Citrus Sinensis ID: 002313

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------

MQSYEYSEDFLDWLLSNEEASHLFEKIVGHSAKKSDFETIGVEIVAKCGGLPIAIKTIANALKNKSPRIWKDAVNQLSNSNPRKIQGMDADLSSIELSYEFLKCKEVKSLFQLCGLLKDGSRIAVDDLLRYVMGLRLLTNADTLEAARNRVHTLIDNLKSASLLFDGDSEDHAKMHRIIHAIAVSIAAEKLLFNIQNVADLKEELDKIDEAPTAISIPFRGIYELPERLGFLKLKLFLFFTENLSLQIPDPFFEGMTELRVLDLTGFRFHSLPSSLGCLINLRTLSLENCLVVDVAIIGDLKKLEILSLKHSSIEQLPREIGQLTCLKLLDLSNCSKLKEIRPNVISNLTRLEELYMGNSFTQWKVEGQSNASLGELKQLSRLTTLEVHIPDAQVMPQDLVFVELERFRICIGDVWSWSDGYETSKTLKLQLNNSTYLGYGMKMLLKRTEDLHLDELAGFKNVVHELDDEEGFARLRHLHVHNGPEILHILNSDGRVGTFPLLESLFLHNLINLEKVCDGKVRLNEDDKSFSNLRIIKVEGCHRVKHLFPFSLVKNLLQLQKVKVTDCTNLKLIVGKESENSAHKNGSISGVYFRKLHFLKLQHLPQLTSSGFDLETPTNTQGSNPGIIAEGDPKDFTSLFNERVVFPSLKKLKLSSINVEKIWLNSFSAIESWGKNLTKLTVEKCGRLKFLFSSSMVNGLEQLQQLDISHCKSMNEVINTRVGRDDNMIEMVFPKLVSLQLSHLPKLTRFGIGDSVEFPSLCQLQIACCPNLKIFICSCTEEMSSEKNIHTTQTQPLFDEKVGLPKLEVLRIDGMDNLRKIWHHQLALDSFTKLKDLDVEYCDQLLSIFPSNMLRRLERLEHLAVSECGSIEEIVEISSNCTVETAPGVVFRQLTSLKLHWLPRLKSFCPGIHISGWLVLKNLDVFECDKFETFSS

ccccccccEEEcccccHHHHHHHHHHHHccccccccHHHHHHHHHHHcccHHHHHHHHHHHHccccHHHHHHHHHHHHccccccccccccccHHHHcccccccccHHHHHHHHHccccccccccHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHccccccccccccEEEccHHHHHHHHHHHcccEEEEEccccccccccccccccEEEEccccccccccccccccccEEEEEEccccccccccHHHcccccccEEEccccccccccccccccccccEEEcccccccccccccccccccEEEccccccccccHHHcccccccEEEccccccccccccccccccccccEEEcccccccEEEcccccccHHHccccccccEEEEEcccccccccccHHHcccccccEEccccccccccccccEEEEEcccccccccccccccccccccEEcccccccccccccccccccccccEEEEEcccccEEEccccccccccccccEEEEEcccccEEEccccccccccccccccccEEEEEcccccccccccccccccccccEEEEcccccccHHcccccccccccccccccEEEEEcccccccccccccccccccccccccccccccEEEcccccccccccccccccccccEEEEccccccccccccccccccccccccEEEEEEccccccccccccccccccccEEEEcccccccHHccccccccccccccccccccEEEEccccccEEEccccccccccccEEEEEccccccEEcccccccccccccccccccccccccccccccccEEEEEccccccccccccccccccccccEEEEEcccccccccccccccccccccEEEEEEcccccEEcccccccccccccccccccccEEEcccccccccccccccccccccccEEEEEcccccccccc

ccccccccEEEcccccHHHHHHHHHHHHccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHcccHHHHHHHHHHHHHHccHHccccccccHHEEEcHcccccHHHHHHHHHHHHccccccccHHHHHHHHHHHcHccccccccHHHHHHHHHHHHHHHccHHEccccccEEEHHHHHHHHHHHHHcccEEEEEEccccccccccccccEEEEEEEccccccccccHccccccEEEEEccccccccccHHHHHHccccEEEEEcccccccccccccccccccEEEccccccccccccccccccEEEEEcccccHHcccHHccccccEEEEEccccccccccHHHHHcHHcccEEEEEEccccEEccccccccHHHHHHcccccEEEEccccccccccHccHHHHHHcEEEccccccccccccccHHHHHHHcccccccccccHHcccccEEEEEcccccccccccccccccccccEEEEEccccccEEcccccccccccccccEEEEcccHcHHHcccccccccccccccccccEEEEcccccHcccccccHHHccccccEEEEcccccHcEcccccccccHHHHHcccccccccccEccccccccHccccccccccHcccccHHHHHHcccccHcccccccccccccccEEEEccccccccccccccccccccccccEEEEcccccccccccccHHcccccccEEEEcccccHHEcccccccccccccccccccccEEEEcccccHcccccccccccccccEEEEcccccccEccccccccHHHHHHccccccccccccccccccccEEEEccccccHHccccccccccccccEEEEEcccHHHHcccccccHHHHHHHHHHHEcccccHHEccccccccccccccccccccccEEEEcccHHHHHHcccccccccccccEEEEcccccHcEccc

MQSYEYSEDFLDWLLSNEEASHLFEKIVghsakksdfeTIGVEIVAKCGGLPIAIKTIANALKNKSPRIWKDAVNqlsnsnprkiqgmdadLSSIELSYEFLKCKEVKSLFQLCgllkdgsriaVDDLLRYVMGLRLLTNADTLEAARNRVHTLIDNLksasllfdgdsedhaKMHRIIHAIAVSIAAEKLLFNIQNVADLKEELdkideaptaisipfrgiyelperlGFLKLKLFLFFTenlslqipdpffegmtELRVLDltgfrfhslpsslgclinlrtlslenclVVDVAIIGDLKKLEILSLKHSSIEQLPREIGQLTclklldlsncsklkeirpnVISNLTRLEElymgnsftqwkvegqsnaslgelkqlsrlttlevhipdaqvmpqdLVFVELERFRICIgdvwswsdgyetsktLKLQLNNSTYLGYGMKMLLKRTEDLHLDELAGFKNVVHELDDEEGFARLRHLHVHNGPEILHILnsdgrvgtfpLLESLFLHNLInlekvcdgkvrlneddksfsNLRIIKVegchrvkhlfpFSLVKNLLQLqkvkvtdctnlklivgkesensahkngsisgvyFRKLHFlklqhlpqltssgfdletptntqgsnpgiiaegdpkdftslfnervvfpslkklklsSINVEKIWLNSFSAIESWGKnltkltvekcgrlkFLFSSSMVNGLEQLQQLDISHCKSMNEVIntrvgrddnmiEMVFPKLVSLQlshlpkltrfgigdsvefpslcqlqiaccpnlkiFICSCteemsseknihttqtqplfdekvglpkleVLRIDGMDNLRKIWHHQLAldsftklkdldVEYCDQLLSIFPSNMLRRLERLEHLAVSECGSIEEIVEIssnctvetapgvVFRQLTSlklhwlprlksfcpgihisgwlvlknldvfecdkfetfss

MQSYEYSEDFLDWLLSNEEASHLFEKIVghsakksdFETIGVEIVAKCGGLPIAIKTIANALKNKSPRIWKDAvnqlsnsnprkiqGMDADLSSIELSYEFLKCKEVKSLFQLCGLLKDGSRIAVDDLLRYVMGLRLLTNADTLEAARNRVHTLIDNLKSASLLFDGDSEDHAKMHRIIHAIAVSIAAEKLLFNIQNVADLKEELDKIdeaptaisipfrgIYELPERLGFLKLKLFLFFTENLSLQIPDPFFEGMTELRVLDLTGFRFHSLPSSLGCLINLRTLSLENCLVVDVAIIGDLKKLEILSLKHSSIEQLPREIGQLTCLKLLDLsncsklkeirpnVISNLTRLEELYMGNSFTQWKVEGQSNASLGELKQLSRLTTLEVHIPDAQVMPQDLVFVELERFRICIGDvwswsdgyetsktlklqlNNSTYLGYGMKMLLKRTEDLHLDELAGFKNVVHELDDEEGFARLRHLHVHNGPEILHILNSDGRVGTFPLLESLFLHNLINLEKVCDGKVRLNEDDKSFSNLRIIKVEGCHRVKHLFPFSLVKNLLQLQKVKVTDCTNLKLivgkesensahkngSISGVYFRKLHFLKLQHLPQLTSSGFDLETPTNTQGSNPGIIAEGDPKDFTSLFNERVVFPSLKKLKLSSINVEKIWLNSFSAIESWGKNLTKLTVEKCGRLKFLFSSSMVNGLEQLQQLDISHCKSMNEVINTRVGRDDNMIEMVFPKLVSLQLSHLPKLTRFGIGDSVEFPSLCQLQIACCPNLKIFICSCTEEMSSEKNIhttqtqplfdekvgLPKLEVLRIDGMDNLRKIWHHQLALDSFTKLKDLDVEYCDQLLSIFPSNMLRRLERLEHLAVSECGSIEEIVEISSNCTVETAPGVVFRQLTSLKLHWLPRLKSFCPGIHISGWLVLKNLDVFECDKFETFSS

MQSYEYSEDFLDWLLSNEEASHLFEKIVGHSAKKSDFETIGVEIVAKCGGLPIAIKTIANALKNKSPRIWKDAVNQLSNSNPRKIQGMDADLSSIELSYEFLKCKEVKSLFQLCGLLKDGSRIAVDDLLRYVMGLRLLTNADTLEAARNRVHTLIDNLKSASLLFDGDSEDHAKMHRIIHAIAVSIAAEKLLFNIQNVADLKEELDKIDEAPTAISIPFRGIYELPERLGflklklflffTENLSLQIPDPFFEGMTELRVLDLTGFRFHSLPSSLGCLINLRTLSLENCLVVDVAIIGDLKKLEILSLKHSSIEQLPREIGQLTCLKLLDLSNCSKLKEIRPNVISNLTRLEELYMGNSFTQWKVEGQSNASLGELKQLSRLTTLEVHIPDAQVMPQDLVFVELERFRICIGDVWSWSDGYETSKTLKLQLNNSTYLGYGMKMLLKRTEDLHLDELAGFKNVVHELDDEEGFARLRHLHVHNGPEILHILNSDGRVGTFPLLESLFLHNLINLEKVCDGKVRLNEDDKSFSNLRIIKVEGCHRVKHLFPFSlvknllqlqkvkvTDCTNLKLIVGKESENSAHKNGSISGVYFRKLHFLKLQHLPQLTSSGFDLETPTNTQGSNPGIIAEGDPKDFTSLFNERVVFPSLKKLKLSSINVEKIWLNSFSAIESWGKNLTKLTVEKCGRLKFLFSSSMVNGLEQLQQLDISHCKSMNEVINTRVGRDDNMIEMVFPKLVSLQLSHLPKLTRFGIGDSVEFPSLCQLQIACCPNLKIFICSCTEEMSSEKNIHTTQTQPLFDEKVGLPKLEVLRIDGMDNLRKIWHHQLALDSFTKLKDLDVEYCDQLLSIFPSNMLRRLERLEHLAVSECGSIEEIVEISSNCTVETAPGVVFRQLTSLKLHWLPRLKSFCPGIHISGWLVLKNLDVFECDKFETFSS

*******EDFLDWLLSNEEASHLFEKIVGHSAKKSDFETIGVEIVAKCGGLPIAIKTIANALKNKSPRIWKDAV****************DLSSIELSYEFLKCKEVKSLFQLCGLLKDGSRIAVDDLLRYVMGLRLLTNADTLEAARNRVHTLIDNLKSASLLFDGDSEDHAKMHRIIHAIAVSIAAEKLLFNIQNVADLKEELDKIDEAPTAISIPFRGIYELPERLGFLKLKLFLFFTENLSLQIPDPFFEGMTELRVLDLTGFRFHSLPSSLGCLINLRTLSLENCLVVDVAIIGDLKKLEILSLKHSSIEQLPREIGQLTCLKLLDLSNCSKLKEIRPNVISNLTRLEELYMGNSFTQWKVEGQSNASLGELKQLSRLTTLEVHIPDAQVMPQDLVFVELERFRICIGDVWSWSDGYETSKTLKLQLNNSTYLGYGMKMLLKRTEDLHLDELAGFKNVVHELDDEEGFARLRHLHVHNGPEILHILNSDGRVGTFPLLESLFLHNLINLEKVCDGKVRLNEDDKSFSNLRIIKVEGCHRVKHLFPFSLVKNLLQLQKVKVTDCTNLKLIVGK*********GSISGVYFRKLHFLKLQHLPQLT**************************DFTSLFNERVVFPSLKKLKLSSINVEKIWLNSFSAIESWGKNLTKLTVEKCGRLKFLFSSSMVNGLEQLQQLDISHCKSMNEVINTRVGRDDNMIEMVFPKLVSLQLSHLPKLTRFGIGDSVEFPSLCQLQIACCPNLKIFICSCTEE********TTQTQPLFDEKVGLPKLEVLRIDGMDNLRKIWHHQLALDSFTKLKDLDVEYCDQLLSIFPSNMLRRLERLEHLAVSECGSIEEIVEISSNCTVETAPGVVFRQLTSLKLHWLPRLKSFCPGIHISGWLVLKNLDVFECDKFE****

****EYSEDFLDWLLSNEEASHLFEKIVGHSAKKSDFETIGVEIVAKCGGLPIAIKTIANALKNKSPRIWKDAVNQLSNSNPR**QG*DADLSSIELSYEFLKCKEVKSLFQLCGLLKDGSRIAVDDLLRYVMGLRLLTNADTLEAARNRVHTLIDNLKSASLLFDGDSEDHAKMHRIIHAIAVSIAAEKLLFNIQNVAD*KEELDKIDEAPTAISIPFRGIYELPERLGFLKLKLFLFFTENLSLQIPDPFFEGMTELRVLDLTGFRFHSLPSSLGCLINLRTLSLENCLVVDVAIIGDLKKLEILSLKHSSIEQLPREIGQLTCLKLLDLSNCSKLKEIRPNVISNLTRLEELYMGNSFTQWKVEGQSNASLGELKQLSRLTTLEVHIPDAQVMPQDLVFVELERFRICIGDVWSWSD*YET**TLKLQLNNSTYLGYGMKMLLKRTEDLHLDELAGFKNVVHELDDEEGFARLRHLHVHNGPEILHILNSDGRVGTFPLLESLFLHNLINLEKVCDGKVRLNEDDKSFSNLRIIKVEGCHRVKHLFPFSLVKNLLQLQKVKVTDCTNLKLIVGKESENSAHKNGSISGVYFRKLHFLKLQHLPQLTSSGFDLETPTNTQGSNPGIIAEGDPKDFTS**N**VVFPSLKKLKLSSINVEKIWLNSFSAIESWGKNLTKLTVEKCGRLKFLFSSSMVNGLEQLQQLDISHCKSMNEVIN**********EMVFPKLVSLQLSHLPKLTRFGIGDSVEFPSLCQLQIACCPNLKIFICSCTEEMSSEKNIHTTQTQPLFDEKVGLPKLEVLRIDGMDNLRKIWHHQL***SFTKLKDLDVEYCDQLLSIFPSNMLRRLERLEHLAVSECGSIEEIVEI**********GVVFRQLTSLKLHWLPRLKSFCPGIHISGWLVLKNLDVFECDKFETFS*

********DFLDWLLSNEEASHLFEKIVGHSAKKSDFETIGVEIVAKCGGLPIAIKTIANALKNKSPRIWKDAVNQLSNSNPRKIQGMDADLSSIELSYEFLKCKEVKSLFQLCGLLKDGSRIAVDDLLRYVMGLRLLTNADTLEAARNRVHTLIDNLKSASLLFDGDSEDHAKMHRIIHAIAVSIAAEKLLFNIQNVADLKEELDKIDEAPTAISIPFRGIYELPERLGFLKLKLFLFFTENLSLQIPDPFFEGMTELRVLDLTGFRFHSLPSSLGCLINLRTLSLENCLVVDVAIIGDLKKLEILSLKHSSIEQLPREIGQLTCLKLLDLSNCSKLKEIRPNVISNLTRLEELYMGNSFTQWKVEGQSNASLGELKQLSRLTTLEVHIPDAQVMPQDLVFVELERFRICIGDVWSWSDGYETSKTLKLQLNNSTYLGYGMKMLLKRTEDLHLDELAGFKNVVHELDDEEGFARLRHLHVHNGPEILHILNSDGRVGTFPLLESLFLHNLINLEKVCDGKVRLNEDDKSFSNLRIIKVEGCHRVKHLFPFSLVKNLLQLQKVKVTDCTNLKLIVGKESENSAHKNGSISGVYFRKLHFLKLQHLPQLTSSGFDLETPTNTQGSNPGIIAEGDPKDFTSLFNERVVFPSLKKLKLSSINVEKIWLNSFSAIESWGKNLTKLTVEKCGRLKFLFSSSMVNGLEQLQQLDISHCKSMNEVINTRVGRDDNMIEMVFPKLVSLQLSHLPKLTRFGIGDSVEFPSLCQLQIACCPNLKIFICSCTEEMSSEKNIHTTQTQPLFDEKVGLPKLEVLRIDGMDNLRKIWHHQLALDSFTKLKDLDVEYCDQLLSIFPSNMLRRLERLEHLAVSECGSIEEIVEISSNCTVETAPGVVFRQLTSLKLHWLPRLKSFCPGIHISGWLVLKNLDVFECDKFETFSS

****EYSEDFLDWLLSNEEASHLFEKIVGHSAKKSDFETIGVEIVAKCGGLPIAIKTIANALKNKSPRIWKDAVNQLSNSNPRKIQGMDADLSSIELSYEFLKCKEVKSLFQLCGLLKDGSRIAVDDLLRYVMGLRLLTNADTLEAARNRVHTLIDNLKSASLLFDGDSEDHAKMHRIIHAIAVSIAAEKLLFNIQNVADLKEELDKIDEAPTAISIPFRGIYELPERLGFLKLKLFLFFTENLSLQIPDPFFEGMTELRVLDLTGFRFHSLPSSLGCLINLRTLSLENCLVVDVAIIGDLKKLEILSLKHSSIEQLPREIGQLTCLKLLDLSNCSKLKEIRPNVISNLTRLEELYMGNSFTQWKVEGQSNASLGELKQLSRLTTLEVHIPDAQVMPQDLVFVELERFRICIGDVWSWSDGYETSKTLKLQLNNSTYLGYGMKMLLKRTEDLHLDELAGFKNVVHELDDEEGFARLRHLHVHNGPEILHILNSDGRVGTFPLLESLFLHNLINLEKVCDGKVRLNEDDKSFSNLRIIKVEGCHRVKHLFPFSLVKNLLQLQKVKVTDCTNLKLIVGKESENSAHKNGSISGVYFRKLHFLKLQHLPQLTSSGFDLETPTNTQGSNPGIIAEGDPKDFTSLFNERVVFPSLKKLKLSSINVEKIWLNSFSAIESWGKNLTKLTVEKCGRLKFLFSSSMVNGLEQLQQLDISHCKSMNEVINTRVGRDDNMIEMVFPKLVSLQLSHLPKLTRFGIGDSVEFPSLCQLQIACCPNLKIFICSCTEEMSSEKNIHTTQTQPLFDEKVGLPKLEVLRIDGMDNLRKIWHHQLALDSFTKLKDLDVEYCDQLLSIFPSNMLRRLERLEHLAVSECGSIEEIVEISSNCTVETAPGVVFRQLTSLKLHWLPRLKSFCPGIHISGWLVLKNLDVFECDKFETF**

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		937	2.2.26 [Sep-21-2011]
O81825		919	Probable disease resistan	yes	no	0.620	0.632	0.283	2e-46
Q9T048		985	Disease resistance protei	no	no	0.609	0.579	0.262	5e-41
Q42484		909	Disease resistance protei	no	no	0.543	0.559	0.263	6e-31
Q9LVT4		843	Probable disease resistan	no	no	0.341	0.379	0.296	9e-22
Q9C8T9		898	Putative disease resistan	no	no	0.388	0.405	0.264	7e-19
Q9FLB4		874	Putative disease resistan	no	no	0.381	0.408	0.261	4e-18
Q7XBQ9		970	Disease resistance protei	N/A	no	0.548	0.529	0.246	8e-17
Q9SI85		893	Probable disease resistan	no	no	0.554	0.582	0.227	1e-15
Q8RXS5		888	Probable disease resistan	no	no	0.331	0.350	0.280	6e-15
Q7XA42		979	Putative disease resistan	N/A	no	0.383	0.366	0.273	7e-15

>sp\|O81825\|DRL28_ARATH Probable disease resistance protein At4g27220 OS=Arabidopsis thaliana GN=At4g27220 PE=2 SV=1	Back alignment and function desciption

 Score =  188 bits (477), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 174/614 (28%), Positives = 282/614 (45%), Gaps = 33/614 (5%)

Query: 15  LSNEEASHLFEKIVGHSAKKSDFETIGVEIVAKCGGLPIAIKTIANALKNKSP-RIWKDA 73
           L  +EA  LF   VG  A   + + I  ++  +C GLP+AI TI   L+ K    +WK  
Sbjct: 272 LQEKEAWELFCHNVGEVANSDNVKPIAKDVSHECCGLPLAIITIGRTLRGKPQVEVWKHT 331

Query: 74  VNQLSNSNPRKIQGMDADLSSIELSYEFLKCKEVKSLFQLCGLLKDGSRIAVDDLLRYVM 133
           +N L  S P  I   +    +++LSY+FL+   +KS F  C L  +   I V +L+ Y +
Sbjct: 332 LNLLKRSAP-SIDTEEKIFGTLKLSYDFLQ-DNMKSCFLFCALFPEDYSIKVSELIMYWV 389

Query: 134 GLRLLTNADTLEAARNRVHTLIDNLKSASLLFDGDSEDHAKMHRIIHAIAVSIAAEK--- 190
              LL      E   N   TL++ LK + LL DGDS D  KMH ++   A+   + +   
Sbjct: 390 AEGLLDGQHHYEDMMNEGVTLVERLKDSCLLEDGDSCDTVKMHDVVRDFAIWFMSSQGEG 449

Query: 191 ---LLFNIQNVADLKEELDKIDEAPTAISIPFRGIYELPERL--GFLKLKLFLFFTENLS 245
              L+   + + +  +  DK   +   +S+    +  LP  +  G   L L L    ++ 
Sbjct: 450 FHSLVMAGRGLIEFPQ--DKFVSSVQRVSLMANKLERLPNNVIEGVETLVLLLQGNSHVK 507

Query: 246 LQIPDPFFEGMTELRVLDLTGFRFHSLPSSLGCLINLRTLSLENC-LVVDVAIIGDLKKL 304
            ++P+ F +    LR+LDL+G R  +LP S   L +LR+L L NC  + ++  +  L KL
Sbjct: 508 -EVPNGFLQAFPNLRILDLSGVRIRTLPDSFSNLHSLRSLVLRNCKKLRNLPSLESLVKL 566

Query: 305 EILSLKHSSIEQLPREIGQLTCLKLLDLSNCSKLKEIRPNVISNLTRLEELYMGNSFTQW 364
           + L L  S+I +LPR +  L+ L+ + +SN  +L+ I    I  L+ LE L M  S   W
Sbjct: 567 QFLDLHESAIRELPRGLEALSSLRYICVSNTYQLQSIPAGTILQLSSLEVLDMAGSAYSW 626

Query: 365 KVEG---QSNASLGELKQLSRLTTLEVHIPDAQVMPQ--DLVFVELERFRICIGDVWSWS 419
            ++G   +  A+L E+  L  L  L + + D        D +   L +F+     + S S
Sbjct: 627 GIKGEEREGQATLDEVTCLPHLQFLAIKLLDVLSFSYEFDSLTKRLTKFQFLFSPIRSVS 686

Query: 420 DGYETSKTLKLQLNNSTYLGYGMKMLLKRTEDLHLDELAGFKNVVHEL--DDEEGFARLR 477
                   L +   N +    G   LL+    L L+   G   +   L    +  F  ++
Sbjct: 687 PPGTGEGCLAISDVNVSNASIG--WLLQHVTSLDLNYCEGLNGMFENLVTKSKSSFVAMK 744

Query: 478 HLHVHNGPEILHILNSDGRVGTFPLLESLFLHNLINLEKVCDGKVRLNEDDKSFSNLRII 537
            L +H  P +      + ++  FP LE L L N +NLE + +    L         L+++
Sbjct: 745 ALSIHYFPSLSLASGCESQLDLFPNLEELSLDN-VNLESIGELNGFLG---MRLQKLKLL 800

Query: 538 KVEGCHRVKHLFPFSLVKNLL-QLQKVKVTDCTNLKLIVGKESENSAHKNGSISGVYFRK 596
           +V GC ++K LF   ++   L  LQ++KV  C  L+ +    S        S+      K
Sbjct: 801 QVSGCRQLKRLFSDQILAGTLPNLQEIKVVSCLRLEELFNFSSVPVDFCAESL----LPK 856

Query: 597 LHFLKLQHLPQLTS 610
           L  +KL++LPQL S
Sbjct: 857 LTVIKLKYLPQLRS 870

Probable disease resistance protein.
Arabidopsis thaliana (taxid: 3702)

>sp\|Q9T048\|DRL27_ARATH Disease resistance protein At4g27190 OS=Arabidopsis thaliana GN=At4g27190 PE=2 SV=1	Back alignment and function description

>sp\|Q42484\|RPS2_ARATH Disease resistance protein RPS2 OS=Arabidopsis thaliana GN=RPS2 PE=1 SV=1	Back alignment and function description

>sp\|Q9LVT4\|DRL37_ARATH Probable disease resistance protein At5g47250 OS=Arabidopsis thaliana GN=At5g47250 PE=2 SV=1	Back alignment and function description

>sp\|Q9C8T9\|DRL19_ARATH Putative disease resistance protein At1g63350 OS=Arabidopsis thaliana GN=At1g63350 PE=2 SV=1	Back alignment and function description

>sp\|Q9FLB4\|DRL31_ARATH Putative disease resistance protein At5g05400 OS=Arabidopsis thaliana GN=At5g05400 PE=2 SV=1	Back alignment and function description

>sp\|Q7XBQ9\|RGA2_SOLBU Disease resistance protein RGA2 OS=Solanum bulbocastanum GN=RGA2 PE=1 SV=1	Back alignment and function description

>sp\|Q9SI85\|DRL14_ARATH Probable disease resistance protein At1g62630 OS=Arabidopsis thaliana GN=At1g62630 PE=3 SV=2	Back alignment and function description

>sp\|Q8RXS5\|DRL40_ARATH Probable disease resistance protein At5g63020 OS=Arabidopsis thaliana GN=At5g63020 PE=2 SV=2	Back alignment and function description

>sp\|Q7XA42\|RGA1_SOLBU Putative disease resistance protein RGA1 OS=Solanum bulbocastanum GN=RGA1 PE=2 SV=2	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		937
224111296		1315	cc-nbs-lrr resistance protein [Populus t	0.944	0.673	0.451	0.0
255563252		1603	Disease resistance protein RPS5, putativ	0.928	0.542	0.457	0.0
224111284		1340	cc-nbs-lrr resistance protein [Populus t	0.941	0.658	0.446	0.0
224143316		1337	cc-nbs-lrr resistance protein [Populus t	0.959	0.672	0.434	0.0
296087872		1152	unnamed protein product [Vitis vinifera]	0.951	0.774	0.406	1e-175
255542484		2460	phosphoprotein phosphatase, putative [Ri	0.939	0.357	0.421	1e-169
359488101		1677	PREDICTED: disease resistance protein At	0.944	0.527	0.409	1e-165
359488095		1347	PREDICTED: probable disease resistance p	0.918	0.639	0.401	1e-163
147865073		1694	hypothetical protein VITISV_021876 [Viti	0.919	0.508	0.403	1e-162
359488103		1530	PREDICTED: disease resistance protein At	0.916	0.561	0.399	1e-160

>gi\|224111296\|ref\|XP_002332952.1\| cc-nbs-lrr resistance protein [Populus trichocarpa] gi\|222834264\|gb\|EEE72741.1\| cc-nbs-lrr resistance protein [Populus trichocarpa]	Back alignment and taxonomy information

 Score =  689 bits (1779), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 418/925 (45%), Positives = 564/925 (60%), Gaps = 40/925 (4%)

Query: 7    SEDFLDWLLSNEEASHLFEKIVGHSAKKSDFETIGVEIVAKCGGLPIAIKTIANALKNKS 66
            + +F   +L   EA +LFEK+VG + KK     +  E+  +C GLPI + T+A ALKNK 
Sbjct: 295  NRNFPIQVLPASEAWNLFEKMVGVAVKKHSVRLVAAEVARRCAGLPILLATVARALKNKD 354

Query: 67   PRIWKDAVNQLSNSNPRKIQGMDADLSSIELSYEFLKCKEVKSLFQLCGLLKDGSRIAVD 126
               WK A+ QL+  +   I   D     +ELSY+ L+  E+KSLF LCG L+  + I + 
Sbjct: 355  LYAWKKALKQLTRFDKDDID--DQVYLGLELSYKSLRGDEIKSLFLLCGQLRSNN-ILIS 411

Query: 127  DLLRYVMGLRLLTNADTLEAARNRVHTLIDNLKSASLLFDGDSEDHAKMHRIIHAIAVSI 186
            DLLRY +GL L     TLE  RN + TL+D LK++ LL +GD +   KMH ++H+ A+S+
Sbjct: 412  DLLRYGIGLDLFKGCSTLEETRNSLLTLVDELKASCLLLEGDKDGSVKMHDVVHSFAISV 471

Query: 187  AAEKLLFNIQNVADLKEELDKID--EAPTAISIPFRGIYELPERLGFLKLKLFLFFTENL 244
            A      ++  VAD  +E    D  +  TAIS+PFR I +LP  L    L  FL   ++ 
Sbjct: 472  ALRD--HHVLTVADEFKEWPANDVLQQYTAISLPFRKIPDLPAILECPNLNSFLLLNKDP 529

Query: 245  SLQIPDPFFEGMTELRVLDLTGFRFHSLPSSLGCLINLRTLSLENCLVVDVAIIGDLKKL 304
            SLQIPD FF  M EL++LDLT      LPSSL  L NL+TL L++C++ D++IIG+L KL
Sbjct: 530  SLQIPDSFFREMKELKILDLTEVNLSPLPSSLQFLENLQTLCLDHCVLEDISIIGELNKL 589

Query: 305  EILSLKHSSIEQLPREIGQLTCLKLLDLSNCSKLKEIRPNVISNLTRLEELYMGNSFTQW 364
            ++LSL  S+I +LPREIG++T L+LLDLSNC +L+ I PN +S+LTRLE+LYMGNSF +W
Sbjct: 590  KVLSLMSSNIVRLPREIGKVTRLQLLDLSNCERLEVISPNALSSLTRLEDLYMGNSFVKW 649

Query: 365  KVEGQS----NASLGELKQLSRLTTLEVHIPDAQVMPQDLV--FVELERFRICIGDVWSW 418
            + EG S    NA L ELK LS L+TL + I DA  MP+DL   F  LERFRI IGD W W
Sbjct: 650  ETEGSSSQRNNACLSELKHLSNLSTLHMQITDADNMPKDLFSSFQNLERFRIFIGDGWDW 709

Query: 419  SDGYETSKTLKLQLNNSTYLGYGMKMLLKRTEDLHLDELAGFKNVVHELDDEEGFARLRH 478
            S    TS+TLKL+LN    L  G+  LLK TE+LHL EL G K+++++LD  EGF +LRH
Sbjct: 710  SVKDATSRTLKLKLNTVIQLEEGVNTLLKITEELHLQELNGVKSILNDLDG-EGFPQLRH 768

Query: 479  LHVHNGPEILHILNS--DGRVGTFPLLESLFLHNLINLEKVCDGKVRLNEDDKSFSNLRI 536
            LHV N P + +I+NS   G    F  L+SLFL NL NLEK+C G++      +S  NLRI
Sbjct: 769  LHVQNCPGVQYIINSIRMGPRTAFLNLDSLFLENLDNLEKICHGQLMA----ESLGNLRI 824

Query: 537  IKVEGCHRVKHLFPFSLVKNLLQLQKVKVTDCTNLKLIVGKESENSAHKNGSISGVYFRK 596
            +KVE CHR+K+LF  S+ + L++L+++ + DC  ++ +V +ESEN A     I  + F +
Sbjct: 825  LKVESCHRLKNLFSVSMARRLVRLEEITIIDCKIMEEVVAEESENDAADGEPI--IEFTQ 882

Query: 597  LHFLKLQHLPQLTSSGFDLETPTNTQGSNPGIIAEGDPKDFT---------SLFNERVVF 647
            L  L LQ LPQ TS   ++E  +++Q     + +E   K+           SLFN +++F
Sbjct: 883  LRRLTLQCLPQFTSFHSNVEESSDSQRRQKLLASEARSKEIVAGNELGTSMSLFNTKILF 942

Query: 648  PSLKKLKLSSINVEKIWLNSFSAIESWGKNLTKLTVEKCGRLKFLFSSSMVNGLEQLQQL 707
            P+L+ LKLSSI VEKIW +  S      KNL  + VE C  L +L +SSMV  L QL++L
Sbjct: 943  PNLEDLKLSSIKVEKIWHDQPSVQSPCVKNLASIAVENCRNLNYLLTSSMVESLAQLKKL 1002

Query: 708  DISHCKSMNE-VINTRVGRDDNMIEMVFPKLVSLQLSHLPKLTRFGIGDSVEFPSLCQLQ 766
            +I +CKSM E V+   +G    M +M+FPKL+ L L  LPKLTRF   + +E  SL  L 
Sbjct: 1003 EICNCKSMEEIVVPEDIGEGKMMSKMLFPKLLILSLIRLPKLTRFCTSNLLECHSLKVLT 1062

Query: 767  IACCPNLKIFI----CSCTEEMSSEKNIHTTQTQPLFDEKVGLPKLEVLRIDGMDNLRKI 822
            +  CP LK FI     +    MS   N  +     LFD+KV  P LE   I  MDNL+ I
Sbjct: 1063 VGNCPELKEFISIPSSADVPAMSKPDNTKSA----LFDDKVAFPDLEEFLIAEMDNLKVI 1118

Query: 823  WHHQLALDSFTKLKDLDVEYCDQLLSIFPSNMLRRLERLEHLAVSECGSIEEIVEISSNC 882
            WH +L  DSF KLK L V     LL+IFPS+MLRR   LE+L +  C S+EEI ++    
Sbjct: 1119 WHSELHSDSFCKLKTLHVVLVKNLLNIFPSSMLRRFHNLENLTIGACDSVEEIFDLQELI 1178

Query: 883  TVETAPGVVFRQLTSLKLHWLPRLK 907
             VE    V   QL  ++L  LP LK
Sbjct: 1179 NVEQRLAVTASQLRVVRLTNLPHLK 1203

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|255563252\|ref\|XP_002522629.1\| Disease resistance protein RPS5, putative [Ricinus communis] gi\|223538105\|gb\|EEF39716.1\| Disease resistance protein RPS5, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|224111284\|ref\|XP_002332949.1\| cc-nbs-lrr resistance protein [Populus trichocarpa] gi\|222834261\|gb\|EEE72738.1\| cc-nbs-lrr resistance protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|224143316\|ref\|XP_002336027.1\| cc-nbs-lrr resistance protein [Populus trichocarpa] gi\|222838884\|gb\|EEE77235.1\| cc-nbs-lrr resistance protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|296087872\|emb\|CBI35155.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|255542484\|ref\|XP_002512305.1\| phosphoprotein phosphatase, putative [Ricinus communis] gi\|223548266\|gb\|EEF49757.1\| phosphoprotein phosphatase, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|359488101\|ref\|XP_002263761.2\| PREDICTED: disease resistance protein At4g27190-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|359488095\|ref\|XP_002270726.2\| PREDICTED: probable disease resistance protein At4g27220-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|147865073\|emb\|CAN83232.1\| hypothetical protein VITISV_021876 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|359488103\|ref\|XP_002263579.2\| PREDICTED: disease resistance protein At4g27190-like [Vitis vinifera]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		937
TAIR\|locus:2131689		919	AT4G27220 [Arabidopsis thalian	0.623	0.635	0.273	4e-43
TAIR\|locus:2136447		985	AT4G27190 [Arabidopsis thalian	0.620	0.589	0.261	6.7e-39
TAIR\|locus:2005517		909	RPS2 "RESISTANT TO P. SYRINGAE	0.390	0.402	0.279	5.6e-30
TAIR\|locus:2031366		898	AT1G63350 "AT1G63350" [Arabido	0.355	0.370	0.284	8.5e-24
TAIR\|locus:2171579		843	AT5G47250 [Arabidopsis thalian	0.339	0.377	0.291	9.9e-23
TAIR\|locus:2166320		888	AT5G63020 [Arabidopsis thalian	0.418	0.441	0.259	5.9e-20
TAIR\|locus:2132741		892	AT4G10780 [Arabidopsis thalian	0.358	0.376	0.273	1.2e-19
TAIR\|locus:2008440		899	AT1G61180 [Arabidopsis thalian	0.358	0.373	0.261	1.4e-19
TAIR\|locus:2171589		948	AT5G47260 [Arabidopsis thalian	0.403	0.398	0.253	6e-19
TAIR\|locus:2031356		884	AT1G63360 [Arabidopsis thalian	0.390	0.414	0.261	1.1e-17

TAIR\|locus:2131689 AT4G27220 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 490 (177.5 bits), Expect = 4.0e-43, Sum P(2) = 4.0e-43
 Identities = 167/611 (27%), Positives = 271/611 (44%)

Query:    15 LSNEEASHLFEKIVGHSAKKSDFETIGVEIVAKCGGLPIAIKTIANALKNKSP-RIWKDA 73
             L  +EA  LF   VG  A   + + I  ++  +C GLP+AI TI   L+ K    +WK  
Sbjct:   272 LQEKEAWELFCHNVGEVANSDNVKPIAKDVSHECCGLPLAIITIGRTLRGKPQVEVWKHT 331

Query:    74 VNQLSNSNPRKIQGMDADLSSIELSYEFLKCKEVKSLFQLCGLLKDGSRIAVDDLLRYVM 133
             +N L  S P  I   +    +++LSY+FL+   +KS F  C L  +   I V +L+ Y +
Sbjct:   332 LNLLKRSAP-SIDTEEKIFGTLKLSYDFLQ-DNMKSCFLFCALFPEDYSIKVSELIMYWV 389

Query:   134 GLRLLTNADTLEAARNRVHTLIDNLKSASLLFDGDSEDHAKMHRIIHAIAV-SIAAEKLL 192
                LL      E   N   TL++ LK + LL DGDS D  KMH ++   A+  ++++   
Sbjct:   390 AEGLLDGQHHYEDMMNEGVTLVERLKDSCLLEDGDSCDTVKMHDVVRDFAIWFMSSQGEG 449

Query:   193 FNIQNVAD---LKEELDKIDEAPTAISIPFRGIYELPERLGXXXXXXXXXXTENLSL-QI 248
             F+   +A    ++   DK   +   +S+    +  LP  +             N  + ++
Sbjct:   450 FHSLVMAGRGLIEFPQDKFVSSVQRVSLMANKLERLPNNVIEGVETLVLLLQGNSHVKEV 509

Query:   249 PDPFFEGMTELRVLDLTGFRFHSLPSSLGCLINLRTLSLENCLVV-DVAIIGDLKKLEIL 307
             P+ F +    LR+LDL+G R  +LP S   L +LR+L L NC  + ++  +  L KL+ L
Sbjct:   510 PNGFLQAFPNLRILDLSGVRIRTLPDSFSNLHSLRSLVLRNCKKLRNLPSLESLVKLQFL 569

Query:   308 SLKHSSIEQLPREIGQLTCLKLLDLSNCSKLKEIRPNVISNLTRLEELYMGNSFTQWKVE 367
              L  S+I +LPR +  L+ L+ + +SN  +L+ I    I  L+ LE L M  S   W ++
Sbjct:   570 DLHESAIRELPRGLEALSSLRYICVSNTYQLQSIPAGTILQLSSLEVLDMAGSAYSWGIK 629

Query:   368 GQSN---ASLGELKQLSRLTTLEVHIPDAQVMPQ--DLVFVELERFRICIGDVWSWSDGY 422
             G+     A+L E+  L  L  L + + D        D +   L +F+     + S S   
Sbjct:   630 GEEREGQATLDEVTCLPHLQFLAIKLLDVLSFSYEFDSLTKRLTKFQFLFSPIRSVSPPG 689

Query:   423 ETSKTLKLQLNNSTYLGYGMKMLLKRTEDLHLDELAGFKNVVHEL--DDEEGFARLRHLH 480
                  L +   N +    G   LL+    L L+   G   +   L    +  F  ++ L 
Sbjct:   690 TGEGCLAISDVNVSNASIGW--LLQHVTSLDLNYCEGLNGMFENLVTKSKSSFVAMKALS 747

Query:   481 VHNGPEILHILNSDGRVGTFPLLESLFLHNLINLEKVCDGKVRLNEDDKSFSNLRIIKVE 540
             +H  P +      + ++  FP LE L L N +NLE + +    L         L++++V 
Sbjct:   748 IHYFPSLSLASGCESQLDLFPNLEELSLDN-VNLESIGELNGFLG---MRLQKLKLLQVS 803

Query:   541 GCHRVKHLFPFSXXXXXX-XXXXXXXTDCTNLKLIVGKESENSAHKNGSISGVYFRKLHF 599
             GC ++K LF                   C  L+ +    S        S+      KL  
Sbjct:   804 GCRQLKRLFSDQILAGTLPNLQEIKVVSCLRLEELFNFSSVPVDFCAESL----LPKLTV 859

Query:   600 LKLQHLPQLTS 610
             +KL++LPQL S
Sbjct:   860 IKLKYLPQLRS 870

GO:0005634 "nucleus" evidence=ISM

GO:0006952 "defense response" evidence=IEA;ISS

GO:0043531 "ADP binding" evidence=IEA

TAIR\|locus:2136447 AT4G27190 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2005517 RPS2 "RESISTANT TO P. SYRINGAE 2" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2031366 AT1G63350 "AT1G63350" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2171579 AT5G47250 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2166320 AT5G63020 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2132741 AT4G10780 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2008440 AT1G61180 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2171589 AT5G47260 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2031356 AT1G63360 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	eugene3.03110007	cc-nbs-lrr resistance protein (1315 aa)
		(Populus trichocarpa)
Predicted Functional Partners:
		Sorry, there are no predicted associations at the current settings.

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		937
pfam00931		285	pfam00931, NB-ARC, NB-ARC domain	5e-14
PLN03210		1153	PLN03210, PLN03210, Resistant to P	5e-06
PLN00113		968	PLN00113, PLN00113, leucine-rich repeat receptor-l	6e-05
PLN00113		968	PLN00113, PLN00113, leucine-rich repeat receptor-l	1e-04
pfam13855		60	pfam13855, LRR_8, Leucine rich repeat	0.001

>gnl\|CDD\|216202 pfam00931, NB-ARC, NB-ARC domain	Back alignment and domain information

 Score = 73.1 bits (180), Expect = 5e-14
 Identities = 36/129 (27%), Positives = 57/129 (44%), Gaps = 5/129 (3%)

Query: 14  LLSNEEASHLFEKIVGH--SAKKSDFETIGVEIVAKCGGLPIAIKTIANALKNKS-PRIW 70
            L  EE+  LF   V         + E +  EIV KC GLP+A+K +   L  KS  + W
Sbjct: 155 SLEPEESWELFSNKVFEKELPPCPELEEVAKEIVEKCKGLPLALKVLGGLLAFKSTVQEW 214

Query: 71  KDAVNQLSNSNPRKIQGMDADLSSIELSYEFLKCKEVKSLFQLCGLLKDGSRIAVDDLLR 130
           +  + QL+N       G++  LS + LSY+ L    +K  F    L  +   I  + L++
Sbjct: 215 EHVLEQLNNE-LAGRDGLNEVLSILSLSYDNLP-MHLKRCFLYLALFPEDYNIRKEQLIK 272

Query: 131 YVMGLRLLT 139
             +    + 
Sbjct: 273 LWIAEGFVI 281

Length = 285

>gnl\|CDD\|215633 PLN03210, PLN03210, Resistant to P	Back alignment and domain information

>gnl\|CDD\|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|206026 pfam13855, LRR_8, Leucine rich repeat	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		937
KOG4658		889	consensus Apoptotic ATPase [Signal transduction me	100.0
PLN03210		1153	Resistant to P. syringae 6; Provisional	100.0
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	100.0
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	100.0
PLN03210		1153	Resistant to P. syringae 6; Provisional	99.88
KOG4194		873	consensus Membrane glycoprotein LIG-1 [Signal tran	99.85
KOG0618		1081	consensus Serine/threonine phosphatase 2C containi	99.83
KOG0472		565	consensus Leucine-rich repeat protein [Function un	99.83
KOG0444		1255	consensus Cytoskeletal regulator Flightless-I (con	99.82
KOG4194		873	consensus Membrane glycoprotein LIG-1 [Signal tran	99.82
KOG0444		1255	consensus Cytoskeletal regulator Flightless-I (con	99.8
PF00931		287	NB-ARC: NB-ARC domain; InterPro: IPR002182 This is	99.78
KOG0472		565	consensus Leucine-rich repeat protein [Function un	99.75
KOG0618		1081	consensus Serine/threonine phosphatase 2C containi	99.73
KOG0617		264	consensus Ras suppressor protein (contains leucine	99.52
KOG0617		264	consensus Ras suppressor protein (contains leucine	99.52
PRK15387		788	E3 ubiquitin-protein ligase SspH2; Provisional	99.42
KOG4237		498	consensus Extracellular matrix protein slit, conta	99.4
KOG4341		483	consensus F-box protein containing LRR [General fu	99.37
KOG4341		483	consensus F-box protein containing LRR [General fu	99.36
PRK15370		754	E3 ubiquitin-protein ligase SlrP; Provisional	99.34
PRK15387		788	E3 ubiquitin-protein ligase SspH2; Provisional	99.33
PRK15370		754	E3 ubiquitin-protein ligase SlrP; Provisional	99.33
KOG4658		889	consensus Apoptotic ATPase [Signal transduction me	99.32
KOG4237		498	consensus Extracellular matrix protein slit, conta	99.11
PF14580		175	LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ	98.98
KOG0532		722	consensus Leucine-rich repeat (LRR) protein, conta	98.94
PF14580		175	LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ	98.89
cd00116		319	LRR_RI Leucine-rich repeats (LRRs), ribonuclease i	98.83
cd00116		319	LRR_RI Leucine-rich repeats (LRRs), ribonuclease i	98.83
KOG1259		490	consensus Nischarin, modulator of integrin alpha5	98.79
KOG1259		490	consensus Nischarin, modulator of integrin alpha5	98.72
KOG0532		722	consensus Leucine-rich repeat (LRR) protein, conta	98.69
PRK15386		426	type III secretion protein GogB; Provisional	98.56
COG4886		394	Leucine-rich repeat (LRR) protein [Function unknow	98.47
COG4886		394	Leucine-rich repeat (LRR) protein [Function unknow	98.45
KOG3207		505	consensus Beta-tubulin folding cofactor E [Posttra	98.4
PRK15386		426	type III secretion protein GogB; Provisional	98.34
PF13855		61	LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF	98.32
PF13855		61	LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF	98.27
PLN03150		623	hypothetical protein; Provisional	98.25
KOG3207		505	consensus Beta-tubulin folding cofactor E [Posttra	98.16
PLN03150		623	hypothetical protein; Provisional	98.14
KOG2120		419	consensus SCF ubiquitin ligase, Skp2 component [Po	98.12
PF12799		44	LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_	98.05
KOG1859		1096	consensus Leucine-rich repeat proteins [General fu	98.03
KOG2120		419	consensus SCF ubiquitin ligase, Skp2 component [Po	97.98
KOG0531		414	consensus Protein phosphatase 1, regulatory subuni	97.84
KOG1947		482	consensus Leucine rich repeat proteins, some prote	97.8
KOG0531		414	consensus Protein phosphatase 1, regulatory subuni	97.8
KOG1947		482	consensus Leucine rich repeat proteins, some prote	97.8
KOG3665		699	consensus ZYG-1-like serine/threonine protein kina	97.77
KOG3665		699	consensus ZYG-1-like serine/threonine protein kina	97.75
PF12799		44	LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_	97.68
KOG1909		382	consensus Ran GTPase-activating protein [RNA proce	97.55
KOG1859		1096	consensus Leucine-rich repeat proteins [General fu	97.47
KOG1909		382	consensus Ran GTPase-activating protein [RNA proce	97.4
KOG1644		233	consensus U2-associated snRNP A' protein [RNA proc	97.31
KOG2982		418	consensus Uncharacterized conserved protein [Funct	97.22
KOG1644		233	consensus U2-associated snRNP A' protein [RNA proc	97.12
KOG4579		177	consensus Leucine-rich repeat (LRR) protein associ	96.95
KOG4579		177	consensus Leucine-rich repeat (LRR) protein associ	96.8
KOG2982		418	consensus Uncharacterized conserved protein [Funct	96.38
KOG2739		260	consensus Leucine-rich acidic nuclear protein [Cel	96.33
KOG2123		388	consensus Uncharacterized conserved protein [Funct	96.23
COG5238		388	RNA1 Ran GTPase-activating protein (RanGAP) involv	96.04
PF00560		22	LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le	95.59
KOG2739		260	consensus Leucine-rich acidic nuclear protein [Cel	95.55
PF13306		129	LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_	95.5
PF00560		22	LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le	95.5
KOG2123		388	consensus Uncharacterized conserved protein [Funct	95.46
KOG3864		221	consensus Uncharacterized conserved protein [Funct	95.16
KOG3864		221	consensus Uncharacterized conserved protein [Funct	94.84
PF13306		129	LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_	94.58
COG5238		388	RNA1 Ran GTPase-activating protein (RanGAP) involv	93.89
PF13504		17	LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO	93.63
PF13504		17	LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO	93.36
KOG0473		326	consensus Leucine-rich repeat protein [Function un	89.7
smart00370		26	LRR Leucine-rich repeats, outliers.	87.99
smart00369		26	LRR_TYP Leucine-rich repeats, typical (most popula	87.99
KOG0473		326	consensus Leucine-rich repeat protein [Function un	86.55
smart00370		26	LRR Leucine-rich repeats, outliers.	83.7
smart00369		26	LRR_TYP Leucine-rich repeats, typical (most popula	83.7
TIGR03015		269	pepcterm_ATPase putative secretion ATPase, PEP-CTE	81.89
PRK04841		903	transcriptional regulator MalT; Provisional	80.99
smart00367		26	LRR_CC Leucine-rich repeat - CC (cysteine-containi	80.94

>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms]	Back alignment and domain information

Probab=100.00  E-value=8.5e-58  Score=531.18  Aligned_cols=476  Identities=26%  Similarity=0.380  Sum_probs=344.7

Q ss_pred             cCCCCCcccCCCCCHHHHHHHHHHHhCCC--CCCCchhHHHHHHHHhcCCCchHHHHHHHHhcCC-ChhHHHHHHHHhhc
Q 002313            3 SYEYSEDFLDWLLSNEEASHLFEKIVGHS--AKKSDFETIGVEIVAKCGGLPIAIKTIANALKNK-SPRIWKDAVNQLSN   79 (937)
Q Consensus         3 ~~~~~~~~~l~~L~~~~~~~lf~~~~~~~--~~~~~~~~i~~~i~~kc~GlPLai~~ig~~L~~~-~~~~W~~~l~~l~~   79 (937)
                      +|++.+.+++++|+++|||+||+++||..  ..++.+.++|++||+||+|+|||+++||+.|+.| +.++|+++.+.+.+
T Consensus       305 ~m~~~~~~~v~~L~~~eaW~LF~~~v~~~~~~~~~~i~~lak~v~~kC~GLPLAl~viG~~ma~K~t~~eW~~~~~~l~s  384 (889)
T KOG4658|consen  305 AMGVDYPIEVECLTPEEAWDLFQKKVGPNTLGSHPDIEELAKEVAEKCGGLPLALNVLGGLLACKKTVQEWRRALNVLKS  384 (889)
T ss_pred             cccCCccccccccCccccHHHHHHhhccccccccccHHHHHHHHHHHhCChHHHHHHHHHHhcCCCcHHHHHHHHccccc
Confidence            48899999999999999999999999654  3456699999999999999999999999999999 88899999999998


Q ss_pred             CCCCCccccccc-cccccccccccCchhHHHHHHHhcCCCCCCcccHHHHHHHHhhcccccCcchHHHHHHHHHHHHHHH
Q 002313           80 SNPRKIQGMDAD-LSSIELSYEFLKCKEVKSLFQLCGLLKDGSRIAVDDLLRYVMGLRLLTNADTLEAARNRVHTLIDNL  158 (937)
Q Consensus        80 ~~~~~~~~~~~~-~~~l~~sY~~L~~~~lk~cfl~~~~fp~~~~i~~~~li~~w~a~g~~~~~~~~~~~~~~~~~~~~~L  158 (937)
                      +...+..++++. +++|++|||+||.+ +|.||+|||+||+||+|++++||.+|+||||++.....+.+++.+++|+.+|
T Consensus       385 ~~~~~~~~~~~~i~~iLklSyd~L~~~-lK~CFLycalFPED~~I~~e~Li~yWiaEGfi~~~~~~~~~~d~G~~~i~~L  463 (889)
T KOG4658|consen  385 SLAADFSGMEESILPILKLSYDNLPEE-LKSCFLYCALFPEDYEIKKEKLIEYWIAEGFIDPLDGGETAEDVGYDYIEEL  463 (889)
T ss_pred             cccCCCCchhhhhHHhhhccHhhhhHH-HHHHHHhhccCCcccccchHHHHHHHHhccCcCccccccchhcchHHHHHHH
Confidence            866666666666 99999999999965 9999999999999999999999999999999988676788899999999999


Q ss_pred             hhcccccccC---CCCceeeehhhHHHHHHHHh-----hccEEEecccCcchhhhh-hccCCCcEEEccCCCCccCCccc
Q 002313          159 KSASLLFDGD---SEDHAKMHRIIHAIAVSIAA-----EKLLFNIQNVADLKEELD-KIDEAPTAISIPFRGIYELPERL  229 (937)
Q Consensus       159 ~~~~~~~~~~---~~~~~~mhd~i~~la~~~~~-----~e~~~~~~~~~~~~~~~~-~~~~~l~~l~l~~~~~~~l~~~~  229 (937)
                      +++++++..+   +..+|+|||+||++|.++++     ++. ..+..+......|. ......|++++.++.+..++...
T Consensus       464 V~~~Ll~~~~~~~~~~~~kmHDvvRe~al~ias~~~~~~e~-~iv~~~~~~~~~~~~~~~~~~rr~s~~~~~~~~~~~~~  542 (889)
T KOG4658|consen  464 VRASLLIEERDEGRKETVKMHDVVREMALWIASDFGKQEEN-QIVSDGVGLSEIPQVKSWNSVRRMSLMNNKIEHIAGSS  542 (889)
T ss_pred             HHHHHHhhcccccceeEEEeeHHHHHHHHHHhccccccccc-eEEECCcCccccccccchhheeEEEEeccchhhccCCC
Confidence            9999998764   45789999999999999999     555 33443333333444 44568999999999999999998


Q ss_pred             CCCccceeeecCCcc-cccCChhhhcCCCCccEEEecCCc-CcccCccccCCCCCCEEEccCCcccCcccccCCCCCcEE
Q 002313          230 GFLKLKLFLFFTENL-SLQIPDPFFEGMTELRVLDLTGFR-FHSLPSSLGCLINLRTLSLENCLVVDVAIIGDLKKLEIL  307 (937)
Q Consensus       230 ~~~~L~~L~l~~~~~-~~~~~~~~~~~l~~Lr~L~L~~~~-~~~lp~~i~~l~~Lr~L~L~~~~~~~l~~i~~L~~L~~L  307 (937)
                      ..++|++|.+.++.. ...++..+|..+++||||||++|. +.++|..|+.|.|||||+++++.                
T Consensus       543 ~~~~L~tLll~~n~~~l~~is~~ff~~m~~LrVLDLs~~~~l~~LP~~I~~Li~LryL~L~~t~----------------  606 (889)
T KOG4658|consen  543 ENPKLRTLLLQRNSDWLLEISGEFFRSLPLLRVLDLSGNSSLSKLPSSIGELVHLRYLDLSDTG----------------  606 (889)
T ss_pred             CCCccceEEEeecchhhhhcCHHHHhhCcceEEEECCCCCccCcCChHHhhhhhhhcccccCCC----------------
Confidence            888999999999873 667888889999999999999875 57889888887777777777665                


Q ss_pred             ecccCcCcccCcccccCccCCEEEecCCCCCcccChhhhcCCCCCcEEEcCCCcccceecCCCCCChhhhcCCCCCCeEE
Q 002313          308 SLKHSSIEQLPREIGQLTCLKLLDLSNCSKLKEIRPNVISNLTRLEELYMGNSFTQWKVEGQSNASLGELKQLSRLTTLE  387 (937)
Q Consensus       308 ~L~~~~l~~lp~~i~~L~~L~~L~l~~~~~l~~lp~~~l~~L~~L~~L~l~~~~~~~~~~~~~~~~~~~l~~l~~L~~L~  387 (937)
                            ++.+|.++++|..|.+|++..+..+..+| +++..|.+||+|.+.....     .......+++.++++|+.+.
T Consensus       607 ------I~~LP~~l~~Lk~L~~Lnl~~~~~l~~~~-~i~~~L~~Lr~L~l~~s~~-----~~~~~~l~el~~Le~L~~ls  674 (889)
T KOG4658|consen  607 ------ISHLPSGLGNLKKLIYLNLEVTGRLESIP-GILLELQSLRVLRLPRSAL-----SNDKLLLKELENLEHLENLS  674 (889)
T ss_pred             ------ccccchHHHHHHhhheecccccccccccc-chhhhcccccEEEeecccc-----ccchhhHHhhhcccchhhhe
Confidence                  55666666666666666666655444443 3245566666666543321     11133445555666666555


Q ss_pred             eecCCCCCCCccccccccceeEEEecCcCCCCCCcCCcceEEEecccccchhhhHHHHhhcccccccccccChhhhhhcc
Q 002313          388 VHIPDAQVMPQDLVFVELERFRICIGDVWSWSDGYETSKTLKLQLNNSTYLGYGMKMLLKRTEDLHLDELAGFKNVVHEL  467 (937)
Q Consensus       388 l~~~~~~~~~~~~~~~~L~~l~l~~~~~~~~~~~~~~~~~l~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~l  467 (937)
                      ................+                                        .....+.+.+.+ .........+
T Consensus       675 ~~~~s~~~~e~l~~~~~----------------------------------------L~~~~~~l~~~~-~~~~~~~~~~  713 (889)
T KOG4658|consen  675 ITISSVLLLEDLLGMTR----------------------------------------LRSLLQSLSIEG-CSKRTLISSL  713 (889)
T ss_pred             eecchhHhHhhhhhhHH----------------------------------------HHHHhHhhhhcc-cccceeeccc
Confidence            53322200000000111                                        111112222222 1111222333


Q ss_pred             cchhhcccCcEEEeecCCceEEEEccC--Ccccc-ccccceecccccccccccccccccCCCCCccCCCccEEEEecCCC
Q 002313          468 DDEEGFARLRHLHVHNGPEILHILNSD--GRVGT-FPLLESLFLHNLINLEKVCDGKVRLNEDDKSFSNLRIIKVEGCHR  544 (937)
Q Consensus       468 ~~~~~~~~L~~L~l~~~~~~~~~~~~~--~~~~~-~p~L~~L~l~~~~~l~~~~~~~~~~~~~~~~l~~L~~L~l~~C~~  544 (937)
                      ..   +.+|+.|.+.+|...+......  ..... ||++..+.+.+|..++......        ..|+|+.|++.+|+.
T Consensus       714 ~~---l~~L~~L~i~~~~~~e~~~~~~~~~~~~~~f~~l~~~~~~~~~~~r~l~~~~--------f~~~L~~l~l~~~~~  782 (889)
T KOG4658|consen  714 GS---LGNLEELSILDCGISEIVIEWEESLIVLLCFPNLSKVSILNCHMLRDLTWLL--------FAPHLTSLSLVSCRL  782 (889)
T ss_pred             cc---ccCcceEEEEcCCCchhhcccccccchhhhHHHHHHHHhhccccccccchhh--------ccCcccEEEEecccc
Confidence            33   8889999999887654321111  11123 7788888888887777653333        348888999988888


Q ss_pred             cccccchhHHHhhccccE
Q 002313          545 VKHLFPFSLVKNLLQLQK  562 (937)
Q Consensus       545 L~~l~~~~~~~~l~~L~~  562 (937)
                      ++++.+  ....+..+++
T Consensus       783 ~e~~i~--~~k~~~~l~~  798 (889)
T KOG4658|consen  783 LEDIIP--KLKALLELKE  798 (889)
T ss_pred             cccCCC--HHHHhhhccc
Confidence            887654  3334444443

>PLN03210 Resistant to P	Back alignment and domain information

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>PLN03210 Resistant to P	Back alignment and domain information

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms]	Back alignment and domain information

>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms]	Back alignment and domain information

>KOG0472 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton]	Back alignment and domain information

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms]	Back alignment and domain information

>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton]	Back alignment and domain information

>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals []	Back alignment and domain information

>KOG0472 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms]	Back alignment and domain information

>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms]	Back alignment and domain information

>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms]	Back alignment and domain information

>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms]	Back alignment and domain information

>KOG4341 consensus F-box protein containing LRR [General function prediction only]	Back alignment and domain information

>KOG4341 consensus F-box protein containing LRR [General function prediction only]	Back alignment and domain information

>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms]	Back alignment and domain information

>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms]	Back alignment and domain information

>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A	Back alignment and domain information

>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton]	Back alignment and domain information

>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A	Back alignment and domain information

>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton]	Back alignment and domain information

>PRK15386 type III secretion protein GogB; Provisional	Back alignment and domain information

>COG4886 Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>COG4886 Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK15386 type III secretion protein GogB; Provisional	Back alignment and domain information

>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A	Back alignment and domain information

>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A	Back alignment and domain information

>PLN03150 hypothetical protein; Provisional	Back alignment and domain information

>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PLN03150 hypothetical protein; Provisional	Back alignment and domain information

>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B	Back alignment and domain information

>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only]	Back alignment and domain information

>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms]	Back alignment and domain information

>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only]	Back alignment and domain information

>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms]	Back alignment and domain information

>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only]	Back alignment and domain information

>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only]	Back alignment and domain information

>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only]	Back alignment and domain information

>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B	Back alignment and domain information

>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms]	Back alignment and domain information

>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only]	Back alignment and domain information

>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms]	Back alignment and domain information

>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification]	Back alignment and domain information

>KOG2982 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification]	Back alignment and domain information

>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only]	Back alignment and domain information

>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only]	Back alignment and domain information

>KOG2982 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>KOG2123 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification]	Back alignment and domain information

>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape []	Back alignment and domain information

>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A	Back alignment and domain information

>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape []	Back alignment and domain information

>KOG2123 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG3864 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG3864 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A	Back alignment and domain information

>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification]	Back alignment and domain information

>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D	Back alignment and domain information

>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D	Back alignment and domain information

>KOG0473 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>smart00370 LRR Leucine-rich repeats, outliers	Back alignment and domain information

>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily	Back alignment and domain information

>KOG0473 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>smart00370 LRR Leucine-rich repeats, outliers	Back alignment and domain information

>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily	Back alignment and domain information

>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily	Back alignment and domain information

>PRK04841 transcriptional regulator MalT; Provisional	Back alignment and domain information

>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		937
2a5y_B		549	CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis	1e-21
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	2e-20
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	3e-20
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	3e-18
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	6e-11
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	3e-07
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	2e-19
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	1e-18
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	4e-16
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	2e-14
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	4e-16
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	1e-15
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	1e-12
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	1e-10
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	4e-10
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	4e-09
1z6t_A		591	APAF-1, apoptotic protease activating factor 1; ca	8e-16
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	1e-15
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	6e-13
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	2e-12
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	2e-12
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	1e-08
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	2e-08
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	6e-04
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	2e-15
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	4e-15
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	2e-09
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	8e-08
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	1e-14
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	2e-13
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	6e-10
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	9e-10
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	1e-09
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	4e-08
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	2e-14
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	3e-11
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	2e-09
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	5e-14
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	8e-10
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	3e-04
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	4e-04
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	5e-14
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	5e-13
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	6e-14
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	3e-12
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	2e-08
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	2e-13
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	1e-10
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	2e-10
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	9e-08
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	5e-06
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	2e-13
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	3e-04
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	2e-13
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	6e-11
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	6e-05
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	2e-13
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	8e-13
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	2e-11
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	3e-11
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	6e-08
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	5e-07
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	4e-13
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	7e-09
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	1e-04
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	5e-13
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	5e-13
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	7e-13
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	6e-12
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	2e-11
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	2e-09
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	5e-04
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	6e-13
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	2e-12
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	5e-12
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	5e-11
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	1e-09
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	3e-09
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	2e-08
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	4e-05
1o6v_A		466	Internalin A; bacterial infection, extracellular r	1e-12
1o6v_A		466	Internalin A; bacterial infection, extracellular r	1e-12
1o6v_A		466	Internalin A; bacterial infection, extracellular r	1e-12
1o6v_A		466	Internalin A; bacterial infection, extracellular r	1e-11
1o6v_A		466	Internalin A; bacterial infection, extracellular r	2e-11
1o6v_A		466	Internalin A; bacterial infection, extracellular r	6e-11
1o6v_A		466	Internalin A; bacterial infection, extracellular r	1e-10
1o6v_A		466	Internalin A; bacterial infection, extracellular r	6e-08
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	1e-12
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	1e-10
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	1e-09
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	4e-07
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	3e-12
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	4e-10
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	1e-09
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	2e-05
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	4e-12
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	7e-10
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	3e-09
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	2e-06
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	6e-12
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	6e-10
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	4e-09
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	7e-12
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	5e-11
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	1e-10
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	6e-10
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	9e-12
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	4e-11
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	1e-08
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	7e-04
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	1e-11
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	4e-09
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	2e-11
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	2e-11
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	1e-10
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	1e-10
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	8e-10
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	3e-09
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	1e-08
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	4e-08
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	5e-05
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	2e-11
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	1e-08
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	3e-08
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	4e-07
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	6e-05
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	4e-11
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	3e-10
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	3e-08
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	5e-06
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	5e-11
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	3e-09
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	6e-09
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	1e-10
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	3e-10
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	5e-10
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	1e-07
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	3e-10
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	3e-06
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	3e-10
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	4e-09
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	1e-08
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	2e-07
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	6e-07
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	7e-06
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	7e-10
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	3e-09
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	4e-09
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	2e-09
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	7e-09
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	2e-07
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	4e-07
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	2e-09
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	9e-06
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	2e-09
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	6e-08
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	2e-07
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	5e-05
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	3e-09
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	4e-06
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	1e-05
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	6e-09
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	1e-07
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	2e-07
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	1e-08
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	1e-06
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	4e-06
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	7e-06
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	2e-08
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	4e-08
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	5e-05
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	5e-08
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	5e-08
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	5e-07
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	1e-07
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	4e-06
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	2e-07
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	5e-06
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	2e-07
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	7e-06
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	2e-05
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	2e-07
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	2e-05
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	3e-07
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	2e-05
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	2e-04
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	3e-04
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	3e-07
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	3e-07
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	1e-06
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	1e-06
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	3e-05
3m19_A		251	Variable lymphocyte receptor A diversity region; a	2e-06
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	3e-06
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	8e-05
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	5e-04
3sfz_A		1249	APAF-1, apoptotic peptidase activating factor 1; a	3e-06
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	4e-06
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	6e-06
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	4e-05
3e6j_A		229	Variable lymphocyte receptor diversity region; var	7e-05
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	1e-04
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	2e-04
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	5e-04
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	6e-04

>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549	Back alignment and structure

 Score = 99.3 bits (247), Expect = 1e-21
 Identities = 26/187 (13%), Positives = 54/187 (28%), Gaps = 11/187 (5%)

Query: 15  LSNEEASHLFEKIVGHSAKKSDFETIGVEIVAKCGGLPIAIKTIANALKNKSPRIWKDAV 74
           L  +E     E            E +  + +    G P  +     + + K+        
Sbjct: 293 LEIDECYDFLEAYGMPMPVGEKEEDVLNKTIELSSGNPATLMMFFKSCEPKTFEKMAQLN 352

Query: 75  NQLSNSNPRKIQGMDAD-----LSSIELSYEFLKCKEVKSLFQLCGLLKDGSRIAVDDLL 129
           N+L +     ++ +          +++   E L   E +S      ++  G  I V    
Sbjct: 353 NKLESRGLVGVECITPYSYKSLAMALQRCVEVLSD-EDRSALAFAVVMPPGVDIPVKLWS 411

Query: 130 RYVMGLRLLTNADTLEAARNRVHTLIDNLKSASLLFDGD--SEDHAKMHRIIHAIAVSIA 187
             +         + L+   + V   +  L     L  G        K+  IIH     + 
Sbjct: 412 CVIPVDICSNEEEQLD---DEVADRLKRLSKRGALLSGKRMPVLTFKIDHIIHMFLKHVV 468

Query: 188 AEKLLFN 194
             + + N
Sbjct: 469 DAQTIAN 475

PyMOL of 2a5y

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		937
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	100.0
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	100.0
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	100.0
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	100.0
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	100.0
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	100.0
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	100.0
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	100.0
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	99.97
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	99.97
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	99.97
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	99.97
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	99.97
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	99.96
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	99.95
4g8a_A		635	TOLL-like receptor 4; leucine rich repeat MD-2 rel	99.95
4g8a_A		635	TOLL-like receptor 4; leucine rich repeat MD-2 rel	99.95
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	99.95
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	99.95
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	99.95
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	99.94
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	99.94
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	99.94
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	99.92
1o6v_A		466	Internalin A; bacterial infection, extracellular r	99.92
1o6v_A		466	Internalin A; bacterial infection, extracellular r	99.92
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	99.91
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	99.91
2a5y_B		549	CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis	99.9
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	99.9
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	99.9
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	99.9
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	99.9
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	99.89
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	99.89
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	99.88
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	99.88
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	99.88
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	99.87
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	99.87
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	99.85
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	99.83
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	99.82
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	99.82
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	99.81
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	99.81
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	99.81
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	99.8
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	99.79
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	99.79
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	99.79
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	99.78
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	99.78
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	99.77
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	99.77
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	99.76
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	99.75
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	99.75
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	99.74
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	99.74
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	99.74
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	99.73
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	99.72
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	99.71
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	99.71
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	99.7
3sfz_A		1249	APAF-1, apoptotic peptidase activating factor 1; a	99.7
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	99.69
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	99.69
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	99.69
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	99.68
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	99.68
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	99.68
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	99.67
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	99.67
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	99.65
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	99.64
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	99.64
3m19_A		251	Variable lymphocyte receptor A diversity region; a	99.64
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	99.64
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	99.62
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	99.62
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	99.61
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	99.61
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	99.61
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	99.61
3m19_A		251	Variable lymphocyte receptor A diversity region; a	99.6
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	99.59
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	99.58
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	99.56
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	99.56
3e6j_A		229	Variable lymphocyte receptor diversity region; var	99.55
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	99.55
1z6t_A		591	APAF-1, apoptotic protease activating factor 1; ca	99.54
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	99.54
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	99.53
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	99.53
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	99.53
4glp_A		310	Monocyte differentiation antigen CD14; alpha beta	99.52
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	99.52
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	99.51
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	99.51
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	99.51
4glp_A		310	Monocyte differentiation antigen CD14; alpha beta	99.49
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	99.48
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	99.48
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	99.48
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	99.46
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	99.46
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	99.45
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	99.44
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.44
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	99.43
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	99.43
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	99.42
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	99.41
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	99.41
3e6j_A		229	Variable lymphocyte receptor diversity region; var	99.41
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	99.39
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	99.36
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.35
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.35
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.35
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	99.33
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	99.31
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	99.3
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	99.3
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	99.29
4b8c_D		727	Glucose-repressible alcohol dehydrogenase transcr	99.27
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	99.26
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	99.25
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	99.24
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	99.21
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	99.17
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	99.15
4b8c_D		727	Glucose-repressible alcohol dehydrogenase transcr	99.14
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	99.13
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	99.1
2r9u_A		174	Variable lymphocyte receptor; adaptive immunity, V	99.08
3g39_A		170	Variable lymphocyte receptor VLRB.2D; antibody, X-	99.07
2r9u_A		174	Variable lymphocyte receptor; adaptive immunity, V	98.98
3g39_A		170	Variable lymphocyte receptor VLRB.2D; antibody, X-	98.92
3sb4_A		329	Hypothetical leucine rich repeat protein; LRR, rig	98.88
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	98.65
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	98.62
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	98.58
3sb4_A		329	Hypothetical leucine rich repeat protein; LRR, rig	98.5
4fdw_A		401	Leucine rich hypothetical protein; putative cell s	98.48
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	98.44
4fdw_A		401	Leucine rich hypothetical protein; putative cell s	98.32
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	98.27
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	98.23
4fs7_A		394	Uncharacterized protein; leucine-rich repeats, pro	98.15
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	97.97
4fs7_A		394	Uncharacterized protein; leucine-rich repeats, pro	97.93
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	97.76
1io0_A		185	Tropomodulin; LRR protein, right-handed super-heli	97.75
3rw6_A		267	Nuclear RNA export factor 1; retroviral constituti	97.6
3rw6_A		267	Nuclear RNA export factor 1; retroviral constituti	97.59
1io0_A		185	Tropomodulin; LRR protein, right-handed super-heli	97.53
4gt6_A		394	Cell surface protein; leucine rich repeats, putati	97.49
4gt6_A		394	Cell surface protein; leucine rich repeats, putati	97.35
4h09_A		379	Hypothetical leucine rich repeat protein; two LRR_	94.96
3rfe_A		130	Platelet glycoprotein IB beta chain; platelet surf	93.86
4h09_A		379	Hypothetical leucine rich repeat protein; two LRR_	93.83
3rfe_A		130	Platelet glycoprotein IB beta chain; platelet surf	93.61
1pgv_A		197	TMD-1, tropomodulin TMD-1; structural genomics, PS	92.97
1pgv_A		197	TMD-1, tropomodulin TMD-1; structural genomics, PS	90.09
1w5s_A		412	Origin recognition complex subunit 2 ORC2; replica	89.64

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A*	Back alignment and structure

Probab=100.00  E-value=8.7e-36  Score=359.69  Aligned_cols=624  Identities=13%  Similarity=0.009  Sum_probs=358.0

Q ss_pred             cCCCcEEEccCCCCccCCccc-CCCccceeeecCCcccccCCh--hhhcCCCCccEEEecCCcCc-ccCccc-cCCCCCC
Q 002313          209 DEAPTAISIPFRGIYELPERL-GFLKLKLFLFFTENLSLQIPD--PFFEGMTELRVLDLTGFRFH-SLPSSL-GCLINLR  283 (937)
Q Consensus       209 ~~~l~~l~l~~~~~~~l~~~~-~~~~L~~L~l~~~~~~~~~~~--~~~~~l~~Lr~L~L~~~~~~-~lp~~i-~~l~~Lr  283 (937)
                      ++.++.++.+.+.+..++..+ .+++|++|++++|.+.+.+|.  . ++++++|++|++++|.+. ..|..+ .++++|+
T Consensus        76 L~~L~~l~~~~~~~~~l~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~-l~~l~~L~~L~Ls~n~l~~~~~~~~~~~l~~L~  154 (768)
T 3rgz_A           76 LTGLESLFLSNSHINGSVSGFKCSASLTSLDLSRNSLSGPVTTLTS-LGSCSGLKFLNVSSNTLDFPGKVSGGLKLNSLE  154 (768)
T ss_dssp             CTTCCEEECTTSCEEECCCCCCCCTTCCEEECCSSEEEEEGGGGGG-GGGCTTCCEEECCSSEEECCSSCCSCCCCTTCS
T ss_pred             cCcccccCCcCCCcCCCchhhccCCCCCEEECCCCcCCCcCCChHH-HhCCCCCCEEECcCCccCCcCCHHHhccCCCCC
Confidence            456677777766665555555 577788888887777666665  4 577788888888887765 345444 6777888


Q ss_pred             EEEccCCcccCc--cc---ccCCCCCcEEecccCcCcccCcccccCccCCEEEecCCCCCcccChhhhcCCCCCcEEEcC
Q 002313          284 TLSLENCLVVDV--AI---IGDLKKLEILSLKHSSIEQLPREIGQLTCLKLLDLSNCSKLKEIRPNVISNLTRLEELYMG  358 (937)
Q Consensus       284 ~L~L~~~~~~~l--~~---i~~L~~L~~L~L~~~~l~~lp~~i~~L~~L~~L~l~~~~~l~~lp~~~l~~L~~L~~L~l~  358 (937)
                      +|++++|.+...  ..   ++++++|++|++++|.+....+ ++++++|++|++++|. +...++. ++++++|++|+++
T Consensus       155 ~L~Ls~n~l~~~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~-~~~l~~L~~L~Ls~n~-l~~~~~~-l~~l~~L~~L~Ls  231 (768)
T 3rgz_A          155 VLDLSANSISGANVVGWVLSDGCGELKHLAISGNKISGDVD-VSRCVNLEFLDVSSNN-FSTGIPF-LGDCSALQHLDIS  231 (768)
T ss_dssp             EEECCSSCCEEETHHHHHHTTCCTTCCEEECCSSEEESCCB-CTTCTTCCEEECCSSC-CCSCCCB-CTTCCSCCEEECC
T ss_pred             EEECCCCccCCcCChhhhhhccCCCCCEEECCCCcccccCC-cccCCcCCEEECcCCc-CCCCCcc-cccCCCCCEEECc
Confidence            888888777644  22   6777788888888777665443 3777788888887755 3333333 7777888888887


Q ss_pred             CCcccceecCCCCCChhhhcCCCCCCeEEeecCCCCCCCccccccccceeEEEecC----cCCCCCCc-CCcceEEEecc
Q 002313          359 NSFTQWKVEGQSNASLGELKQLSRLTTLEVHIPDAQVMPQDLVFVELERFRICIGD----VWSWSDGY-ETSKTLKLQLN  433 (937)
Q Consensus       359 ~~~~~~~~~~~~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~~~~~L~~l~l~~~~----~~~~~~~~-~~~~~l~l~~~  433 (937)
                      +|.+.       ...+..+..+++|+.|+++++...........++|+.|.+..+.    .+.+.... ..++.+++..+
T Consensus       232 ~n~l~-------~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~~l~~L~~L~L~~n~l~~~ip~~~~~~~~~L~~L~Ls~n  304 (768)
T 3rgz_A          232 GNKLS-------GDFSRAISTCTELKLLNISSNQFVGPIPPLPLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGN  304 (768)
T ss_dssp             SSCCC-------SCHHHHTTTCSSCCEEECCSSCCEESCCCCCCTTCCEEECCSSEEEESCCCCSCTTCTTCSEEECCSS
T ss_pred             CCcCC-------CcccHHHhcCCCCCEEECCCCcccCccCccccCCCCEEECcCCccCCccCHHHHhhcCcCCEEECcCC
Confidence            77554       23456677777788888877766543333356677777665432    23333332 56777777665


Q ss_pred             cccchhhhHHHHhhcccccccccccChhhhhhc-ccchhhcccCcEEEeecCCceEEEEccCCcccccc-ccceeccccc
Q 002313          434 NSTYLGYGMKMLLKRTEDLHLDELAGFKNVVHE-LDDEEGFARLRHLHVHNGPEILHILNSDGRVGTFP-LLESLFLHNL  511 (937)
Q Consensus       434 ~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~-l~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~p-~L~~L~l~~~  511 (937)
                      ............+++|+.|++.++.....++.. +..   +++|++|+++++.-...+   +.....++ +|++|+++++
T Consensus       305 ~l~~~~p~~~~~l~~L~~L~L~~n~l~~~ip~~~l~~---l~~L~~L~Ls~n~l~~~~---p~~l~~l~~~L~~L~Ls~N  378 (768)
T 3rgz_A          305 HFYGAVPPFFGSCSLLESLALSSNNFSGELPMDTLLK---MRGLKVLDLSFNEFSGEL---PESLTNLSASLLTLDLSSN  378 (768)
T ss_dssp             EEEECCCGGGGGCTTCCEEECCSSEEEEECCHHHHTT---CTTCCEEECCSSEEEECC---CTTHHHHTTTCSEEECCSS
T ss_pred             cCCCccchHHhcCCCccEEECCCCcccCcCCHHHHhc---CCCCCEEeCcCCccCccc---cHHHHhhhcCCcEEEccCC
Confidence            443333333345677888888775443222222 333   778888888877432222   22223444 7888888876


Q ss_pred             ccccccccccccCCCCCccCCCccEEEEecCCCcccccchhHHHhhccccEEEEcccccchhhhccccccccccCCcccc
Q 002313          512 INLEKVCDGKVRLNEDDKSFSNLRIIKVEGCHRVKHLFPFSLVKNLLQLQKVKVTDCTNLKLIVGKESENSAHKNGSISG  591 (937)
Q Consensus       512 ~~l~~~~~~~~~~~~~~~~l~~L~~L~l~~C~~L~~l~~~~~~~~l~~L~~L~i~~c~~l~~~~~~~~~~~~~~~~~i~~  591 (937)
                      . +...    .+.......+++|++|++.+|.-...+|  ..+..+++|++|++++|.--..++.             ..
T Consensus       379 ~-l~~~----~~~~~~~~~~~~L~~L~L~~n~l~~~~p--~~l~~l~~L~~L~Ls~N~l~~~~p~-------------~l  438 (768)
T 3rgz_A          379 N-FSGP----ILPNLCQNPKNTLQELYLQNNGFTGKIP--PTLSNCSELVSLHLSFNYLSGTIPS-------------SL  438 (768)
T ss_dssp             E-EEEE----CCTTTTCSTTCCCCEEECCSSEEEEECC--GGGGGCTTCCEEECCSSEEESCCCG-------------GG
T ss_pred             C-cCCC----cChhhhhcccCCccEEECCCCccccccC--HHHhcCCCCCEEECcCCcccCcccH-------------HH
Confidence            3 2211    1100011226778888888865333444  3466788888888888653322221             11


Q ss_pred             ccccccceeeccCCCCccccccCCCCCcccCCCCCCccccCCCCCccccccccccCCCcceeeccCcccceeccCCcccc
Q 002313          592 VYFRKLHFLKLQHLPQLTSSGFDLETPTNTQGSNPGIIAEGDPKDFTSLFNERVVFPSLKKLKLSSINVEKIWLNSFSAI  671 (937)
Q Consensus       592 ~~~~~L~~L~l~~c~~L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~~L~l~~c~l~~~~~~~~~~~  671 (937)
                      ..+++|+.|++.++..-..++..                             ...+++|+.|++++|.++......    
T Consensus       439 ~~l~~L~~L~L~~n~l~~~~p~~-----------------------------~~~l~~L~~L~L~~N~l~~~~p~~----  485 (768)
T 3rgz_A          439 GSLSKLRDLKLWLNMLEGEIPQE-----------------------------LMYVKTLETLILDFNDLTGEIPSG----  485 (768)
T ss_dssp             GGCTTCCEEECCSSCCCSCCCGG-----------------------------GGGCTTCCEEECCSSCCCSCCCGG----
T ss_pred             hcCCCCCEEECCCCcccCcCCHH-----------------------------HcCCCCceEEEecCCcccCcCCHH----
Confidence            26778888888877543333322                             234677888888888666332111    


Q ss_pred             cccCCCccEEEEeccCCccccchHHHHhhccccceeeeccccchHHHhccCCCCCCCcccccccccceeeeccCcccccc
Q 002313          672 ESWGKNLTKLTVEKCGRLKFLFSSSMVNGLEQLQQLDISHCKSMNEVINTRVGRDDNMIEMVFPKLVSLQLSHLPKLTRF  751 (937)
Q Consensus       672 ~~~l~~L~~L~i~~c~~l~~l~~~~~~~~l~~L~~L~i~~c~~l~~~~~~~~~~~~~~~~~~~~~L~~L~i~~c~~l~~~  751 (937)
                      ...+++|+.|++++|.....++  ..+..+++|+.|++++|.-...++..         ...+++|+.|++++++-...+
T Consensus       486 l~~l~~L~~L~L~~N~l~~~~p--~~~~~l~~L~~L~L~~N~l~~~~p~~---------l~~l~~L~~L~Ls~N~l~g~i  554 (768)
T 3rgz_A          486 LSNCTNLNWISLSNNRLTGEIP--KWIGRLENLAILKLSNNSFSGNIPAE---------LGDCRSLIWLDLNTNLFNGTI  554 (768)
T ss_dssp             GGGCTTCCEEECCSSCCCSCCC--GGGGGCTTCCEEECCSSCCEEECCGG---------GGGCTTCCEEECCSSEEESBC
T ss_pred             HhcCCCCCEEEccCCccCCcCC--hHHhcCCCCCEEECCCCcccCcCCHH---------HcCCCCCCEEECCCCccCCcC
Confidence            2356778888888775443332  24667778888888777543333321         224677788888777544444


Q ss_pred             cccCCCCcccccceeeccCCCceeeccc------------------ccccc---cccc--ccCccCcCc-cccccccCCC
Q 002313          752 GIGDSVEFPSLCQLQIACCPNLKIFICS------------------CTEEM---SSEK--NIHTTQTQP-LFDEKVGLPK  807 (937)
Q Consensus       752 ~~~~~~~l~~L~~L~i~~C~~l~~~~~~------------------~~~~~---~~~~--~~~~~~~~~-l~~~~~~l~~  807 (937)
                      |...+ ....+..+.+.....+......                  .....   ....  ......+.+ +......+++
T Consensus       555 p~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~~~~~g~~~~~~~~l~~  633 (768)
T 3rgz_A          555 PAAMF-KQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGS  633 (768)
T ss_dssp             CGGGG-TTTTCBCCSTTCSCEEEEEECCSCCTTCCSSEEEEECTTCCGGGGGGGGGTCCSCTTSCEEEEECCCSCSSSBC
T ss_pred             ChHHh-cccchhhhhccccccccccccccccccccccccccccccccchhhhccccccccccccceecccCchhhhcccc
Confidence            44322 1222222222211111100000                  00000   0000  000000000 0112245678


Q ss_pred             ccEEEecCCCCcceeccCCCCcccCCCCcEEEEEcCCCcccccchhHHHhcCCCcEEeecccccceeeecccCcccccCC
Q 002313          808 LEVLRIDGMDNLRKIWHHQLALDSFTKLKDLDVEYCDQLLSIFPSNMLRRLERLEHLAVSECGSIEEIVEISSNCTVETA  887 (937)
Q Consensus       808 L~~L~l~~c~~l~~l~~~~~~~~~l~~L~~L~i~~C~~L~~~~p~~~l~~l~~L~~L~i~~C~~l~~l~~~~~~~~~~~~  887 (937)
                      |+.|+++++.--..+|..   ++.+++|+.|+++++. ++..+|.. ++.+++|+.|+++++.--..+|..         
T Consensus       634 L~~LdLs~N~l~g~ip~~---l~~l~~L~~L~Ls~N~-l~g~ip~~-l~~L~~L~~LdLs~N~l~g~ip~~---------  699 (768)
T 3rgz_A          634 MMFLDMSYNMLSGYIPKE---IGSMPYLFILNLGHND-ISGSIPDE-VGDLRGLNILDLSSNKLDGRIPQA---------  699 (768)
T ss_dssp             CCEEECCSSCCBSCCCGG---GGGCTTCCEEECCSSC-CCSCCCGG-GGGCTTCCEEECCSSCCEECCCGG---------
T ss_pred             ccEEECcCCcccccCCHH---HhccccCCEEeCcCCc-cCCCCChH-HhCCCCCCEEECCCCcccCcCChH---------
Confidence            888888887322244432   4567888888887764 44335653 578888888888886544345431         


Q ss_pred             CceeecccCcccccccccccccCCCCCcccCCccCeEEEecCCCc
Q 002313          888 PGVVFRQLTSLKLHWLPRLKSFCPGIHISGWLVLKNLDVFECDKF  932 (937)
Q Consensus       888 ~~~~~~sL~~L~i~~c~~L~~l~~~~~~~~~~~L~~L~i~~C~~l  932 (937)
                       ...+++|++|++++++--..+|.+.+   +.++....+.|+|.|
T Consensus       700 -l~~l~~L~~L~ls~N~l~g~iP~~~~---~~~~~~~~~~gN~~L  740 (768)
T 3rgz_A          700 -MSALTMLTEIDLSNNNLSGPIPEMGQ---FETFPPAKFLNNPGL  740 (768)
T ss_dssp             -GGGCCCCSEEECCSSEEEEECCSSSS---GGGSCGGGGCSCTEE
T ss_pred             -HhCCCCCCEEECcCCcccccCCCchh---hccCCHHHhcCCchh
Confidence             22467788888888764455565543   345555556666654

PyMOL of 3rgz

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A*	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A*	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A*	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A*	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A*	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A*	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A*	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens}	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens}	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens}	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A*	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens}	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A*	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens}	Back alignment and structure

>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A*	Back alignment and structure

>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A*	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens}	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron}	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697}	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697}	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron}	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus}	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus}	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A*	Back alignment and structure

>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A*	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae}	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes}	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B}	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A*	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens}	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B}	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes}	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae}	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens}	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV}	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B*	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A*	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus}	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B*	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A*	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV}	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B*	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens}	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B*	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A*	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus}	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens}	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri}	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens}	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium}	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium}	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens}	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri}	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A*	Back alignment and structure

>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A*	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri}	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A*	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri}	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae}	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C*	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A*	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus}	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A*	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae}	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus}	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C*	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus}	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens}	Back alignment and structure

>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens}	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C*	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C*	Back alignment and structure

>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens}	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes}	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes}	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes}	Back alignment and structure

>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens}	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri}	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri}	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus}	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes}	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus}	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A}	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A}	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens}	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus}	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp}	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens}	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7	Back alignment and structure

>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp}	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens}	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri}	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri}	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A	Back alignment and structure

>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus}	Back alignment and structure

>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D	Back alignment and structure

>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus}	Back alignment and structure

>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D	Back alignment and structure

>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron}	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens}	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7	Back alignment and structure

>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron}	Back alignment and structure

>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens}	Back alignment and structure

>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A	Back alignment and structure

>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus}	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis}	Back alignment and structure

>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus}	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis}	Back alignment and structure

>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1	Back alignment and structure

>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A	Back alignment and structure

>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A	Back alignment and structure

>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1	Back alignment and structure

>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165}	Back alignment and structure

>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165}	Back alignment and structure

>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum}	Back alignment and structure

>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A*	Back alignment and structure

>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum}	Back alignment and structure

>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A*	Back alignment and structure

>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1	Back alignment and structure

>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1	Back alignment and structure

>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A*	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		937
d2a5yb3		277	c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenor	2e-09
d2omza2		384	c.10.2.1 (A:33-416) Internalin A {Listeria monocyt	1e-08
d2omza2		384	c.10.2.1 (A:33-416) Internalin A {Listeria monocyt	9e-05
d1jl5a_		353	c.10.2.6 (A:) Leucine rich effector protein YopM {	6e-06
d1jl5a_		353	c.10.2.6 (A:) Leucine rich effector protein YopM {	6e-05
d1dcea3		124	c.10.2.2 (A:444-567) Rab geranylgeranyltransferase	1e-05
d1a9na_		162	c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom	7e-05
d2astb2		284	c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1	4e-04
d1z7xw1		460	c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (	6e-04
d1koha1		162	c.10.2.3 (A:201-362) mRNA export factor tap {Human	0.001
d1m9la_		198	c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree	0.002
d1xwdc1		242	c.10.2.7 (C:18-259) Follicle-stimulating hormone r	0.002
d2ifga3		156	c.10.2.7 (A:36-191) High affinity nerve growth fac	0.003

>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Length = 277	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]

 Score = 57.5 bits (138), Expect = 2e-09
 Identities = 12/88 (13%), Positives = 25/88 (28%), Gaps = 6/88 (6%)

Query: 15  LSNEEASHLFEKIVGHSAKKSDFETIGVEIVAKCGGLPIAIKTIANALKNKSPRIWKDAV 74
           L  +E     E            E +  + +    G P  +     + + K+        
Sbjct: 185 LEIDECYDFLEAYGMPMPVGEKEEDVLNKTIELSSGNPATLMMFFKSCEPKTFEKMAQLN 244

Query: 75  NQLSNSNPRKIQGMDADLSSIELSYEFL 102
           N+L +     ++           SY+ L
Sbjct: 245 NKLESRGLVGVE------CITPYSYKSL 266

PyMOL of d2a5yb3

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		937
d2omza2		384	Internalin A {Listeria monocytogenes [TaxId: 1639]	99.78
d2omza2		384	Internalin A {Listeria monocytogenes [TaxId: 1639]	99.76
d1xkua_		305	Decorin {Cow (Bos taurus) [TaxId: 9913]}	99.67
d1p9ag_		266	von Willebrand factor binding domain of glycoprote	99.64
d2a5yb3		277	CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI	99.63
d1p9ag_		266	von Willebrand factor binding domain of glycoprote	99.62
d1ogqa_		313	Polygalacturonase inhibiting protein PGIP {Kidney	99.61
d1xkua_		305	Decorin {Cow (Bos taurus) [TaxId: 9913]}	99.6
d1jl5a_		353	Leucine rich effector protein YopM {Yersinia pesti	99.6
d1ozna_		284	Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma	99.59
d1ogqa_		313	Polygalacturonase inhibiting protein PGIP {Kidney	99.58
d1jl5a_		353	Leucine rich effector protein YopM {Yersinia pesti	99.56
d1h6ta2		210	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.54
d2omxa2		199	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.53
d2omxa2		199	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.51
d1h6ta2		210	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.49
d1ozna_		284	Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma	99.46
d1h6ua2		227	Internalin H {Listeria monocytogenes [TaxId: 1639]	99.46
d1h6ua2		227	Internalin H {Listeria monocytogenes [TaxId: 1639]	99.44
d1a9na_		162	Splicesomal U2A' protein {Human (Homo sapiens) [Ta	99.38
d1dcea3		124	Rab geranylgeranyltransferase alpha-subunit, C-ter	99.38
d2astb2		284	Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa	99.37
d1dcea3		124	Rab geranylgeranyltransferase alpha-subunit, C-ter	99.37
d2astb2		284	Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa	99.33
d1xwdc1		242	Follicle-stimulating hormone receptor {Human (Homo	99.31
d1w8aa_		192	Slit {Fruit fly (Drosophila melanogaster) [TaxId:	99.28
d1a9na_		162	Splicesomal U2A' protein {Human (Homo sapiens) [Ta	99.25
d1xwdc1		242	Follicle-stimulating hormone receptor {Human (Homo	99.22
d1w8aa_		192	Slit {Fruit fly (Drosophila melanogaster) [TaxId:	99.2
d1m9la_		198	Outer arm dynein light chain 1 {Green algae (Chlam	99.07
d1m9la_		198	Outer arm dynein light chain 1 {Green algae (Chlam	99.02
d1z7xw1		460	Ribonuclease inhibitor {Human (Homo sapiens) [TaxI	98.91
d2ifga3		156	High affinity nerve growth factor receptor, N-term	98.74
d2ifga3		156	High affinity nerve growth factor receptor, N-term	98.73
d1z7xw1		460	Ribonuclease inhibitor {Human (Homo sapiens) [TaxI	98.67
d2ca6a1		344	Rna1p (RanGAP1), N-terminal domain {Fission yeast	98.3
d2ca6a1		344	Rna1p (RanGAP1), N-terminal domain {Fission yeast	98.11
d1koha1		162	mRNA export factor tap {Human (Homo sapiens) [TaxI	97.55
d1koha1		162	mRNA export factor tap {Human (Homo sapiens) [TaxI	97.45
d1pgva_		167	Tropomodulin C-terminal domain {nematode (Caenorha	96.39
d1pgva_		167	Tropomodulin C-terminal domain {nematode (Caenorha	96.16
d1io0a_		166	Tropomodulin C-terminal domain {Chicken (Gallus ga	95.8
d1io0a_		166	Tropomodulin C-terminal domain {Chicken (Gallus ga	94.83

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

Probab=99.78  E-value=8.2e-18  Score=183.60  Aligned_cols=102  Identities=24%  Similarity=0.402  Sum_probs=75.4

Q ss_pred             cCCCCccEEEecCCcCcccCccccCCCCCCEEEccCCcccCcccccCCCCCcEEecccCcCcccCcccccCccCCEEEec
Q 002313          254 EGMTELRVLDLTGFRFHSLPSSLGCLINLRTLSLENCLVVDVAIIGDLKKLEILSLKHSSIEQLPREIGQLTCLKLLDLS  333 (937)
Q Consensus       254 ~~l~~Lr~L~L~~~~~~~lp~~i~~l~~Lr~L~L~~~~~~~l~~i~~L~~L~~L~L~~~~l~~lp~~i~~L~~L~~L~l~  333 (937)
                      ..+.+|++|++++++++++ +.+..+++|++|++++|+++.++.++++++|++|++++|.+..+++ ++++++|++|+++
T Consensus        41 ~~l~~l~~L~l~~~~I~~l-~gl~~L~nL~~L~Ls~N~l~~l~~l~~L~~L~~L~L~~n~i~~i~~-l~~l~~L~~L~~~  118 (384)
T d2omza2          41 TDLDQVTTLQADRLGIKSI-DGVEYLNNLTQINFSNNQLTDITPLKNLTKLVDILMNNNQIADITP-LANLTNLTGLTLF  118 (384)
T ss_dssp             HHHTTCCEEECCSSCCCCC-TTGGGCTTCCEEECCSSCCCCCGGGTTCTTCCEEECCSSCCCCCGG-GTTCTTCCEEECC
T ss_pred             HHhCCCCEEECCCCCCCCc-cccccCCCCCEEeCcCCcCCCCccccCCcccccccccccccccccc-ccccccccccccc
Confidence            3466788888888888877 3578888888888888888888778888888888888888887764 7888888888887


Q ss_pred             CCCCCcccChhhhcCCCCCcEEEcCCC
Q 002313          334 NCSKLKEIRPNVISNLTRLEELYMGNS  360 (937)
Q Consensus       334 ~~~~l~~lp~~~l~~L~~L~~L~l~~~  360 (937)
                      ++ .+..++.  ......+..+....+
T Consensus       119 ~~-~~~~~~~--~~~~~~~~~~~~~~~  142 (384)
T d2omza2         119 NN-QITDIDP--LKNLTNLNRLELSSN  142 (384)
T ss_dssp             SS-CCCCCGG--GTTCTTCSEEEEEEE
T ss_pred             cc-ccccccc--ccccccccccccccc
Confidence            74 3555544  344555555554443

PyMOL of d2omza2

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]}	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]}	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]}	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure