Citrus Sinensis ID: 002276

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940---

MEEDQNHHHHQWADPLLLTDVSLQQRISHQYNSQNQIASPPRSHFVAMADSVFHHDPDDGTSWQNDPISNELVDGKSMLGFSLTSPDLVICGGSPEIPKSSYGESPEFSERIQCSFEVSLENGIKGSDDNNGSHKNKTPSVRFSSFNKEFSPESSLELLPPSTMPEQDPVPVVSINEDYREPMLLEAKRFSQLEECESTKDSGERGVKGDYERLKMSYECQKKELTEAKRTLEELKRENQLKNKEYQETWKSLQELQNELMRKSMHVGSLAFAIEGQVKEKSRWFSSLRDLTRRLKIMKMEHINLFEEALAYKKCAAEISEASSTIQSKINHQVQLYEHLKIKFIEGTKERKELYNKVLELKGNIRVFCRCRPLNSEETAAGSVMAVDFESVRDGELTVISNGAPKKTFKFDAVFGPQADQVDVFQDTAPFANSVLDGYNVCIFAYGQTGTGKTFTMEGTKEARGVNFRTLEELFRIIKEREKLYRYDISVSVLEVYNEQIRDLLAVGSQPGAVSKRLEVRQAGEGMHHVPGLVEAHVNNISEVWEVLQTGSNVRAVGSTNANEHSSRSHCMHCVMVRRELVEWGMHKEQAMASGSSRKNSKLTHLLQDSLGGDSKTLMFVQISPNENDLSETLCSLNFASRVRGIELGAAKKQLDTSELLRYKQMVEKTKQELKSRDVQSKRMEDTIHGLDLKLKDKDLKIKSLQDKVKELETQLLVERKLARQHVDTKIAEQHLKQQQQEELKYCTIEATTWKSFAIKVISPIEKENNPEMTEQPRLPNRTGRASLCTAVRRIPLTSAPRRNSLIPLPSAPTSAPLTPALLPLPPCEVDEKEEIDECLTEQVIHCNSPKVIKSESKKLSSALRRSLQKKMQRKSPMQQHFRRGGVNVGMQQLRVSIGSRGRMAHRVLLGAGRRGGTKEIHQKQNQKEKERGWNIGTAGRII

cccccccccccccccHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEcccccccccccccccHHHHHHHcccEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEcccccccccccccccEEEEccccccEEEEEccccccEEEEcccccccccccHHHHHHHHHHHHHHHHcccccEEcccccccccccccccccccccccHHHHHHHHHHHHHcccccEEEEEEEEEEEEcccccccccccccccccccccEEEEcccccEEEcccEEEEcccHHHHHHHHHHHHccccHHccccccccccccEEEEEEEEccccccHHHHHHHHHccccccccHHHHHccccccccccEEEEEccccccccHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHccccccccccccccccHHHHccHHHHHHHHHHHccccccccccccccccccccEEEEccccccccccccccccccccccccccccccHHHHHcccccccccccc

cccccccccccccccccEcccccccccccccccccHcccccccccHHcccccccccccccccccccccccccccccEEEEEEcccccEEEEccccccccccccccHHHHHcccccEEEEHHccccccccEcccccccccccccHHHcccccccHHcccccccccccccccccEEccccccccHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEEcccHHHHccccEEEEEEccccccEEEEcccccccEEEEEcEcccccccHHHHHHHHHHHHHHHHccccEEEEEEccccccHHHHHcEccccccccHHHHHHHHHHHHHHcccEEEEEEEEEEEEEcHHHHHHccccccccccccEEEEEEcccccEEEcccccEEcccHHHHHHHHHHHHHHHHHHHHHccccHHHcEEEEEEEEEEEEccccEEEccccccccccccHHHHHHHHHHccccccEEEEEEEcccccccccHHHHHHHHHHHHHccccccHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHccHcccccccccccccccccccccHccccccccHcccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccccccccccccccHHHHHHHHHHccccHHHHHHHccccEEcccEEEEEccccccEEEEcccccccccccccccccccccccccccccccccEcc

meedqnhhhhqwadplllTDVSLQQRISHqynsqnqiaspprshfvamadsvfhhdpddgtswqndpisnelvdgksmlgfsltspdlvicggspeipkssygespefseRIQCSFEVSLengikgsddnngshknktpsvrfssfnkefspesslellppstmpeqdpvpvvsinedyrepmLLEAKRFsqleecestkdsgergvkgdyERLKMSYECQKKELTEAKRTLEELKRENQLKNKEYQETWKSLQELQNELMRKSMHVGSLAFAIEGQVKEKSRWFSSLRDLTRRLKIMKMEHINLFEEALAYKKCAAEISEASSTIQSKINHQVQLYEHLKIKFIEGTKERKELYNKVLELKGnirvfcrcrplnseetaagsvmavdfesvrdgeltvisngapkktfkfdavfgpqadqvdvfqdtapfansvldgYNVCIfaygqtgtgktftmegtkeargvnFRTLEELFRIIKEREKLYRYDISVSVLEVYNEQIRDLLAvgsqpgavsKRLEvrqagegmhhvpgLVEAHVNNISEVWEVLQTGsnvravgstnanehssrshcMHCVMVRRELVEWGMHKEQAmasgssrknskLTHLLQDslggdsktLMFVQispnendlsETLCSLNFASRVRGIELGAAKKQLDTSELLRYKQMVEKTKQELKSRDVQSKRMEDTIHGLDLKLKDKDLKIKSLQDKVKELETQLLVERKLARQHVDTKIAEQHLKQQQQEELKYCTIEATTWKSFAIKVIspiekennpemteqprlpnrtgraslctavrripltsaprrnsliplpsaptsapltpallplppcevdekeeIDECLTEqvihcnspkviKSESKKLSSALRRSLQKKMqrkspmqqhfrrggvnvgMQQLRVSIGSRGRMAHRVLLgagrrggtkeiHQKQNQKEkergwnigtagrii

meedqnhhhhqwadplLLTDVSLQQRISHQYNsqnqiasppRSHFVAMADSVFHHDPDDGTSWQNDPISNELVDGKSMLGFSLTSPDLVICGGSPEIPKSSYGESPEFSERIQCSFEVSLENGikgsddnngshknkTPSVRFSSFNKEFSPESSLELLPPSTMPEQDPVPVVSINEDYREPMLLEakrfsqleecestkdsgergvkgdyerlKMSYECQKKELTEAKRTleelkrenqlknkeYQETWKSLQELQNELMRKSMHVGSLAFAiegqvkeksrwfsSLRDLTRRLKIMKMEHINLFEEALAYKKCAAEISEASSTIQSKINHQVQLYEHLKIKFIEGTKERKELYNKVLELKGNIRVFCRCRPLNseetaagsvmavdfESVRDGELTvisngapkkTFKFDAVFGPQADQVDVFQDTAPFANSVLDGYNVCIFAYGQTgtgktftmegtkeargvnfrtlEELFRIIKEREKLYRYDISVSVLEVYNEQIRDLLavgsqpgavSKRLEVRQAGEGMHHVPGLVEAHVNNISEVWEVLQTGSNVRAVGStnanehssrshcmHCVMVRRELVEWGMHKEQAmasgssrknskLTHLLQDSLGGDSKTLMFVQISPNENDLSETLCSLNFASRVRGIELgaakkqldtselLRYKQMVEKTkqelksrdvqskrmedtihgldlklkdkdlKIKSLQDKVKELETQLLVERKLARQHVDTKIAEQHLKQQQQEELKYCTIEATTWKSFAIKVISpiekennpemteqprlpnrtgrasLCTAVrripltsaprrnsliplpsaptsapltPALLPLPPCEVDEKEEIDECLTEqvihcnspkviksesKKLSSALRRSLqkkmqrkspmqqhfrrggvnvgMQQLRVSIGSRGRMAHRVLlgagrrggtkeihqkqnqkekergwnigtagrii

MEEDQNHHHHQWADPLLLTDVSLQQRISHQYNSQNQIASPPRSHFVAMADSVFHHDPDDGTSWQNDPISNELVDGKSMLGFSLTSPDLVICGGSPEIPKSSYGESPEFSERIQCSFEVSLENGIKGSDDNNGSHKNKTPSVRFSSFNKefspesslellppsTMPEQDPVPVVSINEDYREPMLLEAKRFSQLEECESTKDSGERGVKGDYERLKMSYECQKKELTEAKRTLEELKRENQLKNKEYQETWKSLQELQNELMRKSMHVGSLAFAIEGQVKEKSRWFSSLRDLTRRLKIMKMEHINLFEEALAYKKCAAEISEASSTIQSKINHQVQLYEHLKIKFIEGTKERKELYNKVLELKGNIRVFCRCRPLNSEETAAGSVMAVDFESVRDGELTVISNGAPKKTFKFDAVFGPQADQVDVFQDTAPFANSVLDGYNVCIFAYGQTGTGKTFTMEGTKEARGVNFRTLEELFRIIKEREKLYRYDISVSVLEVYNEQIRDLLAVGSQPGAVSKRLEVRQAGEGMHHVPGLVEAHVNNISEVWEVLQTGSNVRAVGSTNANEHSSRSHCMHCVMVRRELVEWGMHKEQAMASGSSRKNSKLTHLLQDSLGGDSKTLMFVQISPNENDLSETLCSLNFASRVRGIELGAAKKQLDTSELLRYKQMVEKTKQELKSRDVQSKRMEDTIHGldlklkdkdlkikslqdkVKELETQLLVERKLARQHVDTKIAeqhlkqqqqeelkYCTIEATTWKSFAIKVISPIEKENNPEMTEQPRLPNRTGRASLCTAVRRIPLTSAPRRNSLIplpsaptsapltpallplppCEVDEKEEIDECLTEQVIHCNSPKVIkseskklssalrrslqkkMQRKSPMQQHFRRGGVNVGMQQLRVSIGSRGRMAHRVLLGAGRRGGTKEIHQKQNQKEKERGWNIGTAGRII

****************************************************************************SMLGFSLTSPDLVICG****************************************************************************************************************************************************************************MHVGSLAFAIEGQVKEKSRWFSSLRDLTRRLKIMKMEHINLFEEALAYKKCAAEISEASSTIQSKINHQVQLYEHLKIKFIEGTKERKELYNKVLELKGNIRVFCRCRPLNSEETAAGSVMAVDFESVRDGELTVISNGAPKKTFKFDAVFGPQADQVDVFQDTAPFANSVLDGYNVCIFAYGQTGTGKTFTMEGTKEARGVNFRTLEELFRIIKEREKLYRYDISVSVLEVYNEQIRDLLAVGSQPGAVSKRLEVRQAGEGMHHVPGLVEAHVNNISEVWEVLQTGSNVRAV************HCMHCVMVRRELVEWGM******************************TLMFVQIS****DLSETLCSLNFASRVRGIELGAA************************************************************LETQLLVERKLARQHVD**************ELKYCTIEATTWKSFAIKVISP************************CTAV*******************************************IDECLTEQVIHCN***********************************************V*I*******HRVLL*********************************

***********WADPLLLTD**************************************************************LTSP*************************************************************************************************************************************************************************************************************************************************SKINHQVQLYEHLKIKFIEGTKERKELYNKVLELKGNIRVFCRCRPLN************DFESVR***************FKFDAVFGPQADQVDVFQDTAPFANSVLDGYNVCIFAYGQTGTGKTFTMEGTKEARGVNFRTLEELFRIIKEREKLYRYDISVSVLEVYNEQIRDLLAVGS************QAGEGMHHVPGLVEAHVNNISEVWEVLQTGSNVRAVGSTNANEHSSRSHCMHCVMVRRELVE*******************LTHLLQDSLGGDSKTLMFVQISPNENDLSETLCSLNFASRVRGIE*************************************************************************************************************************************************************************************************************************************************************************************************GTAGR**

***********WADPLLLTDVSLQQRISHQYNSQNQIASPPRSHFVAMADSVFHHDPDDGTSWQNDPISNELVDGKSMLGFSLTSPDLVICGGSPEIP***********ERIQCSFEVSLENGIKGSDDNNGSHKNKTPSVRFSS************LLPPSTMPEQDPVPVVSINEDYREPMLLEAKRFSQL************GVKGDYERLKMSYECQKKELTEAKRTLEELKRENQLKNKEYQETWKSLQELQNELMRKSMHVGSLAFAIEGQVKEKSRWFSSLRDLTRRLKIMKMEHINLFEEALAYKKCAAEISEASSTIQSKINHQVQLYEHLKIKFIEGTKERKELYNKVLELKGNIRVFCRCRPLNSEETAAGSVMAVDFESVRDGELTVISNGAPKKTFKFDAVFGPQADQVDVFQDTAPFANSVLDGYNVCIFAYGQTGTGKTFTMEGTKEARGVNFRTLEELFRIIKEREKLYRYDISVSVLEVYNEQIRDLLAVGSQPGAVSKRLEVRQAGEGMHHVPGLVEAHVNNISEVWEVLQTGSNVRAVG***********HCMHCVMVRRELVEWGMHK*************KLTHLLQDSLGGDSKTLMFVQISPNENDLSETLCSLNFASRVRGIELGAAKKQLDTSELLRYKQMVEK**************MEDTIHGLDLKLKDKDLKIKSLQDKVKELETQLLVERKLARQHVDTKIAEQHLKQQQQEELKYCTIEATTWKSFAIKVISPIEKENNPEMTEQPRLPNRTGRASLCTAVRRIPLTSAPRRNSLIPLPSAPTSAPLTPALLPLPPCEVDEKEEIDECLTEQVIHCNSPKVI****************************FRRGGVNVGMQQLRVSIGSRGRMAHRVLLGAGR****************ERGWNIGTAGRII

*****NHHHHQWADPLLLTDV****************************************SWQNDPISNELVDGKSMLGFSLTSPDLVICGGSPEIPKSSYGESPEFSERIQCSFEVSLENGIKGSDD************RF*S*N***********************PVVSINEDYREPMLLEAKRFSQLEECESTKDS*ERGVKGDYERLKMSYECQKKELTEAKRTLEELKRENQLKNKEYQETWKSLQELQNELMRKSMHVGSLAFAIEGQVKEKSRWFSSLRDLTRRLKIMKMEHINLFEEALAYKKCAAEISEASSTIQSKINHQVQLYEHLKIKFIEGTKERKELYNKVLELKGNIRVFCRCRPLNSEETAAGSVMAVDFESVRDGELTVISNGAPKKTFKFDAVFGPQADQVDVFQDTAPFANSVLDGYNVCIFAYGQTGTGKTFTMEGTKEARGVNFRTLEELFRIIKEREKLYRYDISVSVLEVYNEQIRDLLAVGSQPGAVSKRLEVRQAGEGMHHVPGLVEAHVNNISEVWEVLQTGSNVRAVGSTNANEHSSRSHCMHCVMVRRELVEWGMHKEQAMASGSSRKNSKLTHLLQDSLGGDSKTLMFVQISPNENDLSETLCSLNFASRVRGIELGAAKKQLDTSELLRYKQMVEKTKQELKSRDVQSKRMEDTIHGLDLKLKDKDLKIKSLQDKVKELETQLLVERKLAR********************************************************************RR***************************L*P*********E************************KLSSALRRSLQKKMQRKSPMQQHFRRGGVNVGMQQLRVSIGSRGRMAHRVLLGA*******************************

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MEEDQNHHHHQWADPLLLTDVSLQQRISHQYNSQNQIASPPRSHFVAMADSVFHHDPDDGTSWQNDPISNELVDGKSMLGFSLTSPDLVICGGSPEIPKSSYGESPEFSERIQCSFEVSLENGIKGSDDNNGSHKNKTPSVRFSSFNKEFSPESSLELLPPSTMPEQDPVPVVSINEDYREPMLLEAKRFSQLEECESTKDSGERGVKGDxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxWKSLQELQNELMRKSMHVGSLAFAIEGQVKEKSRWFSSLRDLTRRLKIMKMEHINLFEEALAYKKCAAEISEASSTIQSKINHQVQLYEHLKIKFIEGTKERKELYNKVLELKGNIRVFCRCRPLNSEETAAGSVMAVDFESVRDGELTVISNGAPKKTFKFDAVFGPQADQVDVFQDTAPFANSVLDGYNVCIFAYGQTGTGKTFTMEGTKEARGVNFRTLEELFRIIKEREKLYRYDISVSVLEVYNEQIRDLLAVGSQPGAVSKRLEVRQAGEGMHHVPGLVEAHVNNISEVWEVLQTGSNVRAVGSTNANEHSSRSHCMHCVMVRRELVEWGMHKEQAMASGSSRKNSKLTHLLQDSLGGDSKTLMFVQISPNENDLSETLCSLNFASRVRGIELGAAKKQLDTSELLRYKQMVEKTKQELKSRDVQSKRMEDTIHGLDLKxxxxxxxxxxxxxxxxxxxxxxxxxxxxARQHVDTKIAEQHLKQQQQEELKYCTIEATTWKSFAIKVISPIEKENNPEMTEQPRLPNRTGRASLCTAVRRIPLTSAPRRNSLIPLPSAPTSAPLTPALLPLPPCEVDEKEEIDECLTEQVIHCNSPKVIKSESKKLSSALRRSLQKKMQRKSPMQQHFRRGGVNVGMQQLRVSIGSRGRMAHRVLLGAGRRGGTKEIHQKQNQKEKERGWNIGTAGRII

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		943	2.2.26 [Sep-21-2011]
O81635		987	Kinesin-4 OS=Arabidopsis	no	no	0.337	0.322	0.416	3e-65
O35231		824	Kinesin-like protein KIFC	yes	no	0.357	0.408	0.393	2e-64
Q9BVG8		833	Kinesin-like protein KIFC	no	no	0.349	0.396	0.400	3e-64
P46875		754	Kinesin-3 OS=Arabidopsis	no	no	0.342	0.428	0.373	2e-56
P46864		745	Kinesin-2 OS=Arabidopsis	no	no	0.340	0.430	0.378	5e-56
F4JGP4		790	Kinesin-5 OS=Arabidopsis	no	no	0.376	0.449	0.354	8e-55
Q07970		793	Kinesin-1 OS=Arabidopsis	no	no	0.378	0.450	0.344	9e-54
Q4R628		702	Kinesin-like protein KIF3	N/A	no	0.323	0.434	0.365	6e-53
Q5R4H3		702	Kinesin-like protein KIF3	no	no	0.323	0.434	0.365	7e-53
Q9Y496		699	Kinesin-like protein KIF3	no	no	0.323	0.436	0.365	9e-53

>sp\|O81635\|ATK4_ARATH Kinesin-4 OS=Arabidopsis thaliana GN=ATK4 PE=1 SV=2	Back alignment and function desciption

 Score =  250 bits (639), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 158/379 (41%), Positives = 210/379 (55%), Gaps = 61/379 (16%)

Query: 349 KERKELYNKVLELKGNIRVFCRCRP-LNSEETAAGSVMAVDFESVRDGELTV----ISNG 403
           +E ++LYN V +LKGNIRV+CR RP L  +E+  G + AV  E + +G +T+        
Sbjct: 379 EENRKLYNLVQDLKGNIRVYCRVRPFLPGQES--GGLSAV--EDIDEGTITIRVPSKYGK 434

Query: 404 APKKTFKFDAVFGPQADQVDVFQDTAPFANSVLDGYNVCIFAYGQTGTGKTFTMEG---- 459
           A +K F F+ VFGP A Q +VF D  P   SVLDGYNVCIFAYGQTG+GKTFTM G    
Sbjct: 435 AGQKPFMFNKVFGPSATQEEVFSDMQPLVRSVLDGYNVCIFAYGQTGSGKTFTMTGPKEL 494

Query: 460 TKEARGVNFRTLEELFRIIKEREKLYRYDISVSVLEVYNEQIRDLLAVGSQPGAVSKRLE 519
           T+E+ GVN+R L +LF +  +R+    Y+ISV +LE+YNEQ+RDLLA   Q    +KRLE
Sbjct: 495 TEESLGVNYRALADLFLLSNQRKDTTSYEISVQMLEIYNEQVRDLLAQDGQ----TKRLE 550

Query: 520 VRQAGEGMHHVPGLVEAHVNNISEVWEVLQTGSNVRAVGSTNANEHSSRSHCMHCVMVR- 578
           +R       +VP      V++  +V +++  G   RAV ST  N+ SSRSH    V V+ 
Sbjct: 551 IRNNSHNGINVPEASLVPVSSTDDVIQLMDLGHMNRAVSSTAMNDRSSRSHSCVTVHVQG 610

Query: 579 RELVEWG-MHKEQAMA--SGSSR------------------------------------- 598
           R+L     +H    +   +GS R                                     
Sbjct: 611 RDLTSGSILHGSMHLVDLAGSERVDKSEVTGDRLKEAQHINKSLSALGDVISSLSQKTSH 670

Query: 599 ---KNSKLTHLLQDSLGGDSKTLMFVQISPNENDLSETLCSLNFASRVRGIELGAAKKQL 655
              +NSKLT LLQDSLGG +KTLMFV ISP  + L ET+ +L FA RV  +ELGAA+   
Sbjct: 671 VPYRNSKLTQLLQDSLGGSAKTLMFVHISPEPDTLGETISTLKFAERVGSVELGAARVNK 730

Query: 656 DTSELLRYKQMVEKTKQEL 674
           D SE+   K+ +   K  L
Sbjct: 731 DNSEVKELKEQIANLKMAL 749

Microtubule-binding motor protein.
Arabidopsis thaliana (taxid: 3702)

>sp\|O35231\|KIFC3_MOUSE Kinesin-like protein KIFC3 OS=Mus musculus GN=Kifc3 PE=1 SV=4	Back alignment and function description

>sp\|Q9BVG8\|KIFC3_HUMAN Kinesin-like protein KIFC3 OS=Homo sapiens GN=KIFC3 PE=1 SV=4	Back alignment and function description

>sp\|P46875\|ATK3_ARATH Kinesin-3 OS=Arabidopsis thaliana GN=ATK3 PE=2 SV=1	Back alignment and function description

>sp\|P46864\|ATK2_ARATH Kinesin-2 OS=Arabidopsis thaliana GN=ATK2 PE=2 SV=1	Back alignment and function description

>sp\|F4JGP4\|ATK5_ARATH Kinesin-5 OS=Arabidopsis thaliana GN=ATK5 PE=2 SV=1	Back alignment and function description

>sp\|Q07970\|ATK1_ARATH Kinesin-1 OS=Arabidopsis thaliana GN=ATK1 PE=2 SV=1	Back alignment and function description

>sp\|Q4R628\|KIF3A_MACFA Kinesin-like protein KIF3A OS=Macaca fascicularis GN=KIF3A PE=2 SV=1	Back alignment and function description

>sp\|Q5R4H3\|KIF3A_PONAB Kinesin-like protein KIF3A OS=Pongo abelii GN=KIF3A PE=2 SV=1	Back alignment and function description

>sp\|Q9Y496\|KIF3A_HUMAN Kinesin-like protein KIF3A OS=Homo sapiens GN=KIF3A PE=1 SV=4	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		943
356528722		1046	PREDICTED: uncharacterized protein LOC10	0.965	0.869	0.571	0.0
356555152		996	PREDICTED: uncharacterized protein LOC10	0.908	0.860	0.583	0.0
224117538		1129	predicted protein [Populus trichocarpa]	0.808	0.674	0.617	0.0
359494589		1070	PREDICTED: uncharacterized protein LOC10	0.974	0.858	0.558	0.0
255584178		1147	ATP binding protein, putative [Ricinus c	0.776	0.638	0.609	0.0
449460090		1112	PREDICTED: uncharacterized protein LOC10	0.772	0.654	0.611	0.0
449502183		1095	PREDICTED: uncharacterized protein LOC10	0.772	0.664	0.611	0.0
224061435		1083	predicted protein [Populus trichocarpa]	0.767	0.668	0.584	0.0
296082815		868	unnamed protein product [Vitis vinifera]	0.761	0.827	0.616	0.0
357451443		962	Kinesin-4 [Medicago truncatula] gi\|35548	0.738	0.723	0.577	0.0

>gi\|356528722\|ref\|XP_003532948.1\| PREDICTED: uncharacterized protein LOC100817247 [Glycine max]	Back alignment and taxonomy information

 Score = 1089 bits (2817), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 605/1058 (57%), Positives = 737/1058 (69%), Gaps = 148/1058 (13%)

Query: 9    HHQWA----DPLLLTDVSLQQRIS---HQYNSQNQIASPPRSHFVAMADS-VFHHD-PDD 59
            ++QW     DPLLLTDVSLQQ  S   H  NS +Q +   RS  +AMAD  V   D P  
Sbjct: 4    NNQWCLYDHDPLLLTDVSLQQESSSYTHSPNSLSQASLSSRS--LAMADEPVSRGDSPSI 61

Query: 60   GTSWQN-----------DPISNELVDGKSMLGFSLTSPDLVICGGSPEIPKSSYGESPEF 108
            G S +N           DP    + DG+S+LG+SLTSPDLVIC GSP+I   SYG+SPE 
Sbjct: 62   GFSQENGRFEGNSVKFDDPNVKNVFDGRSILGYSLTSPDLVIC-GSPDIAGISYGDSPEL 120

Query: 109  SER-----IQCSFEVSLENGIKGS--DDNNGSHKNKTPSVRFSSFNKEF-------SPES 154
            S+      ++ S E+SLENGIKGS  + +NG   +K P+V+FS+F + F       SPE+
Sbjct: 121  SKNKHSKDVEQSMELSLENGIKGSQVEVDNG---HKIPTVKFSNFCQTFEQEEKPLSPEA 177

Query: 155  SLELLPPSTMPEQDPVPVVSINEDY--REPMLLEAKRFSQLEECESTKDSGERGVKGDYE 212
            S ELLPP     + P       +D+  R+  +LE    SQ  E ES++D+ + G++  ++
Sbjct: 178  SFELLPPLVTRNESP-------QDHPPRDTEMLEDIGVSQEAEMESSEDTEDIGMEEKFK 230

Query: 213  RLKMSYECQKKELTEAKRTLEELKRENQLKNKEYQETWKSLQELQNELMRKSMHVGSLAF 272
            RLK  ++CQ+KELTE +R L E+KRENQ K++E QE W SL+ELQNELMRKSMHVGSLAF
Sbjct: 231  RLKREFDCQRKELTETRRELGEIKRENQQKSRECQEAWNSLKELQNELMRKSMHVGSLAF 290

Query: 273  AIEGQVKEKSRWFSSLRDLTRRLKIMKMEHINLFEEALAYKKCAAEISEASSTIQSKINH 332
            AIEGQVKEKS+WFSSLRDLTR+LKIMKMEHI L EEA A KK  A++ E    I+SKIN 
Sbjct: 291  AIEGQVKEKSKWFSSLRDLTRKLKIMKMEHIKLLEEAEASKKYQADMREMGLIIKSKINE 350

Query: 333  QVQLYEHLKIKFIEGTKERKELYNKVLELKGNIRVFCRCRPLNSEETAAGSVMAVDFESV 392
            Q++ +E LK K+IEG KERK+LYNKVLEL GNIRVFCRCRPLN+EE +AG+ MA+DFE  
Sbjct: 351  QLESHEDLKSKYIEGAKERKDLYNKVLELTGNIRVFCRCRPLNAEEISAGATMALDFEFA 410

Query: 393  RDGELTVISNGAPKKTFKFDAVFGPQADQVDVFQDTAPFANSVLDGYNVCIFAYGQTGTG 452
            +DG+LTV+SNGAPK+ FKFDAVFGPQA+Q D+F+DTAPFA SVLDGYNVCIFAYGQTGTG
Sbjct: 411  KDGDLTVMSNGAPKRNFKFDAVFGPQAEQADIFEDTAPFATSVLDGYNVCIFAYGQTGTG 470

Query: 453  KTFTMEGTKEARGVNFRTLEELFRIIKEREKLYRYDISVSVLEVYNEQIRDLLAVGSQPG 512
            KTFTMEGT+EARGVNFRTLE++F IIKER+KLY YDISVSVLEVYNEQIRDLL  G+ PG
Sbjct: 471  KTFTMEGTEEARGVNFRTLEKMFDIIKERQKLYCYDISVSVLEVYNEQIRDLLVAGNHPG 530

Query: 513  AVSKRLEVRQAGEGMHHVPGLVEAHVNNISEVWEVLQTGSNVRAVGSTNANEHSSRSHCM 572
              +KRLE+RQAGEGMHH+PGLVEAHVNN++EVWEVLQTGSN RAV STNANEHSSRSHC+
Sbjct: 531  TAAKRLEIRQAGEGMHHIPGLVEAHVNNMTEVWEVLQTGSNARAVSSTNANEHSSRSHCI 590

Query: 573  HCVMVRRE-------------LVEWG---------MHKEQ-------------------A 591
            HCVMV+ E             LV+           +H ++                   A
Sbjct: 591  HCVMVKGENLLNGECTRSKLWLVDLAGSERVAKTEVHGDRLKETQNINRSLSALGDVISA 650

Query: 592  MASGSSR---KNSKLTHLLQDSLGGDSKTLMFVQISPNENDLSETLCSLNFASRVRGIEL 648
            +A+ SS    +NSKLTHLLQDSLGGDSK LMFVQISPNENDLSET+CSLNFASRVRGIEL
Sbjct: 651  LATKSSHIPFRNSKLTHLLQDSLGGDSKALMFVQISPNENDLSETICSLNFASRVRGIEL 710

Query: 649  GAAKKQLDTSELLRYKQMVEKTKQELKSRDVQSKRMEDTIHGLDLKLKDKDLKIKSLQDK 708
            G A+KQLDT ELLR+KQM EK KQE++ +D+Q K+ME+TIHGL+ K+K+ D K K+LQ+K
Sbjct: 711  GPARKQLDTVELLRHKQMAEKVKQEVRLKDLQIKKMEETIHGLESKMKESDNKNKNLQEK 770

Query: 709  VKELETQLLVERKLARQHVDTKIAEQHLKQQQQEE------------------------- 743
            VKELE+QLLVERKLARQHVD+KIAEQH  + Q+E+                         
Sbjct: 771  VKELESQLLVERKLARQHVDSKIAEQHQMKHQEEQNNTLMRPALASRPLGSLKNFNDPVS 830

Query: 744  ---------------------LKYCTIEATTWKSFAIKVISPIEKENNPEMTEQPRLPNR 782
                                 LK C I  +T +S +IK I   EKENNP+M ++  LP R
Sbjct: 831  GGGWCKDQQINSAKPLAENNILKPC-IPFSTMES-SIKCIDHAEKENNPDMADKALLPKR 888

Query: 783  TGRAS-LCTAVRRIPLTSAPRRNSLIPLPSAPTSAPLTPALLPLPPCEVDEKEEIDE--- 838
             GRAS +C    R+P   A RRNSLIPLPS P+       LLP    + D+K+   E   
Sbjct: 889  PGRASTICMMTPRVPSAIASRRNSLIPLPSIPSLTQFQSPLLPKLTNQADQKDVNGELET 948

Query: 839  -CLTEQVIHCNSPKVIKSESKKLSSALRRSLQKKMQRKSPMQQHFRRGGVNVGMQQLRVS 897
             C+  Q  HC SPK ++   K++ S LRRSL KK+Q KSP+QQH R+ GVNVGM+++RVS
Sbjct: 949  NCVPAQT-HCESPKEVRIGVKRIGSILRRSLHKKIQMKSPLQQHMRKVGVNVGMEKVRVS 1007

Query: 898  IGSRGRMAHRVLLGAGRR-GGTKEIHQKQNQKEKERGW 934
            IGSRGR+A R  +G+GRR GG K+I QK +QKEKERGW
Sbjct: 1008 IGSRGRLAPRGQVGSGRRGGGAKDIQQKNSQKEKERGW 1045

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|356555152\|ref\|XP_003545900.1\| PREDICTED: uncharacterized protein LOC100779622 [Glycine max]	Back alignment and taxonomy information

>gi\|224117538\|ref\|XP_002317602.1\| predicted protein [Populus trichocarpa] gi\|222860667\|gb\|EEE98214.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|359494589\|ref\|XP_002270779.2\| PREDICTED: uncharacterized protein LOC100261047 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|255584178\|ref\|XP_002532828.1\| ATP binding protein, putative [Ricinus communis] gi\|223527419\|gb\|EEF29558.1\| ATP binding protein, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|449460090\|ref\|XP_004147779.1\| PREDICTED: uncharacterized protein LOC101222343 [Cucumis sativus]	Back alignment and taxonomy information

>gi\|449502183\|ref\|XP_004161567.1\| PREDICTED: uncharacterized protein LOC101226666 [Cucumis sativus]	Back alignment and taxonomy information

>gi\|224061435\|ref\|XP_002300478.1\| predicted protein [Populus trichocarpa] gi\|222847736\|gb\|EEE85283.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|296082815\|emb\|CBI21820.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|357451443\|ref\|XP_003595998.1\| Kinesin-4 [Medicago truncatula] gi\|355485046\|gb\|AES66249.1\| Kinesin-4 [Medicago truncatula]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		943
TAIR\|locus:2061992		983	AT2G47500 [Arabidopsis thalian	0.241	0.231	0.445	8.1e-63
UNIPROTKB\|F5H3M2		724	KIFC3 "Kinesin-like protein KI	0.364	0.475	0.359	2.3e-62
UNIPROTKB\|F1P0D6		371	KIFC3 "Uncharacterized protein	0.236	0.601	0.443	8.8e-62
UNIPROTKB\|F5H4I9		768	KIFC3 "Kinesin-like protein KI	0.364	0.447	0.359	1.6e-61
TAIR\|locus:2148543		987	ATK4 "kinesin 4" [Arabidopsis	0.262	0.251	0.444	1.8e-61
UNIPROTKB\|F1P110		399	KIFC3 "Uncharacterized protein	0.231	0.546	0.449	2.5e-61
UNIPROTKB\|E2QS65		764	KIFC3 "Uncharacterized protein	0.364	0.450	0.354	2.8e-61
UNIPROTKB\|Q9BVG8		833	KIFC3 "Kinesin-like protein KI	0.364	0.412	0.359	5.8e-61
UNIPROTKB\|B7Z484		848	KIFC3 "cDNA FLJ56036, highly s	0.364	0.405	0.359	7.1e-61
UNIPROTKB\|F6UN94		842	KIFC3 "Uncharacterized protein	0.364	0.408	0.354	1.2e-60

TAIR\|locus:2061992 AT2G47500 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 497 (180.0 bits), Expect = 8.1e-63, Sum P(3) = 8.1e-63
 Identities = 106/238 (44%), Positives = 154/238 (64%)

Query:   349 KERKELYNKVLELKGNIRVFCRCRPLNSEETAAGSVMAVDFESVRDGELTVISNGAPKKT 408
             +E ++LYN+V +LKG+IRV+CR RP    +++  S +  + E    G  T   +G   K+
Sbjct:   384 EENRKLYNQVQDLKGSIRVYCRVRPFLPGQSSFSSTIG-NMEDDTIGINTASRHGKSLKS 442

Query:   409 FKFDAVFGPQADQVDVFQDTAPFANSVLDGYNVCIFAYGQTGTGKTFTMEG----TKEAR 464
             F F+ VFGP A Q +VF D  P   SVLDGYNVCIFAYGQTG+GKTFTM G    T++++
Sbjct:   443 FTFNKVFGPSATQEEVFSDMQPLIRSVLDGYNVCIFAYGQTGSGKTFTMSGPRDLTEKSQ 502

Query:   465 GVNFRTLEELFRIIKEREKLYRYDISVSVLEVYNEQIRDLLAVGSQPGAVSKRLEVRQAG 524
             GVN+R L +LF + ++R+  +RYDI+V ++E+YNEQ+RDLL         +KRLE+R + 
Sbjct:   503 GVNYRALGDLFLLAEQRKDTFRYDIAVQMIEIYNEQVRDLLVTDGS----NKRLEIRNSS 558

Query:   525 EGMHHVPGLVEAHVNNISEVWEVLQTGSNVRAVGSTNANEHSSRSH-CMHCVMVRREL 581
             +    VP      V++  +V ++++TG   RAVGST  N+ SSRSH C+   +  R+L
Sbjct:   559 QKGLSVPDASLVPVSSTFDVIDLMKTGHKNRAVGSTALNDRSSRSHSCLTVHVQGRDL 616

GO:0003777 "microtubule motor activity" evidence=IEA;ISS

GO:0005524 "ATP binding" evidence=IEA

GO:0005737 "cytoplasm" evidence=ISM

GO:0007018 "microtubule-based movement" evidence=IEA

UNIPROTKB\|F5H3M2 KIFC3 "Kinesin-like protein KIFC3" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|F1P0D6 KIFC3 "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

UNIPROTKB\|F5H4I9 KIFC3 "Kinesin-like protein KIFC3" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

TAIR\|locus:2148543 ATK4 "kinesin 4" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

UNIPROTKB\|F1P110 KIFC3 "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

UNIPROTKB\|E2QS65 KIFC3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|Q9BVG8 KIFC3 "Kinesin-like protein KIFC3" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|B7Z484 KIFC3 "cDNA FLJ56036, highly similar to Homo sapiens kinesin family member C3 (KIFC3), mRNA" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|F6UN94 KIFC3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		943
cd01366		329	cd01366, KISc_C_terminal, Kinesin motor domain, KI	1e-127
pfam00225		326	pfam00225, Kinesin, Kinesin motor domain	1e-100
smart00129		335	smart00129, KISc, Kinesin motor, catalytic domain	4e-96
cd00106		328	cd00106, KISc, Kinesin motor domain	4e-85
cd01371		333	cd01371, KISc_KIF3, Kinesin motor domain, kinesins	2e-69
cd01369		325	cd01369, KISc_KHC_KIF5, Kinesin motor domain, kine	2e-62
cd01364		352	cd01364, KISc_BimC_Eg5, Kinesin motor domain, BimC	3e-61
cd01370		338	cd01370, KISc_KIP3_like, Kinesin motor domain, KIP	5e-60
cd01372		341	cd01372, KISc_KIF4, Kinesin motor domain, KIF4-lik	3e-59
cd01365		356	cd01365, KISc_KIF1A_KIF1B, Kinesin motor domain, K	1e-53
cd01373		337	cd01373, KISc_KLP2_like, Kinesin motor domain, KLP	3e-50
cd01374		321	cd01374, KISc_CENP_E, Kinesin motor domain, CENP-E	3e-50
cd01375		334	cd01375, KISc_KIF9_like, Kinesin motor domain, KIF	1e-46
cd01376		319	cd01376, KISc_KID_like, Kinesin motor domain, KIF2	1e-45
cd01368		345	cd01368, KISc_KIF23_like, Kinesin motor domain, KI	1e-40
cd01367		322	cd01367, KISc_KIF2_like, Kinesin motor domain, KIF	2e-39
COG5059		568	COG5059, KIP1, Kinesin-like protein [Cytoskeleton]	8e-36
PLN03188		1320	PLN03188, PLN03188, kinesin-12 family protein; Pro	2e-31
cd01363		186	cd01363, Motor_domain, Myosin and Kinesin motor do	2e-23
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	0.003

>gnl\|CDD\|238662 cd01366, KISc_C_terminal, Kinesin motor domain, KIFC2/KIFC3/ncd-like carboxy-terminal kinesins	Back alignment and domain information

 Score =  386 bits (993), Expect = e-127
 Identities = 150/333 (45%), Positives = 192/333 (57%), Gaps = 49/333 (14%)

Query: 362 KGNIRVFCRCRPLNSEETAAGSVMAVDFESVRDGELTVISNGAPKKTFKFDAVFGPQADQ 421
           KGNIRVFCR RPL   E+   S   + F     G + +      KK+F FD VF P A Q
Sbjct: 1   KGNIRVFCRVRPLLPSESTEYS-SVISFPDEDGGTIELSKGTGKKKSFSFDRVFDPDASQ 59

Query: 422 VDVFQDTAPFANSVLDGYNVCIFAYGQTGTGKTFTMEGTKEARGVNFRTLEELFRIIKER 481
            DVF++ +P   S LDGYNVCIFAYGQTG+GKT+TMEG  E  G+  R LE+LF   +E 
Sbjct: 60  EDVFEEVSPLVQSALDGYNVCIFAYGQTGSGKTYTMEGPPENPGIIPRALEQLFNTAEEL 119

Query: 482 EKL-YRYDISVSVLEVYNEQIRDLLAVGSQPGAVSKRLEVRQAGEGMHHVPGLVEAHVNN 540
           ++  + Y I+ S+LE+YNE IRDLLA    P    K+LE++   +G  +V  L E  V++
Sbjct: 120 KEKGWSYTITASMLEIYNETIRDLLATKPAPK---KKLEIKHDSKGETYVTNLTEVPVSS 176

Query: 541 ISEVWEVLQTGSNVRAVGSTNANEHSSRSHCMHCVMVRRELVEWGMH------------- 587
             EV  +L  GS  R+V STN NEHSSRSH +  + +R   ++ G               
Sbjct: 177 PEEVTRLLNLGSKNRSVASTNMNEHSSRSHAVFQLKIRGTNLQTGEQTRGKLNLVDLAGS 236

Query: 588 -------------KE-QA-----------MASGSSRK------NSKLTHLLQDSLGGDSK 616
                        KE QA           +++  S+       NSKLT+LLQDSLGG+SK
Sbjct: 237 ERLKKSGATGDRLKEAQAINKSLSALGDVISALRSKDSHVPYRNSKLTYLLQDSLGGNSK 296

Query: 617 TLMFVQISPNENDLSETLCSLNFASRVRGIELG 649
           TLMFV ISP E++LSETLCSL FASRVR +ELG
Sbjct: 297 TLMFVNISPLESNLSETLCSLRFASRVRSVELG 329

Ncd is a spindle motor protein necessary for chromosome segregation in meiosis. KIFC2/KIFC3-like kinesins have been implicated in motility of the Golgi apparatus as well as dentritic and axonal transport in neurons. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In this subgroup the motor domain is found at the C-terminus (C-type). C-type kinesins are (-) end-directed motors, i.e. they transport cargo towards the (-) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain, which repositions the other head domain through the coiled-coil domain close to a second tubulin dimer, about 80 Angstroms along the microtubule. Meanwhile, ATP hydrolysis takes place, and when the second head domain binds to the microtubule, the first domain again replaces ADP with ATP, triggering a conformational change that pulls the first domain forward. Length = 329

>gnl\|CDD\|215803 pfam00225, Kinesin, Kinesin motor domain	Back alignment and domain information

>gnl\|CDD\|214526 smart00129, KISc, Kinesin motor, catalytic domain	Back alignment and domain information

>gnl\|CDD\|238054 cd00106, KISc, Kinesin motor domain	Back alignment and domain information

>gnl\|CDD\|238667 cd01371, KISc_KIF3, Kinesin motor domain, kinesins II or KIF3_like proteins	Back alignment and domain information

>gnl\|CDD\|238665 cd01369, KISc_KHC_KIF5, Kinesin motor domain, kinesin heavy chain (KHC) or KIF5-like subgroup	Back alignment and domain information

>gnl\|CDD\|238660 cd01364, KISc_BimC_Eg5, Kinesin motor domain, BimC/Eg5 spindle pole proteins, participate in spindle assembly and chromosome segregation during cell division	Back alignment and domain information

>gnl\|CDD\|238666 cd01370, KISc_KIP3_like, Kinesin motor domain, KIP3-like subgroup	Back alignment and domain information

>gnl\|CDD\|238668 cd01372, KISc_KIF4, Kinesin motor domain, KIF4-like subfamily	Back alignment and domain information

>gnl\|CDD\|238661 cd01365, KISc_KIF1A_KIF1B, Kinesin motor domain, KIF1_like proteins	Back alignment and domain information

>gnl\|CDD\|238669 cd01373, KISc_KLP2_like, Kinesin motor domain, KLP2-like subgroup	Back alignment and domain information

>gnl\|CDD\|238670 cd01374, KISc_CENP_E, Kinesin motor domain, CENP-E/KIP2-like subgroup, involved in chromosome movement and/or spindle elongation during mitosis	Back alignment and domain information

>gnl\|CDD\|238671 cd01375, KISc_KIF9_like, Kinesin motor domain, KIF9-like subgroup; might play a role in cell shape remodeling	Back alignment and domain information

>gnl\|CDD\|238672 cd01376, KISc_KID_like, Kinesin motor domain, KIF22/Kid-like subgroup	Back alignment and domain information

>gnl\|CDD\|238664 cd01368, KISc_KIF23_like, Kinesin motor domain, KIF23-like subgroup	Back alignment and domain information

>gnl\|CDD\|238663 cd01367, KISc_KIF2_like, Kinesin motor domain, KIF2-like group	Back alignment and domain information

>gnl\|CDD\|227392 COG5059, KIP1, Kinesin-like protein [Cytoskeleton]	Back alignment and domain information

>gnl\|CDD\|215621 PLN03188, PLN03188, kinesin-12 family protein; Provisional	Back alignment and domain information

>gnl\|CDD\|238659 cd01363, Motor_domain, Myosin and Kinesin motor domain	Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		943
KOG0239		670	consensus Kinesin (KAR3 subfamily) [Cytoskeleton]	100.0
KOG0243		1041	consensus Kinesin-like protein [Cytoskeleton]	100.0
KOG0245		1221	consensus Kinesin-like protein [Cytoskeleton]	100.0
KOG4280		574	consensus Kinesin-like protein [Cytoskeleton]	100.0
PLN03188		1320	kinesin-12 family protein; Provisional	100.0
KOG0240		607	consensus Kinesin (SMY1 subfamily) [Cytoskeleton]	100.0
cd01370		338	KISc_KIP3_like Kinesin motor domain, KIP3-like sub	100.0
cd01373		337	KISc_KLP2_like Kinesin motor domain, KLP2-like sub	100.0
KOG0242		675	consensus Kinesin-like protein [Cytoskeleton]	100.0
KOG0241		1714	consensus Kinesin-like protein [Cytoskeleton]	100.0
cd01368		345	KISc_KIF23_like Kinesin motor domain, KIF23-like s	100.0
cd01365		356	KISc_KIF1A_KIF1B Kinesin motor domain, KIF1_like p	100.0
cd01367		322	KISc_KIF2_like Kinesin motor domain, KIF2-like gro	100.0
cd01364		352	KISc_BimC_Eg5 Kinesin motor domain, BimC/Eg5 spind	100.0
cd01366		329	KISc_C_terminal Kinesin motor domain, KIFC2/KIFC3/	100.0
cd01371		333	KISc_KIF3 Kinesin motor domain, kinesins II or KIF	100.0
cd01376		319	KISc_KID_like Kinesin motor domain, KIF22/Kid-like	100.0
cd01369		325	KISc_KHC_KIF5 Kinesin motor domain, kinesin heavy	100.0
cd01372		341	KISc_KIF4 Kinesin motor domain, KIF4-like subfamil	100.0
cd01374		321	KISc_CENP_E Kinesin motor domain, CENP-E/KIP2-like	100.0
cd01375		334	KISc_KIF9_like Kinesin motor domain, KIF9-like sub	100.0
smart00129		335	KISc Kinesin motor, catalytic domain. ATPase. Micr	100.0
cd00106		328	KISc Kinesin motor domain. This catalytic (head) d	100.0
PF00225		335	Kinesin: Kinesin motor domain; InterPro: IPR001752	100.0
KOG0247		809	consensus Kinesin-like protein [Cytoskeleton]	100.0
KOG0246		676	consensus Kinesin-like protein [Cytoskeleton]	100.0
KOG0244		913	consensus Kinesin-like protein [Cytoskeleton]	100.0
COG5059		568	KIP1 Kinesin-like protein [Cytoskeleton]	100.0
cd01363		186	Motor_domain Myosin and Kinesin motor domain. Thes	100.0
COG5059		568	KIP1 Kinesin-like protein [Cytoskeleton]	98.12
KOG0250		1074	consensus DNA repair protein RAD18 (SMC family pro	97.49
TIGR02169		1164	SMC_prok_A chromosome segregation protein SMC, pri	96.68
TIGR02169		1164	SMC_prok_A chromosome segregation protein SMC, pri	96.65
PRK11637		428	AmiB activator; Provisional	96.54
TIGR02168		1179	SMC_prok_B chromosome segregation protein SMC, com	96.46
TIGR02168		1179	SMC_prok_B chromosome segregation protein SMC, com	96.3
KOG0982		502	consensus Centrosomal protein Nuf [Cell cycle cont	96.25
PRK11637		428	AmiB activator; Provisional	96.2
PF07888		546	CALCOCO1: Calcium binding and coiled-coil domain (	96.17
PF10481		307	CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0	96.16
PF07926		132	TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro:	96.16
PF04849		306	HAP1_N: HAP1 N-terminal conserved region; InterPro	96.11
PF14662		193	CCDC155: Coiled-coil region of CCDC155	95.98
KOG1029		1118	consensus Endocytic adaptor protein intersectin [S	95.97
KOG0996		1293	consensus Structural maintenance of chromosome pro	95.94
PF08317		325	Spc7: Spc7 kinetochore protein; InterPro: IPR01325	95.92
PF07888		546	CALCOCO1: Calcium binding and coiled-coil domain (	95.87
PF04849		306	HAP1_N: HAP1 N-terminal conserved region; InterPro	95.65
PRK09039		343	hypothetical protein; Validated	95.64
KOG0161		1930	consensus Myosin class II heavy chain [Cytoskeleto	95.61
PF09726		697	Macoilin: Transmembrane protein; InterPro: IPR0191	95.58
COG1196		1163	Smc Chromosome segregation ATPases [Cell division	95.53
PRK09039		343	hypothetical protein; Validated	95.3
KOG4360		596	consensus Uncharacterized coiled coil protein [Fun	95.28
PF05667		594	DUF812: Protein of unknown function (DUF812); Inte	95.25
PRK02224		880	chromosome segregation protein; Provisional	95.22
KOG0933		1174	consensus Structural maintenance of chromosome pro	95.21
PHA02562		562	46 endonuclease subunit; Provisional	95.17
KOG0250		1074	consensus DNA repair protein RAD18 (SMC family pro	95.15
PRK03918		880	chromosome segregation protein; Provisional	95.07
KOG0971		1243	consensus Microtubule-associated protein dynactin	94.98
smart00787		312	Spc7 Spc7 kinetochore protein. This domain is foun	94.97
PRK02224		880	chromosome segregation protein; Provisional	94.96
COG1196		1163	Smc Chromosome segregation ATPases [Cell division	94.9
PF14662		193	CCDC155: Coiled-coil region of CCDC155	94.77
KOG4643		1195	consensus Uncharacterized coiled-coil protein [Fun	94.37
KOG0980		980	consensus Actin-binding protein SLA2/Huntingtin-in	94.34
PF10473		140	CENP-F_leu_zip: Leucine-rich repeats of kinetochor	94.33
PF06818		202	Fez1: Fez1; InterPro: IPR009638 This family repres	94.31
PF12128		1201	DUF3584: Protein of unknown function (DUF3584); In	94.3
KOG0161		1930	consensus Myosin class II heavy chain [Cytoskeleto	94.27
KOG0996		1293	consensus Structural maintenance of chromosome pro	94.26
PRK04863		1486	mukB cell division protein MukB; Provisional	94.25
KOG0980		980	consensus Actin-binding protein SLA2/Huntingtin-in	94.23
PRK03918		880	chromosome segregation protein; Provisional	94.2
PHA02562		562	46 endonuclease subunit; Provisional	94.18
KOG0977		546	consensus Nuclear envelope protein lamin, intermed	93.88
KOG1029		1118	consensus Endocytic adaptor protein intersectin [S	93.79
KOG0933		1174	consensus Structural maintenance of chromosome pro	93.76
COG1579		239	Zn-ribbon protein, possibly nucleic acid-binding [	93.74
PF04156		191	IncA: IncA protein; InterPro: IPR007285 Chlamydia	93.74
COG4942		420	Membrane-bound metallopeptidase [Cell division and	93.73
COG1579		239	Zn-ribbon protein, possibly nucleic acid-binding [	93.7
PF14915		305	CCDC144C: CCDC144C protein coiled-coil region	93.68
PF12718		143	Tropomyosin_1: Tropomyosin like; InterPro: IPR0005	93.63
PF00261		237	Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop	93.56
PF15066		527	CAGE1: Cancer-associated gene protein 1 family	93.53
PF09726		697	Macoilin: Transmembrane protein; InterPro: IPR0191	93.25
PF05667		594	DUF812: Protein of unknown function (DUF812); Inte	93.18
PF13851		201	GAS: Growth-arrest specific micro-tubule binding	93.11
PF12718		143	Tropomyosin_1: Tropomyosin like; InterPro: IPR0005	93.03
PF15070		617	GOLGA2L5: Putative golgin subfamily A member 2-lik	93.01
PRK12704		520	phosphodiesterase; Provisional	93.01
TIGR00606		1311	rad50 rad50. This family is based on the phylogeno	93.0
PF15397		258	DUF4618: Domain of unknown function (DUF4618)	93.0
KOG4643		1195	consensus Uncharacterized coiled-coil protein [Fun	92.98
KOG0978		698	consensus E3 ubiquitin ligase involved in syntaxin	92.89
PF00261		237	Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop	92.85
PF10174		775	Cast: RIM-binding protein of the cytomatrix active	92.83
PF00308		219	Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013	92.82
KOG0971		1243	consensus Microtubule-associated protein dynactin	92.73
COG0556		663	UvrB Helicase subunit of the DNA excision repair c	92.64
TIGR03319		514	YmdA_YtgF conserved hypothetical protein YmdA/YtgF	92.62
PF04156		191	IncA: IncA protein; InterPro: IPR007285 Chlamydia	92.53
KOG0612		1317	consensus Rho-associated, coiled-coil containing p	92.33
PF10473		140	CENP-F_leu_zip: Leucine-rich repeats of kinetochor	92.3
TIGR00606		1311	rad50 rad50. This family is based on the phylogeno	92.25
COG3883		265	Uncharacterized protein conserved in bacteria [Fun	92.2
PRK00106		535	hypothetical protein; Provisional	92.04
COG1340		294	Uncharacterized archaeal coiled-coil protein [Func	91.89
KOG4674		1822	consensus Uncharacterized conserved coiled-coil pr	91.85
PRK04778		569	septation ring formation regulator EzrA; Provision	91.64
COG5185		622	HEC1 Protein involved in chromosome segregation, i	91.57
KOG4360		596	consensus Uncharacterized coiled coil protein [Fun	91.45
KOG0976		1265	consensus Rho/Rac1-interacting serine/threonine ki	91.3
KOG0977		546	consensus Nuclear envelope protein lamin, intermed	91.29
KOG0999		772	consensus Microtubule-associated protein Bicaudal-	91.29
PF05701		522	WEMBL: Weak chloroplast movement under blue light;	91.27
PF10186		302	Atg14: UV radiation resistance protein and autopha	91.13
PF13870		177	DUF4201: Domain of unknown function (DUF4201)	90.99
PF10174		775	Cast: RIM-binding protein of the cytomatrix active	90.84
PF10168		717	Nup88: Nuclear pore component; InterPro: IPR019321	90.73
KOG0995		581	consensus Centromere-associated protein HEC1 [Cell	90.62
PF05701		522	WEMBL: Weak chloroplast movement under blue light;	90.58
PF06785		401	UPF0242: Uncharacterised protein family (UPF0242);	90.55
PRK04778		569	septation ring formation regulator EzrA; Provision	90.5
KOG4674		1822	consensus Uncharacterized conserved coiled-coil pr	90.46
PF15619		194	Lebercilin: Ciliary protein causing Leber congenit	90.39
COG1340		294	Uncharacterized archaeal coiled-coil protein [Func	90.38
PRK04863		1486	mukB cell division protein MukB; Provisional	90.16
PF10168		717	Nup88: Nuclear pore component; InterPro: IPR019321	90.13
PF05010		207	TACC: Transforming acidic coiled-coil-containing p	90.12
KOG0995		581	consensus Centromere-associated protein HEC1 [Cell	90.1
COG2805		353	PilT Tfp pilus assembly protein, pilus retraction	90.07
KOG0976		1265	consensus Rho/Rac1-interacting serine/threonine ki	89.92
PF13870		177	DUF4201: Domain of unknown function (DUF4201)	89.89
KOG0999		772	consensus Microtubule-associated protein Bicaudal-	89.83
PRK06893		229	DNA replication initiation factor; Validated	89.49
KOG1853		333	consensus LIS1-interacting protein NUDE [Cytoskele	89.45
PF05010		207	TACC: Transforming acidic coiled-coil-containing p	89.44
KOG0964		1200	consensus Structural maintenance of chromosome pro	89.38
PF08317		325	Spc7: Spc7 kinetochore protein; InterPro: IPR01325	89.29
PF15619		194	Lebercilin: Ciliary protein causing Leber congenit	89.24
COG4372		499	Uncharacterized protein conserved in bacteria with	89.22
KOG4673		961	consensus Transcription factor TMF, TATA element m	89.03
KOG0243		1041	consensus Kinesin-like protein [Cytoskeleton]	88.82
KOG0612		1317	consensus Rho-associated, coiled-coil containing p	88.67
PF00038		312	Filament: Intermediate filament protein; InterPro:	88.64
PRK01156		895	chromosome segregation protein; Provisional	88.61
KOG2129		552	consensus Uncharacterized conserved protein H4 [Fu	88.61
PF11559		151	ADIP: Afadin- and alpha -actinin-Binding; InterPro	88.59
PF09789		319	DUF2353: Uncharacterized coiled-coil protein (DUF2	88.53
PF09730		717	BicD: Microtubule-associated protein Bicaudal-D; I	88.5
PF10146		230	zf-C4H2: Zinc finger-containing protein ; InterPro	88.29
PRK10361		475	DNA recombination protein RmuC; Provisional	88.03
PRK06835		329	DNA replication protein DnaC; Validated	87.98
COG4372		499	Uncharacterized protein conserved in bacteria with	87.96
PRK01156		895	chromosome segregation protein; Provisional	87.92
COG2433		652	Uncharacterized conserved protein [Function unknow	87.78
PF08614		194	ATG16: Autophagy protein 16 (ATG16); InterPro: IPR	87.62
KOG0727		408	consensus 26S proteasome regulatory complex, ATPas	87.59
COG2804		500	PulE Type II secretory pathway, ATPase PulE/Tfp pi	87.56
PF13851		201	GAS: Growth-arrest specific micro-tubule binding	87.55
KOG0946		970	consensus ER-Golgi vesicle-tethering protein p115	87.35
PRK14086		617	dnaA chromosomal replication initiation protein; P	87.25
TIGR01843		423	type_I_hlyD type I secretion membrane fusion prote	87.16
TIGR03007		498	pepcterm_ChnLen polysaccharide chain length determ	87.02
KOG0964		1200	consensus Structural maintenance of chromosome pro	86.91
PRK06620		214	hypothetical protein; Validated	86.91
PF04111		314	APG6: Autophagy protein Apg6; InterPro: IPR007243	86.81
PF10267		395	Tmemb_cc2: Predicted transmembrane and coiled-coil	86.68
KOG4809		654	consensus Rab6 GTPase-interacting protein involved	86.56
PF05266		190	DUF724: Protein of unknown function (DUF724); Inte	86.42
PTZ00454		398	26S protease regulatory subunit 6B-like protein; P	86.4
KOG1850		391	consensus Myosin-like coiled-coil protein [Cytoske	86.26
PF10186		302	Atg14: UV radiation resistance protein and autopha	86.25
PF12128		1201	DUF3584: Protein of unknown function (DUF3584); In	86.21
TIGR01242		364	26Sp45 26S proteasome subunit P45 family. Many pro	86.15
TIGR01843		423	type_I_hlyD type I secretion membrane fusion prote	86.09
PRK08084		235	DNA replication initiation factor; Provisional	86.08
KOG0994		1758	consensus Extracellular matrix glycoprotein Lamini	85.85
PRK12377		248	putative replication protein; Provisional	85.85
COG0593		408	DnaA ATPase involved in DNA replication initiation	85.8
COG1474		366	CDC6 Cdc6-related protein, AAA superfamily ATPase	85.75
PRK14088		440	dnaA chromosomal replication initiation protein; P	85.6
KOG4603		201	consensus TBP-1 interacting protein [Signal transd	85.57
PF07926		132	TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro:	85.5
PF09730		717	BicD: Microtubule-associated protein Bicaudal-D; I	85.44
TIGR02680		1353	conserved hypothetical protein TIGR02680. Members	85.44
TIGR00362		405	DnaA chromosomal replication initiator protein Dna	85.25
KOG0979		1072	consensus Structural maintenance of chromosome pro	85.15
PF07111		739	HCR: Alpha helical coiled-coil rod protein (HCR);	85.12
PF05483		786	SCP-1: Synaptonemal complex protein 1 (SCP-1); Int	84.9
PRK05642		234	DNA replication initiation factor; Validated	84.87
PRK10884		206	SH3 domain-containing protein; Provisional	84.86
PF08581		79	Tup_N: Tup N-terminal; InterPro: IPR013890 The N-t	84.83
PRK07952		244	DNA replication protein DnaC; Validated	84.74
KOG0946		970	consensus ER-Golgi vesicle-tethering protein p115	84.73
PRK00149		450	dnaA chromosomal replication initiation protein; R	84.71
TIGR02928		365	orc1/cdc6 family replication initiation protein. M	84.62
KOG0979		1072	consensus Structural maintenance of chromosome pro	84.56
PF15070		617	GOLGA2L5: Putative golgin subfamily A member 2-lik	84.44
PRK03992		389	proteasome-activating nucleotidase; Provisional	84.37
PF15254		861	CCDC14: Coiled-coil domain-containing protein 14	84.33
PLN03188		1320	kinesin-12 family protein; Provisional	84.07
PRK08116		268	hypothetical protein; Validated	84.02
TIGR03319		514	YmdA_YtgF conserved hypothetical protein YmdA/YtgF	83.49
KOG0249		916	consensus LAR-interacting protein and related prot	83.25
PF09755		310	DUF2046: Uncharacterized conserved protein H4 (DUF	83.11
PF14915		305	CCDC144C: CCDC144C protein coiled-coil region	83.03
PRK14087		450	dnaA chromosomal replication initiation protein; P	83.0
PRK09087		226	hypothetical protein; Validated	82.99
TIGR03420		226	DnaA_homol_Hda DnaA regulatory inactivator Hda. Me	82.96
PF13514		1111	AAA_27: AAA domain	82.91
PF08614		194	ATG16: Autophagy protein 16 (ATG16); InterPro: IPR	82.86
PF06785		401	UPF0242: Uncharacterised protein family (UPF0242);	82.84
KOG0018		1141	consensus Structural maintenance of chromosome pro	82.68
KOG2991		330	consensus Splicing regulator [RNA processing and m	82.68
KOG0804		493	consensus Cytoplasmic Zn-finger protein BRAP2 (BRC	82.39
PF05483		786	SCP-1: Synaptonemal complex protein 1 (SCP-1); Int	82.37
PRK10884		206	SH3 domain-containing protein; Provisional	82.35
KOG1937		521	consensus Uncharacterized conserved protein [Funct	82.34
TIGR03017		444	EpsF chain length determinant protein EpsF. Sequen	82.18
PF15254		861	CCDC14: Coiled-coil domain-containing protein 14	82.06
KOG1937		521	consensus Uncharacterized conserved protein [Funct	81.9
PRK08727		233	hypothetical protein; Validated	81.74
PF12325		120	TMF_TATA_bd: TATA element modulatory factor 1 TATA	81.65
cd00046		144	DEXDc DEAD-like helicases superfamily. A diverse f	81.56
PF06818		202	Fez1: Fez1; InterPro: IPR009638 This family repres	81.45
PRK00106		535	hypothetical protein; Provisional	81.06
PF05911		769	DUF869: Plant protein of unknown function (DUF869)	80.77
KOG4673		961	consensus Transcription factor TMF, TATA element m	80.7
PRK08903		227	DnaA regulatory inactivator Hda; Validated	80.43
PF12325		120	TMF_TATA_bd: TATA element modulatory factor 1 TATA	80.14
PF04111		314	APG6: Autophagy protein Apg6; InterPro: IPR007243	80.09

>KOG0239 consensus Kinesin (KAR3 subfamily) [Cytoskeleton]	Back alignment and domain information

Probab=100.00  E-value=1.7e-79  Score=722.67  Aligned_cols=380  Identities=46%  Similarity=0.618  Sum_probs=318.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHhHHHhhcC
Q 002276          284 WFSSLRDLTRRLKIMKMEHINLFEEALAYKKCAAEISEASSTIQSKINHQVQLYEHLKIKFIEGTKERKELYNKVLELKG  363 (943)
Q Consensus       284 l~~~L~~L~~~l~~~k~e~~~l~~e~~~~~~~~~~i~~~~~~lq~~i~~~~~~~e~l~~kl~~e~~~RrkLhN~lqELKG  363 (943)
                      ....|..|+..+..++.....+..+...+...+.+   ....+...+..+......+.+++ +|+.+||+|||+|+||||
T Consensus       239 ~~~~i~~l~~~l~~l~~~~~~l~~~~~~~~~~~~~---~~~~~~~~~~~L~~~~~~l~~~~-~e~~~r~kL~N~i~eLkG  314 (670)
T KOG0239|consen  239 IKKKIQALQQELEELKAELKELNDQVSLLTREVQE---ALKESNTLQSDLESLEENLVEKK-KEKEERRKLHNEILELKG  314 (670)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH---HHHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHhhc
Confidence            33346777777777777666666665544443332   22233333555666667778888 899999999999999999


Q ss_pred             CEEEEEEeCCCCchhhccCCeeEEeeeccCCCeEEEEeCCcCc----eeeecceeeCCCCCcccccccchhhHHHhhCCc
Q 002276          364 NIRVFCRCRPLNSEETAAGSVMAVDFESVRDGELTVISNGAPK----KTFKFDAVFGPQADQVDVFQDTAPFANSVLDGY  439 (943)
Q Consensus       364 NIRV~~RVRPl~~~E~~~g~~~~V~~~s~~d~~i~v~~~g~~~----ktF~FD~VF~~~asQeeVFeev~pLV~svLdGy  439 (943)
                      ||||||||||+.+.+.......+++++..  +.+.+.......    +.|.||+||+|.++|++||.++.|+|+++||||
T Consensus       315 nIRV~CRvRP~~~~e~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~f~fdkVf~p~~sQ~~VF~e~~~lv~S~lDGY  392 (670)
T KOG0239|consen  315 NIRVFCRVRPLLPSEKQRLQSKVIDTEEQ--GEVQVDSPDKGDKLEPQSFKFDKVFGPLASQDDVFEEVSPLVQSALDGY  392 (670)
T ss_pred             CceEEEEecCCCccccccccccccccCCc--ceeEeecCCCCCCCccccceeeeecCCcccHHHHHHHHHHHHHHHhcCc
Confidence            99999999999998877544444444322  334444333222    359999999999999999999999999999999


Q ss_pred             ceEEEeeCcccCcccccccc-CCCCCCccHHhHHHHHHHHHhhcccceeEEEEEEEEEecchhhhccccCCCCCCCcccc
Q 002276          440 NVCIFAYGQTGTGKTFTMEG-TKEARGVNFRTLEELFRIIKEREKLYRYDISVSVLEVYNEQIRDLLAVGSQPGAVSKRL  518 (943)
Q Consensus       440 NvcIFAYGQTGSGKTyTM~G-~~e~~GIIPRal~~LF~~i~~~~~~~~y~V~VSflEIYNE~I~DLL~~~~~~~~~~k~L  518 (943)
                      |+||||||||||||||||.| +++++|||||++++||..+.....+|.|.+.+||+|||||.|+|||++..    ...++
T Consensus       393 nVCIFAYGQTGSGKTyTM~G~~~~~~Giipral~~lF~~~~~~~~g~~y~~~~s~~EIYNe~i~DlL~~~~----~~~k~  468 (670)
T KOG0239|consen  393 NVCIFAYGQTGSGKTYTMSGPTPEDPGIIPRALEKLFRTITSLKSGWKYDKTVSMLEIYNEAIRDLLSDES----YVGKL  468 (670)
T ss_pred             ceeEEEecccCCCccccccCCCcccCCccHHHHHHHHHHHHhhccCceEEeeeehhHHHHHHHHHhccccc----cccce
Confidence            99999999999999999999 68999999999999999999987799999999999999999999998764    34689


Q ss_pred             eEEeCCCCceEcCCceEEEecChHHHHHHHHccccccccccCCCccCCCCceeeEEEEEEEEee---------hhchhh-
Q 002276          519 EVRQAGEGMHHVPGLVEAHVNNISEVWEVLQTGSNVRAVGSTNANEHSSRSHCMHCVMVRRELV---------EWGMHK-  588 (943)
Q Consensus       519 eIred~~g~v~V~gLtev~V~S~eE~~~lL~~G~k~R~~asT~mN~~SSRSHsIftI~V~~~~~---------~~lVDk-  588 (943)
                      .|+++++|.++|+|++.+.|.+.+++..+++.|..+|++++|.+|++|||||+||+|+|.+.+.         +++||. 
T Consensus       469 ~I~~~~~~~~~V~~~t~~~V~s~~~v~~ll~~g~~nRsv~~T~~Ne~SSRSH~v~~v~v~g~~~~t~~~~~g~l~LVDLA  548 (670)
T KOG0239|consen  469 EIVDDAEGNLMVPLLTVIKVGSSEEVDILLEIGLSNRSVASTASNERSSRSHLVFRVRIRGINELTGIRVTGVLNLVDLA  548 (670)
T ss_pred             eEEEcCCCceecccceEEecCCHHHHHHHHHHhhccccccccccchhhhccceEEEEEEeccccCcccccccceeEeecc
Confidence            9999999999999999999999999999999999999999999999999999999999988643         367771 


Q ss_pred             ----------------h---------------hhhh---cCCCCCcccchHHhhhhcCCCcceeEEEecCCCCcChHhhH
Q 002276          589 ----------------E---------------QAMA---SGSSRKNSKLTHLLQDSLGGDSKTLMFVQISPNENDLSETL  634 (943)
Q Consensus       589 ----------------E---------------sALa---~~sPyRdSKLTrLLQDSLGGNSKTlMIv~ISPs~~~~~ETL  634 (943)
                                      |               .||+   .|+||||||||+||||||||++||+|||+|||...++.||+
T Consensus       549 GSER~~~s~~tG~RlkE~Q~INkSLS~LgdVi~AL~~k~~HiPyRNSKLT~lLq~sLGG~sKTLmfv~isP~~~~~~Etl  628 (670)
T KOG0239|consen  549 GSERVSKSGVTGERLKEAQNINKSLSALGDVISALASKRSHIPYRNSKLTQLLQDSLGGDSKTLMFVNISPAAAALFETL  628 (670)
T ss_pred             cCcccCcCCCchhhhHHHHHhchhhhhhHHHHHHHhhcCCCCcccccchHHHhHhhhCCccceeeEEEeCccHHHHhhhh
Confidence                            1               3443   36799999999999999999999999999999999999999


Q ss_pred             HHHHHHhHhhccccccccccCChHHHHHHHHHHHHHHHH
Q 002276          635 CSLNFASRVRGIELGAAKKQLDTSELLRYKQMVEKTKQE  673 (943)
Q Consensus       635 sTLrFAsRak~Ik~~~~~~~~~~~el~rlk~~ie~LK~e  673 (943)
                      ++|+||+|++.+++++++.+....+...+..+...++..
T Consensus       629 ~sL~FA~rv~~~~lG~a~~~~~~~~~~~~~~~~~~~~~~  667 (670)
T KOG0239|consen  629 CSLRFATRVRSVELGSARKQVSTSDDVSLKRFGQLEKLS  667 (670)
T ss_pred             hccchHHHhhceecccccccccccchhhhhhhhhhhhhh
Confidence            999999999999999999999888887777776666544

>KOG0243 consensus Kinesin-like protein [Cytoskeleton]	Back alignment and domain information

>KOG0245 consensus Kinesin-like protein [Cytoskeleton]	Back alignment and domain information

>KOG4280 consensus Kinesin-like protein [Cytoskeleton]	Back alignment and domain information

>PLN03188 kinesin-12 family protein; Provisional	Back alignment and domain information

>KOG0240 consensus Kinesin (SMY1 subfamily) [Cytoskeleton]	Back alignment and domain information

>cd01370 KISc_KIP3_like Kinesin motor domain, KIP3-like subgroup	Back alignment and domain information

>cd01373 KISc_KLP2_like Kinesin motor domain, KLP2-like subgroup	Back alignment and domain information

>KOG0242 consensus Kinesin-like protein [Cytoskeleton]	Back alignment and domain information

>KOG0241 consensus Kinesin-like protein [Cytoskeleton]	Back alignment and domain information

>cd01368 KISc_KIF23_like Kinesin motor domain, KIF23-like subgroup	Back alignment and domain information

>cd01365 KISc_KIF1A_KIF1B Kinesin motor domain, KIF1_like proteins	Back alignment and domain information

>cd01367 KISc_KIF2_like Kinesin motor domain, KIF2-like group	Back alignment and domain information

>cd01364 KISc_BimC_Eg5 Kinesin motor domain, BimC/Eg5 spindle pole proteins, participate in spindle assembly and chromosome segregation during cell division	Back alignment and domain information

>cd01366 KISc_C_terminal Kinesin motor domain, KIFC2/KIFC3/ncd-like carboxy-terminal kinesins	Back alignment and domain information

>cd01371 KISc_KIF3 Kinesin motor domain, kinesins II or KIF3_like proteins	Back alignment and domain information

>cd01376 KISc_KID_like Kinesin motor domain, KIF22/Kid-like subgroup	Back alignment and domain information

>cd01369 KISc_KHC_KIF5 Kinesin motor domain, kinesin heavy chain (KHC) or KIF5-like subgroup	Back alignment and domain information

>cd01372 KISc_KIF4 Kinesin motor domain, KIF4-like subfamily	Back alignment and domain information

>cd01374 KISc_CENP_E Kinesin motor domain, CENP-E/KIP2-like subgroup, involved in chromosome movement and/or spindle elongation during mitosis	Back alignment and domain information

>cd01375 KISc_KIF9_like Kinesin motor domain, KIF9-like subgroup; might play a role in cell shape remodeling	Back alignment and domain information

>smart00129 KISc Kinesin motor, catalytic domain	Back alignment and domain information

>cd00106 KISc Kinesin motor domain	Back alignment and domain information

>PF00225 Kinesin: Kinesin motor domain; InterPro: IPR001752 Kinesin [, , ] is a microtubule-associated force-producing protein that may play a role in organelle transport	Back alignment and domain information

>KOG0247 consensus Kinesin-like protein [Cytoskeleton]	Back alignment and domain information

>KOG0246 consensus Kinesin-like protein [Cytoskeleton]	Back alignment and domain information

>KOG0244 consensus Kinesin-like protein [Cytoskeleton]	Back alignment and domain information

>COG5059 KIP1 Kinesin-like protein [Cytoskeleton]	Back alignment and domain information

>cd01363 Motor_domain Myosin and Kinesin motor domain	Back alignment and domain information

>COG5059 KIP1 Kinesin-like protein [Cytoskeleton]	Back alignment and domain information

>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair]	Back alignment and domain information

>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>PRK11637 AmiB activator; Provisional	Back alignment and domain information

>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

>KOG0982 consensus Centrosomal protein Nuf [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton]	Back alignment and domain information

>PRK11637 AmiB activator; Provisional	Back alignment and domain information

>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT)	Back alignment and domain information

>PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore []	Back alignment and domain information

>PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT)	Back alignment and domain information

>PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues	Back alignment and domain information

>PF14662 CCDC155: Coiled-coil region of CCDC155	Back alignment and domain information

>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association []	Back alignment and domain information

>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT)	Back alignment and domain information

>PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues	Back alignment and domain information

>PRK09039 hypothetical protein; Validated	Back alignment and domain information

>KOG0161 consensus Myosin class II heavy chain [Cytoskeleton]	Back alignment and domain information

>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes	Back alignment and domain information

>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>PRK09039 hypothetical protein; Validated	Back alignment and domain information

>KOG4360 consensus Uncharacterized coiled coil protein [Function unknown]	Back alignment and domain information

>PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function	Back alignment and domain information

>PRK02224 chromosome segregation protein; Provisional	Back alignment and domain information

>KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PHA02562 46 endonuclease subunit; Provisional	Back alignment and domain information

>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair]	Back alignment and domain information

>PRK03918 chromosome segregation protein; Provisional	Back alignment and domain information

>KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton]	Back alignment and domain information

>smart00787 Spc7 Spc7 kinetochore protein	Back alignment and domain information

>PRK02224 chromosome segregation protein; Provisional	Back alignment and domain information

>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>PF14662 CCDC155: Coiled-coil region of CCDC155	Back alignment and domain information

>KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown]	Back alignment and domain information

>KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton]	Back alignment and domain information

>PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ]	Back alignment and domain information

>PF06818 Fez1: Fez1; InterPro: IPR009638 This family represents the eukaryotic Fez1 protein	Back alignment and domain information

>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins	Back alignment and domain information

>KOG0161 consensus Myosin class II heavy chain [Cytoskeleton]	Back alignment and domain information

>KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PRK04863 mukB cell division protein MukB; Provisional	Back alignment and domain information

>KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton]	Back alignment and domain information

>PRK03918 chromosome segregation protein; Provisional	Back alignment and domain information

>PHA02562 46 endonuclease subunit; Provisional	Back alignment and domain information

>KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure]	Back alignment and domain information

>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only]	Back alignment and domain information

>PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion	Back alignment and domain information

>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning]	Back alignment and domain information

>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only]	Back alignment and domain information

>PF14915 CCDC144C: CCDC144C protein coiled-coil region	Back alignment and domain information

>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells	Back alignment and domain information

>PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells	Back alignment and domain information

>PF15066 CAGE1: Cancer-associated gene protein 1 family	Back alignment and domain information

>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes	Back alignment and domain information

>PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function	Back alignment and domain information

>PF13851 GAS: Growth-arrest specific micro-tubule binding	Back alignment and domain information

>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells	Back alignment and domain information

>PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5	Back alignment and domain information

>PRK12704 phosphodiesterase; Provisional	Back alignment and domain information

>TIGR00606 rad50 rad50	Back alignment and domain information

>PF15397 DUF4618: Domain of unknown function (DUF4618)	Back alignment and domain information

>KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown]	Back alignment and domain information

>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells	Back alignment and domain information

>PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion []	Back alignment and domain information

>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication	Back alignment and domain information

>KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton]	Back alignment and domain information

>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair]	Back alignment and domain information

>TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF	Back alignment and domain information

>PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion	Back alignment and domain information

>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ]	Back alignment and domain information

>TIGR00606 rad50 rad50	Back alignment and domain information

>COG3883 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>PRK00106 hypothetical protein; Provisional	Back alignment and domain information

>COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown]	Back alignment and domain information

>KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown]	Back alignment and domain information

>PRK04778 septation ring formation regulator EzrA; Provisional	Back alignment and domain information

>COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning]	Back alignment and domain information

>KOG4360 consensus Uncharacterized coiled coil protein [Function unknown]	Back alignment and domain information

>KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms]	Back alignment and domain information

>KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure]	Back alignment and domain information

>KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function	Back alignment and domain information

>PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking	Back alignment and domain information

>PF13870 DUF4201: Domain of unknown function (DUF4201)	Back alignment and domain information

>PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion []	Back alignment and domain information

>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs	Back alignment and domain information

>KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function	Back alignment and domain information

>PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function	Back alignment and domain information

>PRK04778 septation ring formation regulator EzrA; Provisional	Back alignment and domain information

>KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown]	Back alignment and domain information

>PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease	Back alignment and domain information

>COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown]	Back alignment and domain information

>PRK04863 mukB cell division protein MukB; Provisional	Back alignment and domain information

>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs	Back alignment and domain information

>PF05010 TACC: Transforming acidic coiled-coil-containing protein (TACC); InterPro: IPR007707 This family contains the proteins TACC 1, 2 and 3, found concentrated in the centrosomes of eukaryotes which may play a conserved role in organising centrosomal microtubules	Back alignment and domain information

>KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion]	Back alignment and domain information

>KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms]	Back alignment and domain information

>PF13870 DUF4201: Domain of unknown function (DUF4201)	Back alignment and domain information

>KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PRK06893 DNA replication initiation factor; Validated	Back alignment and domain information

>KOG1853 consensus LIS1-interacting protein NUDE [Cytoskeleton]	Back alignment and domain information

>PF05010 TACC: Transforming acidic coiled-coil-containing protein (TACC); InterPro: IPR007707 This family contains the proteins TACC 1, 2 and 3, found concentrated in the centrosomes of eukaryotes which may play a conserved role in organising centrosomal microtubules	Back alignment and domain information

>KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association []	Back alignment and domain information

>PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease	Back alignment and domain information

>COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown]	Back alignment and domain information

>KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription]	Back alignment and domain information

>KOG0243 consensus Kinesin-like protein [Cytoskeleton]	Back alignment and domain information

>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope	Back alignment and domain information

>PRK01156 chromosome segregation protein; Provisional	Back alignment and domain information

>KOG2129 consensus Uncharacterized conserved protein H4 [Function unknown]	Back alignment and domain information

>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch	Back alignment and domain information

>PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function	Back alignment and domain information

>PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) []	Back alignment and domain information

>PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule	Back alignment and domain information

>PRK10361 DNA recombination protein RmuC; Provisional	Back alignment and domain information

>PRK06835 DNA replication protein DnaC; Validated	Back alignment and domain information

>COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown]	Back alignment and domain information

>PRK01156 chromosome segregation protein; Provisional	Back alignment and domain information

>COG2433 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells	Back alignment and domain information

>KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion]	Back alignment and domain information

>PF13851 GAS: Growth-arrest specific micro-tubule binding	Back alignment and domain information

>KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PRK14086 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family	Back alignment and domain information

>TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily	Back alignment and domain information

>KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PRK06620 hypothetical protein; Validated	Back alignment and domain information

>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells	Back alignment and domain information

>PF10267 Tmemb_cc2: Predicted transmembrane and coiled-coil 2 protein; InterPro: IPR019394 This family of transmembrane coiled-coil containing proteins is conserved from worms to humans	Back alignment and domain information

>KOG4809 consensus Rab6 GTPase-interacting protein involved in endosome-to-TGN transport [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF05266 DUF724: Protein of unknown function (DUF724); InterPro: IPR007930 This family contains several uncharacterised proteins found exclusively in Arabidopsis thaliana	Back alignment and domain information

>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional	Back alignment and domain information

>KOG1850 consensus Myosin-like coiled-coil protein [Cytoskeleton]	Back alignment and domain information

>PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking	Back alignment and domain information

>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins	Back alignment and domain information

>TIGR01242 26Sp45 26S proteasome subunit P45 family	Back alignment and domain information

>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family	Back alignment and domain information

>PRK08084 DNA replication initiation factor; Provisional	Back alignment and domain information

>KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures]	Back alignment and domain information

>PRK12377 putative replication protein; Provisional	Back alignment and domain information

>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair]	Back alignment and domain information

>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK14088 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>KOG4603 consensus TBP-1 interacting protein [Signal transduction mechanisms]	Back alignment and domain information

>PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT)	Back alignment and domain information

>PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) []	Back alignment and domain information

>TIGR02680 conserved hypothetical protein TIGR02680	Back alignment and domain information

>TIGR00362 DnaA chromosomal replication initiator protein DnaA	Back alignment and domain information

>KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair]	Back alignment and domain information

>PF07111 HCR: Alpha helical coiled-coil rod protein (HCR); InterPro: IPR009800 This family consists of several mammalian alpha helical coiled-coil rod HCR proteins	Back alignment and domain information

>PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex	Back alignment and domain information

>PRK05642 DNA replication initiation factor; Validated	Back alignment and domain information

>PRK10884 SH3 domain-containing protein; Provisional	Back alignment and domain information

>PF08581 Tup_N: Tup N-terminal; InterPro: IPR013890 The N-terminal region of the Tup protein has been shown to interact with the Ssn6 transcriptional co-repressor []	Back alignment and domain information

>PRK07952 DNA replication protein DnaC; Validated	Back alignment and domain information

>KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PRK00149 dnaA chromosomal replication initiation protein; Reviewed	Back alignment and domain information

>TIGR02928 orc1/cdc6 family replication initiation protein	Back alignment and domain information

>KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair]	Back alignment and domain information

>PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5	Back alignment and domain information

>PRK03992 proteasome-activating nucleotidase; Provisional	Back alignment and domain information

>PF15254 CCDC14: Coiled-coil domain-containing protein 14	Back alignment and domain information

>PLN03188 kinesin-12 family protein; Provisional	Back alignment and domain information

>PRK08116 hypothetical protein; Validated	Back alignment and domain information

>TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF	Back alignment and domain information

>KOG0249 consensus LAR-interacting protein and related proteins [General function prediction only]	Back alignment and domain information

>PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain	Back alignment and domain information

>PF14915 CCDC144C: CCDC144C protein coiled-coil region	Back alignment and domain information

>PRK14087 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PRK09087 hypothetical protein; Validated	Back alignment and domain information

>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda	Back alignment and domain information

>PF13514 AAA_27: AAA domain	Back alignment and domain information

>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells	Back alignment and domain information

>PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function	Back alignment and domain information

>KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG2991 consensus Splicing regulator [RNA processing and modification]	Back alignment and domain information

>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only]	Back alignment and domain information

>PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex	Back alignment and domain information

>PRK10884 SH3 domain-containing protein; Provisional	Back alignment and domain information

>KOG1937 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>TIGR03017 EpsF chain length determinant protein EpsF	Back alignment and domain information

>PF15254 CCDC14: Coiled-coil domain-containing protein 14	Back alignment and domain information

>KOG1937 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PRK08727 hypothetical protein; Validated	Back alignment and domain information

>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes []	Back alignment and domain information

>cd00046 DEXDc DEAD-like helicases superfamily	Back alignment and domain information

>PF06818 Fez1: Fez1; InterPro: IPR009638 This family represents the eukaryotic Fez1 protein	Back alignment and domain information

>PRK00106 hypothetical protein; Provisional	Back alignment and domain information

>PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants	Back alignment and domain information

>KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription]	Back alignment and domain information

>PRK08903 DnaA regulatory inactivator Hda; Validated	Back alignment and domain information

>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes []	Back alignment and domain information

>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		943
2h58_A		330	Crystal Structure Of The Kifc3 Motor Domain In Comp		4e-60
2ncd_A		420	Ncd (Non-Claret Disjunctional) Dimer From D. Melano		1e-50
1cz7_A		406	The Crystal Structure Of A Minus-End Directed Micro		1e-50
1n6m_A		409	Rotation Of The StalkNECK AND ONE HEAD IN A NEW CRY		2e-50
3h4s_A		386	Structure Of The Complex Of A Mitotic Kinesin With		2e-50
3u06_A		412	Crystal Structure Of The Kinesin-14 Ncdg347d Length		1e-49
3l1c_A		383	Kinesin-14 Protein Ncd, T436s Mutant Length = 383		5e-49
1sdm_A		369	Crystal Structure Of Kinesin-Like Calmodulin Bindin		3e-46
1f9t_A		358	Crystal Structures Of Kinesin Mutants Reveal A Sign		2e-45
4etp_A		403	C-Terminal Motor And Motor Homology Domain Of Kar3v		4e-44
2rep_A		376	Crystal Structure Of The Motor Domain Of Human Kine		7e-44
3b6u_A		372	Crystal Structure Of The Motor Domain Of Human Kine		2e-43
1f9w_A		347	Crystal Structures Of Mutants Reveal A Signalling P		1e-42
1f9u_A		347	Crystal Structures Of Mutants Reveal A Signalling P		1e-42
3kar_A		346	The Motor Domain Of Kinesin-Like Protein Kar3, A Sa		4e-42
1f9v_A		347	Crystal Structures Of Mutants Reveal A Signalling P		1e-41
1goj_A		355	Structure Of A Fast Kinesin: Implications For Atpas		2e-41
4gkr_A		371	Structure Of The C-Terminal Motor Domain Of Kar3 Fr		5e-39
4a28_A		368	Eg5-2 Length = 368		6e-39
3hqd_A		369	Human Kinesin Eg5 Motor Domain In Complex With Ampp		6e-39
1q0b_A		367	Crystal Structure Of The Motor Protein Ksp In Compl		6e-39
1ii6_A		368	Crystal Structure Of The Mitotic Kinesin Eg5 In Com		6e-39
4a1z_A		368	Eg5-1 Length = 368		7e-39
4ap0_A		370	The Mitotic Kinesin Eg5 In Complex With Mg-Adp And		7e-39
1x88_A		359	Human Eg5 Motor Domain Bound To Mg-Adp And Monastro		8e-39
4aqv_C		373	Model Of Human Kinesin-5 Motor Domain (3hqd) And Ma		1e-38
3zcw_A		348	Eg5 - New Allosteric Binding Site Length = 348		1e-38
3t0q_A		349	Motor Domain Structure Of The Kar3-Like Kinesin Fro		2e-37
3b6v_A		395	Crystal Structure Of The Motor Domain Of Human Kine		4e-36
3b6v_A		395	Crystal Structure Of The Motor Domain Of Human Kine		7e-07
1bg2_A		325	Human Ubiquitous Kinesin Motor Domain Length = 325		2e-35
1mkj_A		349	Human Kinesin Motor Domain With Docked Neck Linker		3e-35
2y5w_A		365	Crystal Structure Of Drosophila Melanogaster Kinesi		4e-35
4atx_C		340	Rigor Kinesin Motor Domain With An Ordered Neck-Lin		1e-34
2wbe_C		373	Kinesin-5-Tubulin Complex With Amppnp Length = 373		6e-34
2vvg_A		350	Crystal Structure Of The G.Intestinalis Kinesin 2 G		6e-34
4h1g_A		715	Structure Of Candida Albicans Kar3 Motor Domain Fus		8e-33
3gbj_A		354	Crystal Structure Of The Motor Domain Of Kinesin Ki		7e-31
3lre_A		355	Crystal Structure Analysis Of Human Kinesin-8 Motor		1e-30
2xt3_A		344	Human Kif7, A Kinesin Involved In Hedgehog Signalli		2e-30
4a14_A		344	Human Kif7, A Kinesin Involved In Hedgehog Signalli		4e-30
1t5c_A		349	Crystal Structure Of The Motor Domain Of Human Kine		8e-28
2kin_A		238	Kinesin (Monomeric) From Rattus Norvegicus Length =		2e-27
3bfn_A		388	Crystal Structure Of The Motor Domain Of Human Kine		3e-26
3nwn_A		359	Crystal Structure Of The Human Kif9 Motor Domain In		2e-24
2owm_A		443	Motor Domain Of Neurospora Crassa Kinesin-3 (Nckin3		6e-24
2owm_A		443	Motor Domain Of Neurospora Crassa Kinesin-3 (Nckin3		8e-06
1i5s_A		367	Crystal Structure Of The Kif1a Motor Domain Complex		2e-23
1ia0_K		394	Kif1a Head-Microtubule Complex Structure In Atp-For		2e-22
1ia0_K		394	Kif1a Head-Microtubule Complex Structure In Atp-For		5e-04
1i6i_A		366	Crystal Structure Of The Kif1a Motor Domain Complex		2e-22
1i6i_A		366	Crystal Structure Of The Kif1a Motor Domain Complex		5e-04
1vfv_A		366	Crystal Structure Of The Kif1a Motor Domain Complex		4e-22
2gry_A		420	Crystal Structure Of The Human Kif2 Motor Domain In		6e-22
2heh_A		387	Crystal Structure Of The Kif2c Motor Domain (Casp T		1e-21
1v8j_A		410	The Crystal Structure Of The Minimal Functional Dom		2e-20
3edl_D		331	Kinesin13-Microtubule Ring Complex Length = 331		6e-20
3pxn_A		344	Crystal Structure Of The Drosophila Kinesin Family		9e-18
3dc4_A		344	Crystal Structure Of The Drosophila Kinesin Family		1e-17
1ry6_A		360	Crystal Structure Of Internal Kinesin Motor Domain		5e-11

>pdb|2H58|A Chain A, Crystal Structure Of The Kifc3 Motor Domain In Complex With Adp Length = 330