05
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-16
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-15
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 1e-15
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-15
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 7e-13
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-15
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 7e-11
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-10
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-15
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-14
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-13
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-13
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-09
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-07
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-15
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-12
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-15
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-12
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-11
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-05
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-05
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-14
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-14
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-14
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-13
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-12
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 7e-11
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 7e-09
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-14
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-14
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-13
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-12
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-12
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-11
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-08
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-06
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-14
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-09
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 3e-14
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 3e-13
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 4e-11
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 5e-10
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 7e-14
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-13
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-13
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 7e-13
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 8e-12
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-07
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-13
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-12
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-11
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-09
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-06
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-04
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-13
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-12
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-12
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-09
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-08
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-13
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-12
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-11
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-10
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-05
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-12
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-09
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-12
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-06
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-12
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-11
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-08
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-12
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-05
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-12
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-11
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-09
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-07
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 7e-06
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-05
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 6e-12
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 6e-11
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 5e-10
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-11
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-09
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-07
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 6e-11
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 9e-11
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-10
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-10
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-09
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 5e-09
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 9e-09
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-08
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-08
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-07
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-08
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-07
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-08
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-06
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-08
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 4e-08
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 5e-08
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-07
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-07
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-07
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 4e-07
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-06
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-06
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 5e-08
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 6e-08
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 1e-05
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 8e-04
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 6e-08
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 1e-07
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 9e-08
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-06
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-05
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 3e-07
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 2e-04
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 8e-07
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 1e-06
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-06
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 2e-06
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 5e-06
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 4e-04
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-06
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 6e-06
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 4e-05
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 7e-05
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 3e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 4e-04
3m19_A251 Variable lymphocyte receptor A diversity region; a 7e-04
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
 Score =  138 bits (350), Expect = 1e-37
 Identities = 55/179 (30%), Positives = 82/179 (45%), Gaps = 11/179 (6%)

Query: 157 RIVEIKDSPQWNRLSFVS--CSCNRLVIMDESLQLLPAVETLDLSRNKFAKVDNLRKCVN 214
           RI E + S        V        +  MD +L  L A + L LS N   K+ +L    N
Sbjct: 12  RIFEERKSVVATEAEKVELHGMIPPIEKMDATLSTLKACKHLALSTNNIEKISSLSGMEN 71

Query: 215 LKHLDLGFNNLRSIAAFSEVSCHIVKLVLRNNALTTLRGIENLKSLEGLDISYNIISTFS 274
           L+ L LG N ++ I     V+  + +L +  N + +L GIE L +L  L +S N I+ + 
Sbjct: 72  LRILSLGRNLIKKIENLDAVADTLEELWISYNQIASLSGIEKLVNLRVLYMSNNKITNWG 131

Query: 275 ELEFLASLPYLLNLWLEGNPLC-------CSRWYRAQVFSYFAHPAKLKVDGKEISTRE 326
           E++ LA+L  L +L L GNPL         +  YR +V     +  KL  DG  +   E
Sbjct: 132 EIDKLAALDKLEDLLLAGNPLYNDYKENNATSEYRIEVVKRLPNLKKL--DGMPVDVDE 188
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Length = 267 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query950
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.92
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.92
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.92
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.91
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.91
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.9
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.9
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.9
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.9
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.9
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.9
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.9
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.89
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.89
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.89
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.89
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.89
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.89
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.89
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.89
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.89
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.89
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.89
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.89
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.88
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.88
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.88
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.88
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.88
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.88
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.88
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.88
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.88
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.88
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.87
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.87
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.87
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.87
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.87
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.86
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.86
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.86
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.86
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.86
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.86
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.86
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.86
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.86
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.86
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.86
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.86
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.86
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.85
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.85
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.85
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.84
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.84
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.84
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 99.84
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.84
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.84
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 99.83
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.83
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.83
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.82
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.82
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.82
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.81
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.81
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.81
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.8
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.8
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.79
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.79
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.78
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.78
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.78
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.77
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.77
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.77
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.76
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.76
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.75
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.74
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.73
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.73
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.73
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.72
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.72
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.71
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.71
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.7
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.7
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.69
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.69
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.68
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.67
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.66
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.66
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.65
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.64
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.63
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.62
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.61
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.61
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.6
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.6
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.59
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.59
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.59
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.59
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.59
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.56
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.56
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.53
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.51
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.51
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.5
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.49
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.49
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.47
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.46
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.45
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.45
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.44
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.43
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.4
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.39
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.38
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.34
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.32
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.32
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.31
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.26
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.25
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.21
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.18
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.18
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.11
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.11
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.05
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.03
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.0
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.94
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.93
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.86
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.27
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.27
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.22
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.22
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.08
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.06
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.98
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.82
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.75
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.6
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.34
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.26
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.92
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 96.88
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.75
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 96.56
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.25
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 95.61
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
Probab=99.92  E-value=6.3e-25  Score=246.11  Aligned_cols=293  Identities=14%  Similarity=0.140  Sum_probs=228.4

Q ss_pred             ccCCcEEEecCCCccchhhhh-hhccccccccCC-CCccc---------cccccccCCCCccchhHHHHhcCCCCCcEEE
Q 002227           25 IEGSIVLKLNPAGLHYVQSRL-EALRELERLLAG-APLDY---------LRAYVSDLGDHRALEQLRRILKLLTSLKVVS   93 (950)
Q Consensus        25 L~~l~~L~L~~~~L~~Lp~~L-~~L~~Le~L~~~-~~L~~---------L~l~vLdLs~n~~l~~Lp~~L~~L~~L~~Ld   93 (950)
                      +.+++.|++..+.+..+|..+ ..++.|+.+... ..+..         -.+..+++++|......|..|.++++|+.|+
T Consensus        44 l~~l~~l~l~~~~l~~l~~~~~~~l~~L~~L~L~~n~i~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~  123 (390)
T 3o6n_A           44 LNNQKIVTFKNSTMRKLPAALLDSFRQVELLNLNDLQIEEIDTYAFAYAHTIQKLYMGFNAIRYLPPHVFQNVPLLTVLV  123 (390)
T ss_dssp             GCCCSEEEEESCEESEECTHHHHHCCCCSEEECTTSCCCEECTTTTTTCTTCCEEECCSSCCCCCCTTTTTTCTTCCEEE
T ss_pred             cCCceEEEecCCchhhCChhHhcccccCcEEECCCCcccccChhhccCCCCcCEEECCCCCCCcCCHHHhcCCCCCCEEE
Confidence            577889999999999998764 667767665442 11111         1234677888776665566788899999999


Q ss_pred             ccCCCCCCCCCccCCCCCCCcEEEeeCCCCCccchhhHHhhhhhhhhhhccCCCccchhhhcccccc-------ccCCCC
Q 002227           94 ALPPPARDPTPLSLLPFCRLKVLELRGCDLSTSAAKGLLELRHTLEKIICHNSTNALRHVFASRIVE-------IKDSPQ  166 (950)
Q Consensus        94 Ls~N~L~~~iP~sL~~L~nL~~LdLS~N~Ls~~lP~sL~~L~~Ll~LlL~~N~L~sL~~l~~~~i~~-------L~~L~~  166 (950)
                      |++|.+....+..|..+++|++|+|++|.+++..|..+..+++|..+.+.+|.+..+.......+..       +..+..
T Consensus       124 L~~n~l~~l~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~l~~L~~L~l~~n~l~~~~~  203 (390)
T 3o6n_A          124 LERNDLSSLPRGIFHNTPKLTTLSMSNNNLERIEDDTFQATTSLQNLQLSSNRLTHVDLSLIPSLFHANVSYNLLSTLAI  203 (390)
T ss_dssp             CCSSCCCCCCTTTTTTCTTCCEEECCSSCCCBCCTTTTSSCTTCCEEECCSSCCSBCCGGGCTTCSEEECCSSCCSEEEC
T ss_pred             CCCCccCcCCHHHhcCCCCCcEEECCCCccCccChhhccCCCCCCEEECCCCcCCccccccccccceeecccccccccCC
Confidence            9999888655556788899999999999998877778888888888888888877653221111110       111123


Q ss_pred             CCCccEEEccCCcCccchhhcCCCCCCcEEEccCCCCCCCcCcCCCCCCcEEECCCCCccccc-cccccccceeEEEecC
Q 002227          167 WNRLSFVSCSCNRLVIMDESLQLLPAVETLDLSRNKFAKVDNLRKCVNLKHLDLGFNNLRSIA-AFSEVSCHIVKLVLRN  245 (950)
Q Consensus       167 L~~L~~L~Ls~N~Lt~LP~sL~~L~~L~~LdLS~N~Lt~l~~L~~L~~L~~LdLS~N~L~~L~-~l~~~L~~L~~L~Ls~  245 (950)
                      .++|+.|++++|.+..+|..  .+++|+.|++++|.++.++.+..+++|+.|+|++|.++.++ ..+..+++|+.|+|++
T Consensus       204 ~~~L~~L~l~~n~l~~~~~~--~~~~L~~L~l~~n~l~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~L~~  281 (390)
T 3o6n_A          204 PIAVEELDASHNSINVVRGP--VNVELTILKLQHNNLTDTAWLLNYPGLVEVDLSYNELEKIMYHPFVKMQRLERLYISN  281 (390)
T ss_dssp             CSSCSEEECCSSCCCEEECC--CCSSCCEEECCSSCCCCCGGGGGCTTCSEEECCSSCCCEEESGGGTTCSSCCEEECCS
T ss_pred             CCcceEEECCCCeeeecccc--ccccccEEECCCCCCcccHHHcCCCCccEEECCCCcCCCcChhHccccccCCEEECCC
Confidence            45688888888888877653  35789999999999999988999999999999999999874 4556789999999999


Q ss_pred             CCCCCcc-cCCCCCCCCEEEccCCCCCCCchhhhcCCCCCCcEEEecCCCCCCCcccchhHhhccCCCcccccCCCcCCh
Q 002227          246 NALTTLR-GIENLKSLEGLDISYNIISTFSELEFLASLPYLLNLWLEGNPLCCSRWYRAQVFSYFAHPAKLKVDGKEIST  324 (950)
Q Consensus       246 N~Ls~Lp-~L~~L~sL~~LdLs~N~Ls~l~~l~~L~~L~~L~~L~LsgNpLt~~~~~r~~~~~~L~~L~~L~LdgN~Is~  324 (950)
                      |+|+.++ .+..+++|+.|+|++|.|+.++  ..+..+++|+.|+|++|+++..+      +..++.|+.++|++|++.+
T Consensus       282 n~l~~~~~~~~~l~~L~~L~L~~n~l~~~~--~~~~~l~~L~~L~L~~N~i~~~~------~~~~~~L~~L~l~~N~~~~  353 (390)
T 3o6n_A          282 NRLVALNLYGQPIPTLKVLDLSHNHLLHVE--RNQPQFDRLENLYLDHNSIVTLK------LSTHHTLKNLTLSHNDWDC  353 (390)
T ss_dssp             SCCCEEECSSSCCTTCCEEECCSSCCCCCG--GGHHHHTTCSEEECCSSCCCCCC------CCTTCCCSEEECCSSCEEH
T ss_pred             CcCcccCcccCCCCCCCEEECCCCcceecC--ccccccCcCCEEECCCCccceeC------chhhccCCEEEcCCCCccc
Confidence            9999986 5678999999999999999987  45678899999999999998654      4567889999999999998


Q ss_pred             hHH
Q 002227          325 REL  327 (950)
Q Consensus       325 ~e~  327 (950)
                      ...
T Consensus       354 ~~~  356 (390)
T 3o6n_A          354 NSL  356 (390)
T ss_dssp             HHH
T ss_pred             hhH
Confidence            653
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 950
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 3e-15
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 3e-04
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-13
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 9e-12
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-10
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-08
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-06
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-04
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 2e-12
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 1e-08
d1m9la_198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 4e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.001
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-06
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 3e-06
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 1e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 2e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 3e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 2e-05
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.002
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.003
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 5e-05
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 4e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 7e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-04
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 4e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 0.002
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.003
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Rab geranylgeranyltransferase alpha-subunit, C-terminal domain
domain: Rab geranylgeranyltransferase alpha-subunit, C-terminal domain
species: Rat (Rattus norvegicus) [TaxId: 10116]

 Score = 70.9 bits (173), Expect = 3e-15
 Identities = 30/121 (24%), Positives = 55/121 (45%)

Query: 195 TLDLSRNKFAKVDNLRKCVNLKHLDLGFNNLRSIAAFSEVSCHIVKLVLRNNALTTLRGI 254
            L L+      + +L + + + HLDL  N LR++         +  L   +NAL  + G+
Sbjct: 2   VLHLAHKDLTVLCHLEQLLLVTHLDLSHNRLRALPPALAALRCLEVLQASDNALENVDGV 61

Query: 255 ENLKSLEGLDISYNIISTFSELEFLASLPYLLNLWLEGNPLCCSRWYRAQVFSYFAHPAK 314
            NL  L+ L +  N +   + ++ L S P L+ L L+GN LC     + ++       + 
Sbjct: 62  ANLPRLQELLLCNNRLQQSAAIQPLVSCPRLVLLNLQGNSLCQEEGIQERLAEMLPSVSS 121

Query: 315 L 315
           +
Sbjct: 122 I 122
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query950
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.84
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.84
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.81
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.81
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.8
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.79
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.78
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.77
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.75
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.75
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.71
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.69
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.69
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.65
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.65
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.64
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.61
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.61
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.58
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.56
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.54
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.5
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.45
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.43
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.4
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.36
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.31
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.24
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.19
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.19
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.15
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.03
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.03
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.03
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.01
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.94
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.57
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.79
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.39
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.27
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.79
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.18
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: von Willebrand factor binding domain of glycoprotein Ib alpha
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.84  E-value=2e-20  Score=197.62  Aligned_cols=201  Identities=24%  Similarity=0.198  Sum_probs=157.9

Q ss_pred             CCCCCcEEEccCCCCCCCCCccCCCCCCCcEEEeeCCCCCccchhhHHhhhhhhhhhhccCCCccchhhhccccccccCC
Q 002227           85 LLTSLKVVSALPPPARDPTPLSLLPFCRLKVLELRGCDLSTSAAKGLLELRHTLEKIICHNSTNALRHVFASRIVEIKDS  164 (950)
Q Consensus        85 ~L~~L~~LdLs~N~L~~~iP~sL~~L~nL~~LdLS~N~Ls~~lP~sL~~L~~Ll~LlL~~N~L~sL~~l~~~~i~~L~~L  164 (950)
                      +...+..++.+++.++ .+|..|.  ++|++|+|++|.|++..+..|..+++|.++.+.+|.++.++.           .
T Consensus         8 ~~~~~~~v~C~~~~L~-~iP~~lp--~~l~~L~Ls~N~i~~l~~~~f~~l~~L~~L~L~~N~l~~l~~-----------~   73 (266)
T d1p9ag_           8 KVASHLEVNCDKRNLT-ALPPDLP--KDTTILHLSENLLYTFSLATLMPYTRLTQLNLDRAELTKLQV-----------D   73 (266)
T ss_dssp             CSTTCCEEECTTSCCS-SCCSCCC--TTCCEEECTTSCCSEEEGGGGTTCTTCCEEECTTSCCCEEEC-----------C
T ss_pred             ccCCCeEEEccCCCCC-eeCcCcC--cCCCEEECcCCcCCCcCHHHhhcccccccccccccccccccc-----------c
Confidence            4455666777777777 3565553  567788888888777666667777777777777776655432           2


Q ss_pred             CCCCCccEEEccCCcCccchhhcCCCCCCcEEEccCCCCCCCc--CcCCCCCCcEEECCCCCccccccc-cccccceeEE
Q 002227          165 PQWNRLSFVSCSCNRLVIMDESLQLLPAVETLDLSRNKFAKVD--NLRKCVNLKHLDLGFNNLRSIAAF-SEVSCHIVKL  241 (950)
Q Consensus       165 ~~L~~L~~L~Ls~N~Lt~LP~sL~~L~~L~~LdLS~N~Lt~l~--~L~~L~~L~~LdLS~N~L~~L~~l-~~~L~~L~~L  241 (950)
                      ..+++|+.|+|++|+++.++..+..+++|+.|++++|.+..++  .+..+.+|+.|++++|.+..+++. +..++.|+.|
T Consensus        74 ~~l~~L~~L~Ls~N~l~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~l~~l~~L~l~~n~l~~l~~~~~~~l~~l~~l  153 (266)
T d1p9ag_          74 GTLPVLGTLDLSHNQLQSLPLLGQTLPALTVLDVSFNRLTSLPLGALRGLGELQELYLKGNELKTLPPGLLTPTPKLEKL  153 (266)
T ss_dssp             SCCTTCCEEECCSSCCSSCCCCTTTCTTCCEEECCSSCCCCCCSSTTTTCTTCCEEECTTSCCCCCCTTTTTTCTTCCEE
T ss_pred             cccccccccccccccccccccccccccccccccccccccceeeccccccccccccccccccccceeccccccccccchhc
Confidence            3567899999999999988888889999999999999988864  577888999999999999988753 3457889999


Q ss_pred             EecCCCCCCcc--cCCCCCCCCEEEccCCCCCCCchhhhcCCCCCCcEEEecCCCCCCCccc
Q 002227          242 VLRNNALTTLR--GIENLKSLEGLDISYNIISTFSELEFLASLPYLLNLWLEGNPLCCSRWY  301 (950)
Q Consensus       242 ~Ls~N~Ls~Lp--~L~~L~sL~~LdLs~N~Ls~l~~l~~L~~L~~L~~L~LsgNpLt~~~~~  301 (950)
                      ++++|+|+.++  .+..+++|++|+|++|+|+.+|  ..+..+++|+.|+|++||+.|.|..
T Consensus       154 ~l~~N~l~~~~~~~~~~l~~L~~L~Ls~N~L~~lp--~~~~~~~~L~~L~L~~Np~~CdC~~  213 (266)
T d1p9ag_         154 SLANNNLTELPAGLLNGLENLDTLLLQENSLYTIP--KGFFGSHLLPFAFLHGNPWLCNCEI  213 (266)
T ss_dssp             ECTTSCCSCCCTTTTTTCTTCCEEECCSSCCCCCC--TTTTTTCCCSEEECCSCCBCCSGGG
T ss_pred             ccccccccccCccccccccccceeecccCCCcccC--hhHCCCCCCCEEEecCCCCCCCcch
Confidence            99999999875  5788999999999999999887  4466788999999999999988743
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure