Citrus Sinensis ID: 002350


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930---
METSFVRLSISVIMITVLMNEMHGYKACLETERTALLQIKSFFISASDIEYKDSILSSWVDDDDDDGMPSDCCHWQRVKCNATTGRVMQLSLKNTTRLNYPYDWFPLLNMSLFHPLEELQSLDLSVNIFTYDSKVAAYDSLRSLKQLKILVLGHNYFDDSIFSYLNTLPSLCTLILHWNRIEGSQTNQGICELKNLFEMNLERNFIGSPLITCLKNLTRLKILDISSNQLNGSLPSVISNLTSLEYLDLSHNNFEGMFPLSSLANHSKLEGLLLSTRNNTLHVKTENWLPTSQLIVLGLTKCNLNGSYPDFLLHQYHLKYLDLSHNKLVGNFPTWLLRNNPKLEVLLLKNNSFSGILQLPKAKHDFLHHLDISCNNFRGKLPHNMGVILQKLMYMDISKNCFEGNIPYSAGEMKELSLLDLSRNYFSGGLSQSVVTGCFSLELLDLSNNNFEGQFFSEYMNLTRLRHLYFENNNFSGKIKDGLLSSTSLQVLDISNNMLSGHIPHWMGNFSSELEILSMSKNHLEGNVPVQLNNLERLRILDISENRLSGPIASSLNLSSVEHLSLQKNALNGLIPGELFRSCKLVTLNLRDNTFSGRIPHQINEHSNLRFLLLGGNHLQGPIPDQLCQLQKLAMMDLSRNKFSGSIPPCFANVLSWRVGSDDVLNGSKLNSPELDEEIEFGSLGNNRSSNTMFGMWRWLSALEKRAAIDERVEIEFAMKNRYEIYNGSNVNRVTGLDLSCNQLTGEIPSDIGQLQAILALNLSNNSLSGSIPESFSNLKMIESLDISYNKLTGQIPPQLTALNFLSIFNVSYNNLSGRTPDKGQFATFDESSYRGNPSLCAWLIQQKYSRTLKPTTTQASGAEEEEEEEDDDESAIDMVTLYSSFGASYVTVILVLIAILWINSYWRRLWFYSIDRCINTWYYWLSKYVLCR
cccHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccEEEccccccEEEEEcccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccHHHHcccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccHHHHcccccccEEEccccccccccccccccccccccEEEcccccccccccHHHHccccccEEEcccccccccccHHHHHccccccEEEccccccEEcccccccccccccEEEccccccEEEcccccccccccccEEEcccccccccccccccccccccEEEcccccccEEccHHHHHccccccEEEccccEEEEEccccccccccccEEEccccEEcccccccccccccccEEEcccccccccccHHHHHccccccEEEcccccccccccccccccccccEEEccccccccccccccccccccEEEcccccccccccHHccccccccEEEcccccccccccHHHHccccccEEEccccccccccHHHHHccccccEEEccccccccccccccHHHHcccccccccccccccccccccccccEEEcccccccccccHHHHHHHHHHHHccccccEEEEEEEEccEEEEccccccccEEEEcccccccccccHHHHccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHccEEEEEEEEEEEEc
cHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHccccccccccccccccccccccccccccccccEEEEEEcccccEEEEEEcccccccccccccccccccHHHHccccccEEEcccccccccccccccHHHcccccccEEEcccccccccccHHHccccccEEEEcccccccccccHHHHcccccccEEEcccccccccccccHccccccEEEEEccccccccccHHHcccccccEEEcccccccccccHHHHcccccccEEEEccccccccccHHHHccccccEEEEEccccccccccHHHcccccccEEEcccccccccccHHHHHHcccccEEEEccccccccccHHHcccccccEEEcccccccccccHHHHHHHHcccEEEcccccccccccHHHHccccccEEEEccccccccccHHHHHccccccEEEcccccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHHHHHccEEEcccccccccccHHHccccccEEEEccccccccccccHccccccEEEEcccccccccccHHHccccccEEEEcccccccccccHHHcccccccEEEEccccccccccHHHccccccEEEEcccccccccccHHHHHHHHHHHcccccccccccHHHcccccEEEEEcccccccccccccccccHHHHccccccccccccccccccccHHHHccccEEEEEEcccccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccccEEcccHHHHHcccccEEEccccEEEEEccccccHHHccHHHcccccEEcccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHEEEHHHEcc
METSFVRLSISVIMITVLMNEMHGYKACLETERTALLQIKSFFisasdieykdsilsswvddddddgmpsdcchwqrvkcnattgRVMQLSLKnttrlnypydwfpllnmslfhpleelqsldlsvniftyDSKVAAYDSLRSLKQLKILVLghnyfddsiFSYLNTLPSLCTLILhwnriegsqtnqGICELKNLFEMNlernfigspliTCLKNltrlkildissnqlngslpsvISNLTsleyldlshnnfegmfplsslanhsKLEGLLLSTrnntlhvktenwlpTSQLIVLGLtkcnlngsypdfllHQYHLKYLdlshnklvgnfptwllrnnpklEVLLLKNnsfsgilqlpkakhdflhhldiscnnfrgklphNMGVILQKLMYMDISkncfegnipysagemkELSLLDLSrnyfsgglsqsvVTGCFSLELldlsnnnfegqffsEYMNLTRLRHLYfennnfsgkikdgllsstslQVLDISnnmlsghiphwmgnfSSELEILSMSKnhlegnvpvqlnnlerlrildisenrlsgpiasslnlssVEHLSLQKnalnglipgelfrSCKLVtlnlrdntfsgriphqinehSNLRFLLLggnhlqgpipdqLCQLQKLAMMDlsrnkfsgsippcfanvlswrvgsddvlngsklnspeldeeiefgslgnnrssntMFGMWRWLSALEKRAAIDERVEIEFAMKNRYeiyngsnvnrvtgldlscnqltgeipsdiGQLQAILALNLsnnslsgsipesfsnlkMIESLDISynkltgqippqltaLNFLSIFNVSynnlsgrtpdkgqfatfdessyrgnpsLCAWLIQQKYsrtlkptttqasgaeeeeeeedddesaIDMVTLYSSFGASYVTVILVLIAILWINSYWRRLWFYSIDRCINTWYYWLSKYVLCR
metsfvrlSISVIMITVLMNEMHGYKACLETERTALLQIKSFFISASDIEYKDSILSSWVDDDDDDGMPSDCCHWQRVKCNATTGRVMQLSLKNTTRLNYPYDWFPLLNMSLFHPLEELQSLDLSVNIFTYDSKVAAYDSLRSLKQLKILVLGHNYFDDSIFSYLNTLPSLCTLILHWNRIEGSQTNQGICELKNLFEMNLERNFIGSPLITCLKNLTRLKILDISSNQLNGSLPSVISNLTSLEYLDLSHNNFEGMFPLSSLANHSKLEGLLLSTRNNTLHVKTENWLPTSQLIVLGLTKCNLNGSYPDFLLHQYHLKYLDLSHNKLVGNFPTWLLRNNPKLEVLLLKNNSFSGILQLPKAKHDFLHHLDISCNNFRGKLPHNMGVILQKLMYMDISKNCFEGNIPYSAGEMKELSLLDLSRNYFSGGLSQSVVTGCFSLELLDLSNNNFEGQFFSEYMNLTRLRHLYFENNNFSGKIKDGLLSSTSLQVLDISNNMLSGHIPHWMGNFSSELEILSMSKNHLEGNVPVQLNNLERLRILDISENRLSGPIASSLNLSSVEHLSLQKNALNGLIPGELFRSCKLVTLNLRDNTFSGRIPHQINEHSNLRFLLLGGNHLQGPIPDQLCQLQKLAMMDLSRNKFSGSIPPCFANVLSWRVGSDDVLNGSKLNSPELDEEIefgslgnnrssNTMFGMWRWLSALEKRAAIDERVEIEFAMKNRYEIYNGSNVNRVTGLDLSCNQLTGEIPSDIGQLQAILALNLSNNSLSGSIPESFSNLKMIESLDISYNKLTGQIPPQLTALNFLSIFNVSYNNLSGRTPDKGQFATFDESSYRGNPSLCAWLIQQKYsrtlkptttqasgaeeeeeeedddesaIDMVTLYSSFGASYVTVILVLIAILWINSYWRRLWFYSIDRCINTWYYWLSKYVLCR
METSFVRLSISVIMITVLMNEMHGYKACLETERTALLQIKSFFISASDIEYKdsilsswvddddddgmpsdCCHWQRVKCNATTGRVMQLSLKNTTRLNYPYDWFPLLNMSLFHPLEELQSLDLSVNIFTYDSKVAAYDSLRSLKQLKILVLGHNYFDDSIFSYLNTLPSLCTLILHWNRIEGSQTNQGICELKNLFEMNLERNFIGSPLITCLKNLTRLKILDISSNQLNGSLPSVISNLTSLEYLDLSHNNFEGMFPLSSLANHSKLEGLLLSTRNNTLHVKTENWLPTSQLIVLGLTKCNLNGSYPDFLLHQYHLKYLDLSHNKLVGNFPTWLLRNNPKLEVLLLKNNSFSGILQLPKAKHDFLHHLDISCNNFRGKLPHNMGVILQKLMYMDISKNCFEGNIPYSAGEMKELSLLDLSRNYFSGGLSQSVVTGCFSLELLDLSNNNFEGQFFSEYMNLTRLRHLYFENNNFSGKIKDGLLSSTSLQVLDISNNMLSGHIPHWMGNFSSELEILSMSKNHLEGNVPVQLNNLERLRILDISENRLSGPIASSLNLSSVEHLSLQKNALNGLIPGELFRSCKLVTLNLRDNTFSGRIPHQINEHSNLRFLLLGGNHLQGPIPDQLCQLQKLAMMDLSRNKFSGSIPPCFANVLSWRVGSDDVLNGSKLNSPELDEEIEFGSLGNNRSSNTMFGMWRWLSALEKRAAIDERVEIEFAMKNRYEIYNGSNVNRVTGLDLSCNQLTGEIPSDIGQLQAILAlnlsnnslsGSIPESFSNLKMIESLDISYNKLTGQIPPQLTALNFLSIFNVSYNNLSGRTPDKGQFATFDESSYRGNPSLCAWLIQQKYSRTLKPTTTQASGAeeeeeeedddeSAIDMVTLYSSFGASYVTVILVLIAILWINSYWRRLWFYSIDRCINTWYYWLSKYVLCR
****FVRLSISVIMITVLMNEMHGYKACLETERTALLQIKSFFISASDIEYKDSILSSWVDDDDDDGMPSDCCHWQRVKCNATTGRVMQLSLKNTTRLNYPYDWFPLLNMSLFHPLEELQSLDLSVNIFTYDSKVAAYDSLRSLKQLKILVLGHNYFDDSIFSYLNTLPSLCTLILHWNRIEGSQTNQGICELKNLFEMNLERNFIGSPLITCLKNLTRLKILDISSNQLNGSLPSVISNLTSLEYLDLSHNNFEGMFPLSSLANHSKLEGLLLSTRNNTLHVKTENWLPTSQLIVLGLTKCNLNGSYPDFLLHQYHLKYLDLSHNKLVGNFPTWLLRNNPKLEVLLLKNNSFSGILQLPKAKHDFLHHLDISCNNFRGKLPHNMGVILQKLMYMDISKNCFEGNIPYSAGEMKELSLLDLSRNYFSGGLSQSVVTGCFSLELLDLSNNNFEGQFFSEYMNLTRLRHLYFENNNFSGKIKDGLLSSTSLQVLDISNNMLSGHIPHWMGNFSSELEILSMSKNHLEGNVPVQLNNLERLRILDISENRLSGPIASSLNLSSVEHLSLQKNALNGLIPGELFRSCKLVTLNLRDNTFSGRIPHQINEHSNLRFLLLGGNHLQGPIPDQLCQLQKLAMMDLSRNKFSGSIPPCFANVLSWRVGSDDVL*************************NTMFGMWRWLSALEKRAAIDERVEIEFAMKNRYEIYNGSNVNRVTGLDLSCNQLTGEIPSDIGQLQAILALNLSNNSL***IPESFSNLKMIESLDISYNKLTGQIPPQLTALNFLSIFNVSYNNLSGR*****QFATFDESSYRGNPSLCAWLIQQKY***************************IDMVTLYSSFGASYVTVILVLIAILWINSYWRRLWFYSIDRCINTWYYWLSKYVLC*
****FVRLSISVIMITVLMNEMHGYKACLETERTALLQIKSFFISASDIEYKDSILSSWVDDDDDDGMPSDCCHWQRVKCNATTGRVMQLSLKNTTRLNYPYDWFPLLNMSLFHPLEELQSLDLSVNIFTYDSKVAAYDSLRSLKQLKILVLGHNYFDDSIFSYLNTLPSLCTLILHWNRIEGSQTNQGICELKNLFEMNLERNFIGSPLITCLKNLTRLKILDISSNQLNGSLPSVISNLTSLEYLDLSHNNFEGMFPLSSLANHSKLEGLLLSTRNNTLHVKTENWLPTSQLIVLGLTKCNLNGSYPDFLLHQYHLKYLDLSHNKLVGNFPTWLLRNNPKLEVLLLKNNSFSGILQLPKAKHDFLHHLDISCNNFRGKLPHNMGVILQKLMYMDISKNCFEGNIPYSAGEMKELSLLDLSRNYFSGGLSQSVVTGCFSLELLDLSNNNFEGQFFSEYMNLTRLRHLYFENNNFSGKIKDGLLSSTSLQVLDISNNMLSGHIPHWMGNFSSELEILSMSKNHLEGNVPVQLNNLERLRILDISENRLSGPIASSLNLSSVEHLSLQKNALNGLIPGELFRSCKLVTLNLRDNTFSGRIPHQINEHSNLRFLLLGGNHLQGPIPDQLCQLQKLAMMDLSRNKFSGSIPPCFANVLSWRVGSDDVLNGSKLNSPELDEEIEFGSLGNNRSSNTMFGMWRWLSALEKRAAIDERVEIEFAMKNRYEIYNGSNVNRVTGLDLSCNQLTGEIPSDIGQLQAILALNLSNNSLSGSIPESFSNLKMIESLDISYNKLTGQIPPQLTALNFLSIFNVSYNNLSGRTPDKGQFATFDESSYRGNPSLCAWLIQQ****************************AIDMVTLYSSFGASYVTVILVLIAILWINSYWRRLWFYSIDRCINTWYYWLSKYVLCR
METSFVRLSISVIMITVLMNEMHGYKACLETERTALLQIKSFFISASDIEYKDSILSSWVDDDDDDGMPSDCCHWQRVKCNATTGRVMQLSLKNTTRLNYPYDWFPLLNMSLFHPLEELQSLDLSVNIFTYDSKVAAYDSLRSLKQLKILVLGHNYFDDSIFSYLNTLPSLCTLILHWNRIEGSQTNQGICELKNLFEMNLERNFIGSPLITCLKNLTRLKILDISSNQLNGSLPSVISNLTSLEYLDLSHNNFEGMFPLSSLANHSKLEGLLLSTRNNTLHVKTENWLPTSQLIVLGLTKCNLNGSYPDFLLHQYHLKYLDLSHNKLVGNFPTWLLRNNPKLEVLLLKNNSFSGILQLPKAKHDFLHHLDISCNNFRGKLPHNMGVILQKLMYMDISKNCFEGNIPYSAGEMKELSLLDLSRNYFSGGLSQSVVTGCFSLELLDLSNNNFEGQFFSEYMNLTRLRHLYFENNNFSGKIKDGLLSSTSLQVLDISNNMLSGHIPHWMGNFSSELEILSMSKNHLEGNVPVQLNNLERLRILDISENRLSGPIASSLNLSSVEHLSLQKNALNGLIPGELFRSCKLVTLNLRDNTFSGRIPHQINEHSNLRFLLLGGNHLQGPIPDQLCQLQKLAMMDLSRNKFSGSIPPCFANVLSWRVGSDDVLNGSKLNSPELDEEIEFGSLGNNRSSNTMFGMWRWLSALEKRAAIDERVEIEFAMKNRYEIYNGSNVNRVTGLDLSCNQLTGEIPSDIGQLQAILALNLSNNSLSGSIPESFSNLKMIESLDISYNKLTGQIPPQLTALNFLSIFNVSYNNLSGRTPDKGQFATFDESSYRGNPSLCAWLIQQKYSRTL**********************AIDMVTLYSSFGASYVTVILVLIAILWINSYWRRLWFYSIDRCINTWYYWLSKYVLCR
*ETSFVRLSISVIMITVLMNEMHGYKACLETERTALLQIKSFFISASDIEYKDSILSSWVDDDDDDGMPSDCCHWQRVKCNATTGRVMQLSLKNTTRLNYPYDWFPLLNMSLFHPLEELQSLDLSVNIFTYDSKVAAYDSLRSLKQLKILVLGHNYFDDSIFSYLNTLPSLCTLILHWNRIEGSQTNQGICELKNLFEMNLERNFIGSPLITCLKNLTRLKILDISSNQLNGSLPSVISNLTSLEYLDLSHNNFEGMFPLSSLANHSKLEGLLLSTRNNTLHVKTENWLPTSQLIVLGLTKCNLNGSYPDFLLHQYHLKYLDLSHNKLVGNFPTWLLRNNPKLEVLLLKNNSFSGILQLPKAKHDFLHHLDISCNNFRGKLPHNMGVILQKLMYMDISKNCFEGNIPYSAGEMKELSLLDLSRNYFSGGLSQSVVTGCFSLELLDLSNNNFEGQFFSEYMNLTRLRHLYFENNNFSGKIKDGLLSSTSLQVLDISNNMLSGHIPHWMGNFSSELEILSMSKNHLEGNVPVQLNNLERLRILDISENRLSGPIASSLNLSSVEHLSLQKNALNGLIPGELFRSCKLVTLNLRDNTFSGRIPHQINEHSNLRFLLLGGNHLQGPIPDQLCQLQKLAMMDLSRNKFSGSIPPCFANVLSWRVGSDDVLNGSKLNSPELDEEIEFGSLGNNRSSNTMFGMWRWLSALEKRAAIDERVEIEFAMKNRYEIYNGSNVNRVTGLDLSCNQLTGEIPSDIGQLQAILALNLSNNSLSGSIPESFSNLKMIESLDISYNKLTGQIPPQLTALNFLSIFNVSYNNLSGRTPDKGQFATFDESSYRGNPSLCAWLIQQKY***********************DESAIDMVTLYSSFGASYVTVILVLIAILWINSYWRRLWFYSIDRCINTWYYWLSKYVLCR
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiHHHHHHHHHHHHHHHHooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
METSFVRLSISVIMITVLMNEMHGYKACLETERTALLQIKSFFISASDIEYKDSILSSWVDDDDDDGMPSDCCHWQRVKCNATTGRVMQLSLKNTTRLNYPYDWFPLLNMSLFHPLEELQSLDLSVNIFTYDSKVAAYDSLRSLKQLKILVLGHNYFDDSIFSYLNTLPSLCTLILHWNRIEGSQTNQGICELKNLFEMNLERNFIGSPLITCLKNLTRLKILDISSNQLNGSLPSVISNLTSLEYLDLSHNNFEGMFPLSSLANHSKLEGLLLSTRNNTLHVKTENWLPTSQLIVLGLTKCNLNGSYPDFLLHQYHLKYLDLSHNKLVGNFPTWLLRNNPKLEVLLLKNNSFSGILQLPKAKHDFLHHLDISCNNFRGKLPHNMGVILQKLMYMDISKNCFEGNIPYSAGEMKELSLLDLSRNYFSGGLSQSVVTGCFSLELLDLSNNNFEGQFFSEYMNLTRLRHLYFENNNFSGKIKDGLLSSTSLQVLDISNNMLSGHIPHWMGNFSSELEILSMSKNHLEGNVPVQLNNLERLRILDISENRLSGPIASSLNLSSVEHLSLQKNALNGLIPGELFRSCKLVTLNLRDNTFSGRIPHQINEHSNLRFLLLGGNHLQGPIPDQLCQLQKLAMMDLSRNKFSGSIPPCFANVLSWRVGSDDVLNGSKLNSPELDEEIEFGSLGNNRSSNTMFGMWRWLSALEKRAAIDERVEIEFAMKNRYEIYNGSNVNRVTGLDLSCNQLTGEIPSDIGQLQAILALNLSNNSLSGSIPESFSNLKMIESLDISYNKLTGQIPPQLTALNFLSIFNVSYNNLSGRTPDKGQFATFDESSYRGNPSLCAWLIQQKYSRTLKPTTTQASGAEEEEEEEDDDESAIDMVTLYSSFGASYVTVILVLIAILWINSYWRRLWFYSIDRCINTWYYWLSKYVLCR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query933 2.2.26 [Sep-21-2011]
Q9C9H7847 Receptor-like protein 12 no no 0.803 0.885 0.292 2e-71
Q8L899 1207 Systemin receptor SR160 O N/A no 0.764 0.590 0.324 5e-69
Q8GUQ5 1207 Brassinosteroid LRR recep N/A no 0.764 0.590 0.324 5e-69
C0LGQ5 1249 LRR receptor-like serine/ no no 0.822 0.614 0.295 3e-68
Q9FL28 1173 LRR receptor-like serine/ no no 0.677 0.538 0.308 4e-66
Q9ZWC8 1166 Serine/threonine-protein no no 0.651 0.521 0.319 3e-62
Q9LJF3 1164 Receptor-like protein kin no no 0.653 0.524 0.322 3e-59
Q9FZ59 1088 Leucine-rich repeat recep no no 0.653 0.560 0.314 5e-59
O22476 1196 Protein BRASSINOSTEROID I no no 0.660 0.515 0.313 1e-57
Q9FIZ3 1252 LRR receptor-like serine/ no no 0.688 0.512 0.288 1e-57
>sp|Q9C9H7|RLP12_ARATH Receptor-like protein 12 OS=Arabidopsis thaliana GN=RLP12 PE=2 SV=2 Back     alignment and function desciption
 Score =  271 bits (692), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 259/886 (29%), Positives = 405/886 (45%), Gaps = 136/886 (15%)

Query: 12  VIMITVLMNEMHGYKA--CLETERTALLQIKSFFISASDIEYKDSILSSWVDDDDDDGMP 69
           +I +++L++ +       C + +R ALL+ +  F     I     I++ W    +     
Sbjct: 16  IIFLSLLVHSLASSSPHFCRDDQRDALLEFRGEF----PINASWHIMNQWRGPWNKS--- 68

Query: 70  SDCCHWQRVKCNATTGRVMQLSLKNTTRLNYPYDWFPLLNMSLFHPLEELQSLDLS---- 125
           +DCC W  V CN  +G+V+ L + NT   NY        N SLF  L+ L+ LDL+    
Sbjct: 69  TDCCLWNGVTCNDKSGQVISLDIPNTFLNNYLKT-----NSSLFK-LQYLRHLDLTNCNL 122

Query: 126 ----------------VNIF--TYDSKVAAYDSLRSLKQLKILVLGHNYFDDSIFSYLNT 167
                           VN++   +  ++ A  S+ +L QL+ L+L +N     I S L  
Sbjct: 123 YGEIPSSLGNLSHLTLVNLYFNKFVGEIPA--SIGNLNQLRHLILANNVLTGEIPSSLGN 180

Query: 168 LPSLCTLILHWNRIEGSQTNQGICELKNLFEMNLERNFIGSPLITCLKNLTRLKILDISS 227
           L  L  L L  NR+ G +    I +LK L  ++L  N +   + + L NL+ L  L ++ 
Sbjct: 181 LSRLVNLELFSNRLVG-KIPDSIGDLKQLRNLSLASNNLIGEIPSSLGNLSNLVHLVLTH 239

Query: 228 NQLNGSLPSVISNLTSLEYLDLSHNNFEGMFPLSSLANHSKLEGLLLSTRNNTLHVKTEN 287
           NQL G +P+ I NL  L  +   +N+  G  P+S  AN +KL   +LS+ N T       
Sbjct: 240 NQLVGEVPASIGNLIELRVMSFENNSLSGNIPIS-FANLTKLSIFVLSSNNFT------- 291

Query: 288 WLPTSQLIVLGLTKCNLNGSYPDFLLHQYH-LKYLDLSHNKLVGNFPTWLLRNNPKLEVL 346
                              ++P F +  +H L+Y D+S+N   G FP  LL   P LE +
Sbjct: 292 ------------------STFP-FDMSIFHNLEYFDVSYNSFSGPFPKSLLLI-PSLESI 331

Query: 347 LLKNNSFSGILQLPKAKHDF-LHHLDISCNNFRGKLPHNMGVILQKLMYMDISKNCFEGN 405
            L+ N F+G ++         L  L +  N   G +P ++  +L  L  +DIS N F G 
Sbjct: 332 YLQENQFTGPIEFANTSSSTKLQDLILGRNRLHGPIPESISRLLN-LEELDISHNNFTGA 390

Query: 406 IPYSAGEMKELSLLDLSRNYFSGGLSQSVVTGC-FSLELLDLSNNNFEGQFFSEYMNLTR 464
           IP +  ++  L  LDLS+N   G      V  C + L  + LS+N+F   F +       
Sbjct: 391 IPPTISKLVNLLHLDLSKNNLEGE-----VPACLWRLNTMVLSHNSFS-SFENTSQEEAL 444

Query: 465 LRHLYFENNNFSGKIKDGLLSSTSLQVLDISNNMLSGHIPHWMGNFSSELEILSMSKNHL 524
           +  L   +N+F G I   +   +SL  LD+SNN+ SG IP  + NFS  ++ L++  N+ 
Sbjct: 445 IEELDLNSNSFQGPIPYMICKLSSLGFLDLSNNLFSGSIPSCIRNFSGSIKELNLGDNNF 504

Query: 525 EGNVPVQLNNLERLRILDISENRLSGPIASSL-NLSSVEHLSLQKNALNGLIPGELFRSC 583
            G +P   +    L  LD+S N+L G    SL N  ++E ++++ N +  + P  L    
Sbjct: 505 SGTLPDIFSKATELVSLDVSHNQLEGKFPKSLINCKALELVNVESNKIKDIFPSWLESLP 564

Query: 584 KLVTLNLRDNTFSGRIPHQINEHSNLRFLLLGGNHLQGPIPDQLCQLQKLAMMDLSRNKF 643
            L  LNLR N F G + H+   H+++ F                   Q L ++D+S N F
Sbjct: 565 SLHVLNLRSNKFYGPLYHR---HASIGF-------------------QSLRIIDISHNNF 602

Query: 644 SGSIPPCFANVLSWRVGSDDVLNGSKLNSPELDEEIEFGSLGNNRSSNTMFGMWRWL-SA 702
           SG++PP + +  +W+            +   L EE++            M   WR+  S 
Sbjct: 603 SGTLPPYYFS--NWK------------DMTTLTEEMD----------QYMTEFWRYADSY 638

Query: 703 LEKRAAIDERVEIEFAMKNRYEIYNGSNVNRVTGLDLSCNQLTGEIPSDIGQLQAILALN 762
             +   +++ V++ F    R              +D S N++ G IP  +G L+ +  LN
Sbjct: 639 YHEMEMVNKGVDMSFERIRR----------DFRAIDFSGNKINGNIPESLGYLKELRVLN 688

Query: 763 LSNNSLSGSIPESFSNLKMIESLDISYNKLTGQIPPQLTALNFLSIFNVSYNNLSGRTPD 822
           LS N+ +  IP   +NL  +E+LDIS NKL+GQIP  L AL+FLS  N S+N L G  P 
Sbjct: 689 LSGNAFTSVIPRFLANLTKLETLDISRNKLSGQIPQDLAALSFLSYMNFSHNLLQGPVPR 748

Query: 823 KGQFATFDESSYRGNPSLCAWLIQQKYSRTLKPTTTQASGAEEEEE 868
             QF     SS+  NP L       + +  L PT+       E EE
Sbjct: 749 GTQFQRQKCSSFLDNPGLYGLEDICRDTGALNPTSQLPEDLSEAEE 794




Involved in the perception of CLV3 and CLV3-like peptides, that act as extracellular signals regulating meristems maintenance.
Arabidopsis thaliana (taxid: 3702)
>sp|Q8L899|BRI1_SOLPE Systemin receptor SR160 OS=Solanum peruvianum PE=1 SV=1 Back     alignment and function description
>sp|Q8GUQ5|BRI1_SOLLC Brassinosteroid LRR receptor kinase OS=Solanum lycopersicum GN=CURL3 PE=1 SV=1 Back     alignment and function description
>sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 Back     alignment and function description
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function description
>sp|Q9ZWC8|BRL1_ARATH Serine/threonine-protein kinase BRI1-like 1 OS=Arabidopsis thaliana GN=BRL1 PE=1 SV=1 Back     alignment and function description
>sp|Q9LJF3|BRL3_ARATH Receptor-like protein kinase BRI1-like 3 OS=Arabidopsis thaliana GN=BRL3 PE=1 SV=1 Back     alignment and function description
>sp|Q9FZ59|PEPR2_ARATH Leucine-rich repeat receptor-like protein kinase PEPR2 OS=Arabidopsis thaliana GN=PEPR2 PE=1 SV=1 Back     alignment and function description
>sp|O22476|BRI1_ARATH Protein BRASSINOSTEROID INSENSITIVE 1 OS=Arabidopsis thaliana GN=BRI1 PE=1 SV=1 Back     alignment and function description
>sp|Q9FIZ3|GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query933
358345471933 Receptor kinase [Medicago truncatula] gi 0.928 0.928 0.449 0.0
297842171966 leucine-rich repeat family protein [Arab 0.937 0.905 0.404 1e-178
12324907910 putative disease resistance protein; 468 0.919 0.942 0.412 1e-176
3574688611016 Receptor-like protein kinase [Medicago t 0.916 0.841 0.403 1e-174
3583456931011 Receptor-like protein kinase [Medicago t 0.916 0.845 0.403 1e-174
359482731918 PREDICTED: probable LRR receptor-like se 0.927 0.942 0.419 1e-171
15221162965 receptor like protein 15 [Arabidopsis th 0.933 0.902 0.393 1e-171
12323813951 disease resistance protein, putative; 63 0.941 0.923 0.420 1e-169
359484714862 PREDICTED: probable LRR receptor-like se 0.907 0.982 0.429 1e-164
334183409932 receptor like protein 9 [Arabidopsis tha 0.921 0.922 0.396 1e-164
>gi|358345471|ref|XP_003636801.1| Receptor kinase [Medicago truncatula] gi|355502736|gb|AES83939.1| Receptor kinase [Medicago truncatula] Back     alignment and taxonomy information
 Score =  645 bits (1665), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 421/936 (44%), Positives = 542/936 (57%), Gaps = 70/936 (7%)

Query: 26  KACLETERTALLQIKSFFISASDIEYKDSILSSWVDDDDDDGMPSDCCHWQRVKCNATTG 85
           + CLE E+  LL +K+F IS S  +Y +  L+SW   D       DCC W+RVKCN TTG
Sbjct: 28  EGCLEKEKLGLLDLKTFLISNSTSKYNN--LTSWDKSD------VDCCSWERVKCNHTTG 79

Query: 86  RVMQLSLKNTT-RLNYPYDWFPLLNMSLFHPLEELQSLDLSVNIFTYDSKVAAYDSLRSL 144
            VM L L   T   N  Y W  + N S F P   L  LDLS N F         D    +
Sbjct: 80  HVMDLLLGGVTIPTNTTYLW--IFNFSYFLPFNHLVHLDLSANYF---------DGWVEI 128

Query: 145 KQLKILVLGHNYFDDSIF--SYLNTLPSLCTLILHWNR--IEGSQTNQGICELKNLFEMN 200
           +   IL    NY + ++       TL       L+ NR   E      G+C +KNL E++
Sbjct: 129 EGNFILDFFFNYHESNLVFRDGFTTLSHTTHQPLNVNRRLTENKIILTGLCGMKNLQELD 188

Query: 201 LERNFIGSPLITCLKNLTRLKILDISSNQLNGSLPSVISNLTSLEYLDLSHNNFEGMFPL 260
           L RN +      CL+NLT L++LD+SSN   G++PS I +L SLEYL L   NF+G+F  
Sbjct: 189 LSRNGMSGYFPQCLRNLTSLRVLDLSSNNFVGNIPSFIISLKSLEYLSLFDTNFDGIFSF 248

Query: 261 SSLANHSKLEGLLLSTRNNTLHVKTE---NWLPTSQLIVLGLTKCNLN----GSYPDFLL 313
           SSL NHSKLE  LLS + N L+V+TE   +W PT QL VL L  C LN    G++P FLL
Sbjct: 249 SSLNNHSKLEVFLLSPKTNNLYVETEESPSWHPTFQLKVLQLRNCFLNSKRDGTFPTFLL 308

Query: 314 HQYHLKYLDLSHNKLVGNFPTWLLRNNPKLEVLLLKNNSFSGILQLPKAKHDFLHHLDIS 373
           +Q+ L+ LDLSHNKL GNFP+W+L NN KLE L L NNSF+G L+LP  KH  L  L IS
Sbjct: 309 YQHELQLLDLSHNKLSGNFPSWILENNTKLETLYLMNNSFTGTLELPTFKHGLLD-LQIS 367

Query: 374 CNNFRGKLPHNMGVILQKLMYMDISKNCFEGNIPYSAGEMKELSLLDLSRNYFSGGLSQS 433
            N   G+L  ++G I   L Y+++SKN FEG +P S GEM+ +  LDLS N FSG LS  
Sbjct: 368 NNKIGGQLQEDIGKIFPNLYYVNLSKNSFEGILPSSIGEMQTIRTLDLSNNNFSGELSSH 427

Query: 434 VVTGCFSLELLDLSNNNFEGQFFSEYMNLTRLRHLYFENNNFSGKIKDGLLSSTSLQVLD 493
           +++   SL LL LS+N+F G       NLTRL  LY  NN+FSG I+DG+ +++SL  LD
Sbjct: 428 LISNLTSLRLLRLSHNSFHG-LVPLLSNLTRLNWLYLNNNSFSGVIEDGVSNNSSLFSLD 486

Query: 494 ISNNMLSGHIPHWMGNFSSELEILSMSKNHLEGNVPVQLNNLERLRILDISENRLSGPIA 553
           ISNNMLSG IP W+G F+ +L +LS+SKN L+G +P +L NL  L  LD+SEN LS  + 
Sbjct: 487 ISNNMLSGRIPRWIGRFT-KLSVLSLSKNRLQGEIPNELCNLISLSYLDLSENNLSDFLP 545

Query: 554 SSL-NLSSVEHLSLQKNALNGLIPGELFRSCKLVTLNLRDNTFSGRIPHQINEHSNLRFL 612
               N   ++ L LQKNAL G IP    +  KL +L+LRDN F G IP  IN  S LR L
Sbjct: 546 YCFKNFKYMKFLYLQKNALQGNIPYAFSQLTKLTSLDLRDNNFFGNIPQWINRLSKLRVL 605

Query: 613 LLGGNHLQGPIPDQLCQLQKLAMMDLSRNKFSGSIPPCFANVLSWRVGSDDVLNGSKLNS 672
           LL GN L GPIP  +C+L+ + +MDLS N  + +IPPC  N+    V       G +   
Sbjct: 606 LLAGNKLTGPIPIYVCELEHVRIMDLSHNWINETIPPCIKNISFKMVEFQTTAVGGRAVQ 665

Query: 673 PELDEEIEFGSLGNNRSSNTMFGMWRWL-----------SALEKRAAID-------ERVE 714
            + D + +    GN  +S        W            S+L     I        E VE
Sbjct: 666 NDNDSKDKIQYYGNTATSYIFLVDDIWFTPGNTFDIFYNSSLSLNHPIADEYMISYEIVE 725

Query: 715 IEFAMKNRYEIYNGSNVNRVTGLDLSCNQLTGEIPSDIGQLQAILALNLSNNSLSGSIPE 774
           IEF  K+ Y  Y G+N+N +TGLDLS N L+G IP +IG+L+ I ALNLS+N  SGSIP 
Sbjct: 726 IEFRTKSYYLSYKGNNLNLMTGLDLSSNNLSGSIPPEIGELRDIKALNLSHNRFSGSIPG 785

Query: 775 SFSNLKMIESLDISYNKLTGQIPPQLTALNFLSIFNVSYNNLSGRTPDKGQFATFDESSY 834
           +F NL  IESLD+SYN L+G +P  LT L  L+IFNVSYN  SGR P   QFA FDE++Y
Sbjct: 786 TFPNLINIESLDLSYNNLSGALPQNLTNLYSLAIFNVSYNKFSGRVPTTMQFANFDENNY 845

Query: 835 RGNPSLCAWLIQQKYSRT--LKPTTTQASGAEEEEEEEDDDESAIDMVTLYSSFGASYVT 892
           RGN  LC  +I    + T    P +T               ++AIDM + Y S  ASYVT
Sbjct: 846 RGNSDLCGSVINITCNHTSIFPPASTT------------QHQTAIDMESFYWSCVASYVT 893

Query: 893 VILVLIAILWINSYWRRLWFYSIDRCINTWYYWLSK 928
           V++ L  ILW+NS+W R+WF  +D CI   +Y  S+
Sbjct: 894 VVIGLAVILWVNSHWCRVWFRYVDLCI---FYCFSR 926




Source: Medicago truncatula

Species: Medicago truncatula

Genus: Medicago

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|297842171|ref|XP_002888967.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. lyrata] gi|297334808|gb|EFH65226.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|12324907|gb|AAG52409.1|AC020579_11 putative disease resistance protein; 46848-50365 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|357468861|ref|XP_003604715.1| Receptor-like protein kinase [Medicago truncatula] gi|355505770|gb|AES86912.1| Receptor-like protein kinase [Medicago truncatula] Back     alignment and taxonomy information
>gi|358345693|ref|XP_003636910.1| Receptor-like protein kinase [Medicago truncatula] gi|355502845|gb|AES84048.1| Receptor-like protein kinase [Medicago truncatula] Back     alignment and taxonomy information
>gi|359482731|ref|XP_003632819.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g36180-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|15221162|ref|NP_177559.1| receptor like protein 15 [Arabidopsis thaliana] gi|12323812|gb|AAG51871.1|AC079678_1 disease resistance protein, putative; 1096-4664 [Arabidopsis thaliana] gi|332197443|gb|AEE35564.1| receptor like protein 15 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|12323813|gb|AAG51872.1|AC079678_2 disease resistance protein, putative; 6346-10057 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|359484714|ref|XP_002264041.2| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g36180-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|334183409|ref|NP_176115.2| receptor like protein 9 [Arabidopsis thaliana] gi|332195389|gb|AEE33510.1| receptor like protein 9 [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query933
TAIR|locus:2037308976 RLP14 "AT1G74180" [Arabidopsis 0.834 0.798 0.415 1.9e-145
TAIR|locus:2019662965 RLP15 "AT1G74190" [Arabidopsis 0.849 0.821 0.405 2.5e-145
TAIR|locus:20250121083 RLP1 "AT1G07390" [Arabidopsis 0.782 0.674 0.413 2.4e-140
TAIR|locus:2101943891 RLP45 "AT3G53240" [Arabidopsis 0.852 0.892 0.390 1.4e-133
TAIR|locus:2040075935 RLP21 "AT2G25470" [Arabidopsis 0.851 0.849 0.365 7.9e-117
TAIR|locus:20373131000 RLP13 "AT1G74170" [Arabidopsis 0.811 0.757 0.372 5.3e-104
TAIR|locus:2155909908 RLP56 "AT5G49290" [Arabidopsis 0.917 0.942 0.341 2e-102
TAIR|locus:2120362 1249 GSO1 "GASSHO1" [Arabidopsis th 0.730 0.546 0.314 1.9e-70
TAIR|locus:2156349 1252 GSO2 "GASSHO 2" [Arabidopsis t 0.741 0.552 0.314 1.8e-69
TAIR|locus:2005498 1196 BRI1 "BRASSINOSTEROID INSENSIT 0.743 0.580 0.308 3e-65
TAIR|locus:2037308 RLP14 "AT1G74180" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1421 (505.3 bits), Expect = 1.9e-145, P = 1.9e-145
 Identities = 336/808 (41%), Positives = 470/808 (58%)

Query:   116 LEELQSLDLSVNIFTYDSKVAAYDSLRSLKQLKILVLGHNYFDDSI-FSYLNTLPSLCTL 174
             L +L+ LDLS +   Y+  +  +  L  LK L    L  N F   +    L  L +L  L
Sbjct:   186 LTKLELLDLSRS--GYNGSIPEFTHLEKLKALD---LSANDFSSLVELQELKVLTNLEVL 240

Query:   175 ILHWNRIEGSQTNQGICELKNLFEMNLERNFIGSPLITCLKNLTRLKILDISSNQLNGSL 234
              L WN ++G    +  CE+KNL +++L  N+    L  CL NL +L++LD+SSNQL+G+L
Sbjct:   241 GLAWNHLDGPIPKEVFCEMKNLRQLDLRGNYFEGQLPVCLGNLNKLRVLDLSSNQLSGNL 300

Query:   235 PSVISNLTSLEYLDLSHNNFEGMFPLSSLANHSKLEGLLLSTRNNTLHVKTE-NWLPTSQ 293
             P+  ++L SLEYL LS NNFEG F L+ LAN +KL+   LS+ +  L V+TE NWLP  Q
Sbjct:   301 PASFNSLESLEYLSLSDNNFEGFFSLNPLANLTKLKVFRLSSTSEMLQVETESNWLPKFQ 360

Query:   294 LIVLGLTKCNLNGSYPDFLLHQYHLKYLDLSHNKLVGNFPTWLLRNNPKLEVLLLKNNSF 353
             L V  L  C+L G  P+FL++Q +L+ +DLS N+L G+ PTWLL NNP+L+VL LKNNSF
Sbjct:   361 LTVAALPFCSL-GKIPNFLVYQTNLRLVDLSSNRLSGDIPTWLLENNPELKVLQLKNNSF 419

Query:   354 SGILQLPKAKHDFLHHLDISCNNFRGKLPHNMGVILQKLMYMDISKNCFEGNIPYSAGEM 413
             + I Q+P   H  L  LD S N+  G LP N+G +L +L++M+ S N F+GN+P S GEM
Sbjct:   420 T-IFQIPTIVHK-LQVLDFSANDITGVLPDNIGHVLPRLLHMNGSHNGFQGNLPSSMGEM 477

Query:   414 KELSLLDLSRNYFSGGLSQSVVTGCFSLELLDLSNNNFEGQFFSEYMNLTRLRHLYFENN 473
              ++S LDLS N FSG L +S++TGCFSL  L LS+N+F G        LT L  L   NN
Sbjct:   478 NDISFLDLSYNNFSGELPRSLLTGCFSLITLQLSHNSFSGPILPIQTRLTSLIVLRMHNN 537

Query:   474 NFSGKIKDGLLSSTSLQVLDISNNMLSGHIPHWMGNFSSELEILSMSKNHLEGNVPVQLN 533
              F+G+I  GL +  +L + D SNN L+G I   +   SS L +L +S N LEG +P  L 
Sbjct:   538 LFTGEIGVGLRTLVNLSIFDASNNRLTGLISSSIPPDSSHLIMLLLSNNLLEGTLPPSLL 597

Query:   534 NLERLRILDISENRLSGPIASSLNLSSVEHLS--LQKNALNGLIPGELFRSCKLVTLNLR 591
              +  L  LD+S N LSG + SS+ ++S+  +   L  N+  G +P  L  +  +  L+LR
Sbjct:   598 AIHHLNFLDLSGNLLSGDLPSSV-VNSMYGIKIFLHNNSFTGPLPVTLLENAYI--LDLR 654

Query:   592 DNTFSGRIPHQINEHSNLRFLLLGGNHLQGPIPDQLCQLQKLAMMDLSRNKFSGSIPPCF 651
             +N  SG IP  +N    +  LLL GN+L G IP +LC L  + ++DLS NK +G IPPC 
Sbjct:   655 NNKLSGSIPQFVNTGKMIT-LLLRGNNLTGSIPRKLCDLTSIRLLDLSDNKLNGVIPPCL 713

Query:   652 ANVLSWRVGSDDVLNGSKLNSPELDEEIEFGSLGNNRSSNTMFGMWRWLSALEKRAAIDE 711
              N LS  +G    L+G         +EI FG         + F +  ++   +    I  
Sbjct:   714 -NHLSTELGEGIGLSG-------FSQEISFGDSLQMEFYRSTFLVDEFMLYYDSTYMI-- 763

Query:   712 RVEIEFAMKNRYEIYNGSNVNRVTGLDLSCNQLTGEIPSDIGQLQAILAXXXXXXXXXGS 771
              VEIEFA K RY+ ++G  ++ + GLDLS N+L+G IP+++G L  + A          S
Sbjct:   764 -VEIEFAAKQRYDSFSGGTLDYMYGLDLSSNELSGVIPAELGDLSKLRALNLSRNLLSSS 822

Query:   772 IPESFSNLKMIESLDISYNKLTGQIPPQLTALNFLSIFNVSYNNLSGRTPDKGQFATFDE 831
             IP +FS LK IESLD+SYN L G IP QLT L  L++FNVS+NNLSG  P  GQF TF++
Sbjct:   823 IPANFSKLKDIESLDLSYNMLQGNIPHQLTNLTSLAVFNVSFNNLSGIIPQGGQFNTFND 882

Query:   832 SSYRGNPSLCAWLIQQKYSRTLKPTTTQASGAXXXXXXXXXXXSAIDMVTLYSSFGASYV 891
             +SY GNP LC     +      K  T +A              +AIDMV LY + G++Y 
Sbjct:   883 NSYLGNPLLCGTPTDRSCEG--KKNTKEADNGGEEEEEDDDDEAAIDMVVLYWTTGSTYA 940

Query:   892 TVILVLIAILWINSYWRRLWFYSIDRCI 919
               ++ ++ ++  +  WRR W   +D  I
Sbjct:   941 IALIGILVLMCFDCPWRRTWLCIVDAFI 968


GO:0007165 "signal transduction" evidence=IC
GO:0009507 "chloroplast" evidence=IDA
TAIR|locus:2019662 RLP15 "AT1G74190" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2025012 RLP1 "AT1G07390" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2101943 RLP45 "AT3G53240" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2040075 RLP21 "AT2G25470" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2037313 RLP13 "AT1G74170" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2155909 RLP56 "AT5G49290" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2120362 GSO1 "GASSHO1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2156349 GSO2 "GASSHO 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2005498 BRI1 "BRASSINOSTEROID INSENSITIVE 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
fgenesh2_kg.2__1688__AT1G74190.1
annotation not avaliable (966 aa)
(Arabidopsis lyrata)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query933
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-67
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-53
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 7e-47
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-18
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 5e-09
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 5e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 7e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-06
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 1e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-05
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 2e-05
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 3e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 5e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 7e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-04
pfam0826342 pfam08263, LRRNT_2, Leucine rich repeat N-terminal 2e-04
COG5238388 COG5238, RNA1, Ran GTPase-activating protein (RanG 2e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 0.001
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 0.001
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 0.001
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 0.001
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 0.002
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 0.002
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 0.002
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 0.003
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score =  243 bits (621), Expect = 2e-67
 Identities = 190/655 (29%), Positives = 288/655 (43%), Gaps = 95/655 (14%)

Query: 193 LKNLFEMNLERNFIGSPLITCLKNLTRLKILDISSNQLNGSLPSVISNLTSLEYLDLSHN 252
           LK L   N   +      ITC  N +R+  +D+S   ++G + S I  L  ++ ++LS+N
Sbjct: 45  LKYLSNWNSSADVCLWQGITC-NNSSRVVSIDLSGKNISGKISSAIFRLPYIQTINLSNN 103

Query: 253 NFEGMFPLSSLANHSKLEGLLLSTRNNTLHVKTENWLPTSQLIVLGLTKCNLNGSYPDFL 312
              G  P                                                  D  
Sbjct: 104 QLSGPIP-------------------------------------------------DDIF 114

Query: 313 LHQYHLKYLDLSHNKLVGNFPTWLLRNNPKLEVLLLKNNSFSGILQLPKAKHDFLHHLDI 372
                L+YL+LS+N   G+ P   +   P LE L L NN  SG +         L  LD+
Sbjct: 115 TTSSSLRYLNLSNNNFTGSIPRGSI---PNLETLDLSNNMLSGEIPNDIGSFSSLKVLDL 171

Query: 373 SCNNFRGKLPHNMGVILQKLMYMDISKNCFEGNIPYSAGEMKELSLLDLSRNYFSGGLSQ 432
             N   GK+P+++   L  L ++ ++ N   G IP   G+MK L  + L  N  SG +  
Sbjct: 172 GGNVLVGKIPNSLTN-LTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPY 230

Query: 433 SVVTGCFSLELLDLSNNNFEGQFFSEYMNLTRLRHLYFENNNFSGKIKDGLLSSTSLQVL 492
            +  G  SL  LDL  NN  G   S   NL  L++L+   N  SG I   + S   L  L
Sbjct: 231 EI-GGLTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIPPSIFSLQKLISL 289

Query: 493 DISNNMLSGHIPHWMGNFSSELEILSMSKNHLEGNVPVQLNNLERLRILDISENRLSGPI 552
           D+S+N LSG IP  +    + LEIL +  N+  G +PV L +L RL++L +  N+ SG I
Sbjct: 290 DLSDNSLSGEIPELVIQLQN-LEILHLFSNNFTGKIPVALTSLPRLQVLQLWSNKFSGEI 348

Query: 553 ASSL----NLSSVEHLSLQKNALNGLIPGELFRSCKLVTLNLRDNTFSGRIPHQINEHSN 608
             +L    NL+    L L  N L G IP  L  S  L  L L  N+  G IP  +    +
Sbjct: 349 PKNLGKHNNLTV---LDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRS 405

Query: 609 LRFLLLGGNHLQGPIPDQLCQLQKLAMMDLSRNKFSGSIPPCFANVLSWRVGSDDVLNGS 668
           LR + L  N   G +P +  +L  +  +D+S N   G I     N   W + S  +L+ +
Sbjct: 406 LRRVRLQDNSFSGELPSEFTKLPLVYFLDISNNNLQGRI-----NSRKWDMPSLQMLSLA 460

Query: 669 KLNSPELDEEIEFGSLGNNRSSNTMFGMWRWLSALEKRAAID-ERVEIEFAMKNRYEIYN 727
           +                     N  FG        ++   +D  R +   A+  +     
Sbjct: 461 R---------------------NKFFGGLPDSFGSKRLENLDLSRNQFSGAVPRKL---- 495

Query: 728 GSNVNRVTGLDLSCNQLTGEIPSDIGQLQAILALNLSNNSLSGSIPESFSNLKMIESLDI 787
             +++ +  L LS N+L+GEIP ++   + +++L+LS+N LSG IP SFS + ++  LD+
Sbjct: 496 -GSLSELMQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDL 554

Query: 788 SYNKLTGQIPPQLTALNFLSIFNVSYNNLSGRTPDKGQFATFDESSYRGNPSLCA 842
           S N+L+G+IP  L  +  L   N+S+N+L G  P  G F   + S+  GN  LC 
Sbjct: 555 SQNQLSGEIPKNLGNVESLVQVNISHNHLHGSLPSTGAFLAINASAVAGNIDLCG 609


Length = 968

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|219766 pfam08263, LRRNT_2, Leucine rich repeat N-terminal domain Back     alignment and domain information
>gnl|CDD|227563 COG5238, RNA1, Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 933
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 100.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.98
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.97
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.97
KOG4237498 consensus Extracellular matrix protein slit, conta 99.93
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.89
PLN032101153 Resistant to P. syringae 6; Provisional 99.88
KOG4237498 consensus Extracellular matrix protein slit, conta 99.86
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.86
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.85
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.78
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.77
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.74
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.71
KOG0617264 consensus Ras suppressor protein (contains leucine 99.67
KOG0617264 consensus Ras suppressor protein (contains leucine 99.61
PLN03150623 hypothetical protein; Provisional 99.57
PLN03150623 hypothetical protein; Provisional 99.43
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.34
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.19
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.18
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.13
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.1
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.03
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.99
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.98
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.95
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.95
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.87
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.82
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.81
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.77
PF0826343 LRRNT_2: Leucine rich repeat N-terminal domain; In 98.7
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.7
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.66
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.65
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.59
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.53
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.49
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.43
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.38
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.37
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.34
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.16
KOG4341483 consensus F-box protein containing LRR [General fu 98.07
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.97
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.95
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.87
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.86
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.82
PRK15386426 type III secretion protein GogB; Provisional 97.79
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.78
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.7
KOG4341483 consensus F-box protein containing LRR [General fu 97.66
PRK15386426 type III secretion protein GogB; Provisional 97.52
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.48
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.33
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.26
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.06
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.85
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.56
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.44
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.42
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.27
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.16
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.69
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.39
KOG4308478 consensus LRR-containing protein [Function unknown 93.85
KOG4308478 consensus LRR-containing protein [Function unknown 93.48
KOG0473326 consensus Leucine-rich repeat protein [Function un 92.99
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 90.05
KOG3864221 consensus Uncharacterized conserved protein [Funct 89.33
smart0037026 LRR Leucine-rich repeats, outliers. 85.83
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 85.83
KOG0473326 consensus Leucine-rich repeat protein [Function un 85.23
smart0037026 LRR Leucine-rich repeats, outliers. 84.67
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 84.67
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 81.25
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=100.00  E-value=5e-71  Score=694.20  Aligned_cols=583  Identities=33%  Similarity=0.522  Sum_probs=415.1

Q ss_pred             hHHHHHHHHHhhhhcccccccccCCCCCCCCCCCCCCCCCCCCCcccceeEecCCCCcEEEEecCCCCCCCCCCCCcccc
Q 002350           29 LETERTALLQIKSFFISASDIEYKDSILSSWVDDDDDDGMPSDCCHWQRVKCNATTGRVMQLSLKNTTRLNYPYDWFPLL  108 (933)
Q Consensus        29 ~~~~~~~ll~~k~~~~~~~~~~~~~~~l~~W~~~~~~~~~~~~~C~w~gv~c~~~~~~V~~l~l~~~~~l~l~~~~~~~~  108 (933)
                      .++|++||++||+++.++      .+.+++| +..      .+||.|.||+|+. .++|+.|++++...   +       
T Consensus        27 ~~~~~~~l~~~~~~~~~~------~~~~~~w-~~~------~~~c~w~gv~c~~-~~~v~~L~L~~~~i---~-------   82 (968)
T PLN00113         27 HAEELELLLSFKSSINDP------LKYLSNW-NSS------ADVCLWQGITCNN-SSRVVSIDLSGKNI---S-------   82 (968)
T ss_pred             CHHHHHHHHHHHHhCCCC------cccCCCC-CCC------CCCCcCcceecCC-CCcEEEEEecCCCc---c-------
Confidence            568999999999998533      4578999 654      6899999999985 57899888876542   1       


Q ss_pred             cccccCCCCCCCEeeCCCCCCccccCccccccCCCCCCCCEEeCCCCcCCCcchhhhc-CCCCCCEEecCCCcccCccCh
Q 002350          109 NMSLFHPLEELQSLDLSVNIFTYDSKVAAYDSLRSLKQLKILVLGHNYFDDSIFSYLN-TLPSLCTLILHWNRIEGSQTN  187 (933)
Q Consensus       109 ~~~~f~~l~~L~~LdLs~n~~~~~~~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~l~-~l~~L~~L~Ls~n~i~~~~~~  187 (933)
                                            +..+    ..+..+++|++|+|++|.+.+.+|..+. .+++|++|+|++|.+++..| 
T Consensus        83 ----------------------~~~~----~~~~~l~~L~~L~Ls~n~~~~~ip~~~~~~l~~L~~L~Ls~n~l~~~~p-  135 (968)
T PLN00113         83 ----------------------GKIS----SAIFRLPYIQTINLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIP-  135 (968)
T ss_pred             ----------------------ccCC----hHHhCCCCCCEEECCCCccCCcCChHHhccCCCCCEEECcCCccccccC-
Confidence                                  2222    3344555555555555555544444433 56666666666666655544 


Q ss_pred             hhhcCCCCCCEEECCCCCCCCcchhhcCCCCCCCEEEccCCcCCCCCchhccCCCCCCEEECCCCcCCCCCChhhhhcCC
Q 002350          188 QGICELKNLFEMNLERNFIGSPLITCLKNLTRLKILDISSNQLNGSLPSVISNLTSLEYLDLSHNNFEGMFPLSSLANHS  267 (933)
Q Consensus       188 ~~l~~l~~L~~L~Ls~n~l~~~~~~~l~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~~~~~l~~l~  267 (933)
                        .+.+++|++|+|++|.+.+.+|..++++++|++|++++|.+.+.+|..++++++|++|++++|.+.+.          
T Consensus       136 --~~~l~~L~~L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~----------  203 (968)
T PLN00113        136 --RGSIPNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQ----------  203 (968)
T ss_pred             --ccccCCCCEEECcCCcccccCChHHhcCCCCCEEECccCcccccCChhhhhCcCCCeeeccCCCCcCc----------
Confidence              23456666666666666666666666666666666666666666666666666666666666655432          


Q ss_pred             CCceEecccccCccccccCCCCCCCcceEEEccCCCCCCCCchhhhCCCCCCEEEccCCCCcccchhHHHhCCCCCCEEE
Q 002350          268 KLEGLLLSTRNNTLHVKTENWLPTSQLIVLGLTKCNLNGSYPDFLLHQYHLKYLDLSHNKLVGNFPTWLLRNNPKLEVLL  347 (933)
Q Consensus       268 ~L~~L~L~~~~~~~~~~~~~~~~~~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~~l~~L~~L~  347 (933)
                                                              +|..+.++++|++|++++|.+.+.+|..+. .+       
T Consensus       204 ----------------------------------------~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~-~l-------  235 (968)
T PLN00113        204 ----------------------------------------IPRELGQMKSLKWIYLGYNNLSGEIPYEIG-GL-------  235 (968)
T ss_pred             ----------------------------------------CChHHcCcCCccEEECcCCccCCcCChhHh-cC-------
Confidence                                                    334444555555556655555555554332 22       


Q ss_pred             cCCCCCcCcCcCCcccCCCccEEEccCCcCCCCCChhhhhcCCCccEEEccCCCCCCCccccccCCCCCCEEEcCCCcCC
Q 002350          348 LKNNSFSGILQLPKAKHDFLHHLDISCNNFRGKLPHNMGVILQKLMYMDISKNCFEGNIPYSAGEMKELSLLDLSRNYFS  427 (933)
Q Consensus       348 L~~n~l~~~~~~~~~~~~~L~~L~Ls~n~l~~~~p~~~~~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~  427 (933)
                                       ++|++|++++|.+++.+|..+. .+++|++|++++|.+.+.+|..+..+++|++|++++|.+.
T Consensus       236 -----------------~~L~~L~L~~n~l~~~~p~~l~-~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~  297 (968)
T PLN00113        236 -----------------TSLNHLDLVYNNLTGPIPSSLG-NLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLS  297 (968)
T ss_pred             -----------------CCCCEEECcCceeccccChhHh-CCCCCCEEECcCCeeeccCchhHhhccCcCEEECcCCeec
Confidence                             2333333334444334444443 2566666666666666556655555555555555555555


Q ss_pred             CCcchhhhcCCCCCCEEECcCCcCCCcCchhhcccCcCCeEEccCccccccccccccCCCCCCEEEccCCcCCCCChhhH
Q 002350          428 GGLSQSVVTGCFSLELLDLSNNNFEGQFFSEYMNLTRLRHLYFENNNFSGKIKDGLLSSTSLQVLDISNNMLSGHIPHWM  507 (933)
Q Consensus       428 ~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~Ls~n~l~~~~p~~l  507 (933)
                      +.+                         |..+..+++|+.|++++|.+.+..|..+..+++|+.|++++|.+.+.+|..+
T Consensus       298 ~~~-------------------------p~~~~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~L~~n~l~~~~p~~l  352 (968)
T PLN00113        298 GEI-------------------------PELVIQLQNLEILHLFSNNFTGKIPVALTSLPRLQVLQLWSNKFSGEIPKNL  352 (968)
T ss_pred             cCC-------------------------ChhHcCCCCCcEEECCCCccCCcCChhHhcCCCCCEEECcCCCCcCcCChHH
Confidence            444                         4444445555555555555555555555556666666666666666666666


Q ss_pred             hhhccccceeecCCCcCCCCcchhccCCCCCCEEEccCCcCccccCccc-cCCCCceEEeecCcCcccCchhhccCCCcc
Q 002350          508 GNFSSELEILSMSKNHLEGNVPVQLNNLERLRILDISENRLSGPIASSL-NLSSVEHLSLQKNALNGLIPGELFRSCKLV  586 (933)
Q Consensus       508 ~~~~~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~-~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~  586 (933)
                      +.+.. |+.|++++|++++.+|..+..+++|+.|++++|++.+.+|..+ .+++|+.|++++|++++.+|..+..+++|+
T Consensus       353 ~~~~~-L~~L~Ls~n~l~~~~p~~~~~~~~L~~L~l~~n~l~~~~p~~~~~~~~L~~L~L~~n~l~~~~p~~~~~l~~L~  431 (968)
T PLN00113        353 GKHNN-LTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFSGELPSEFTKLPLVY  431 (968)
T ss_pred             hCCCC-CcEEECCCCeeEeeCChhHhCcCCCCEEECcCCEecccCCHHHhCCCCCCEEECcCCEeeeECChhHhcCCCCC
Confidence            65554 6666666666666666666666677777777777776666665 677777777777777777888888888888


Q ss_pred             EEeCcCCcCcccCchhhhcCCCccEEEcCCCcCCCCCchhhhcCCCCCEEEccCCcCCCCCCchhhhhhccccCCCCccC
Q 002350          587 TLNLRDNTFSGRIPHQINEHSNLRFLLLGGNHLQGPIPDQLCQLQKLAMMDLSRNKFSGSIPPCFANVLSWRVGSDDVLN  666 (933)
Q Consensus       587 ~L~Ls~N~l~~~~p~~l~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~g~~p~~~~~l~~l~~~~~~~~~  666 (933)
                      .|++++|.+++.+|..+..+++|+.|++++|++.+.+|..+ ..++|+.|++++|+++|.+|..+.++            
T Consensus       432 ~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~n~~~~~~p~~~-~~~~L~~L~ls~n~l~~~~~~~~~~l------------  498 (968)
T PLN00113        432 FLDISNNNLQGRINSRKWDMPSLQMLSLARNKFFGGLPDSF-GSKRLENLDLSRNQFSGAVPRKLGSL------------  498 (968)
T ss_pred             EEECcCCcccCccChhhccCCCCcEEECcCceeeeecCccc-ccccceEEECcCCccCCccChhhhhh------------
Confidence            99999999888888888888999999999999988888765 45889999999999999888776543            


Q ss_pred             CCCCCCCCccchhhcccCCCCCCCccccchhhhhhhhhhhhhchhhhHHhhhhccceeeecCCCCCcccEEEcCCCcCCC
Q 002350          667 GSKLNSPELDEEIEFGSLGNNRSSNTMFGMWRWLSALEKRAAIDERVEIEFAMKNRYEIYNGSNVNRVTGLDLSCNQLTG  746 (933)
Q Consensus       667 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~L~~LdLs~N~l~g  746 (933)
                                                                                       ++|+.|||++|+++|
T Consensus       499 -----------------------------------------------------------------~~L~~L~Ls~N~l~~  513 (968)
T PLN00113        499 -----------------------------------------------------------------SELMQLKLSENKLSG  513 (968)
T ss_pred             -----------------------------------------------------------------hccCEEECcCCccee
Confidence                                                                             356779999999999


Q ss_pred             CCChhhhhccccCeeeccccccccccchhccCCCCCCEEECcCCeecccCCcCCcCCCCCCeEEccCCcCcccCCCCCcC
Q 002350          747 EIPSDIGQLQAILALNLSNNSLSGSIPESFSNLKMIESLDISYNKLTGQIPPQLTALNFLSIFNVSYNNLSGRTPDKGQF  826 (933)
Q Consensus       747 ~ip~~l~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~LdLs~N~l~~~ip~~l~~l~~L~~L~ls~N~l~g~~p~~~~~  826 (933)
                      .+|..++.+++|++|+|++|.++|.+|..|+++++|+.|||++|+++|.+|..+..+++|+++++++|+++|.+|..++|
T Consensus       514 ~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~l~ls~N~l~~~~p~~~~~  593 (968)
T PLN00113        514 EIPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHLHGSLPSTGAF  593 (968)
T ss_pred             eCChHHcCccCCCEEECCCCcccccCChhHhCcccCCEEECCCCcccccCChhHhcCcccCEEeccCCcceeeCCCcchh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CccCcccccCCCCCCCcc
Q 002350          827 ATFDESSYRGNPSLCAWL  844 (933)
Q Consensus       827 ~~~~~~~~~gN~~lc~~~  844 (933)
                      .++...++.||+.+|+.+
T Consensus       594 ~~~~~~~~~~n~~lc~~~  611 (968)
T PLN00113        594 LAINASAVAGNIDLCGGD  611 (968)
T ss_pred             cccChhhhcCCccccCCc
Confidence            999999999999999854



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query933
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 1e-54
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 4e-26
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 9e-04
3rgx_A768 Structural Insight Into Brassinosteroid Perception 1e-54
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 2e-15
3rg1_A612 Crystal Structure Of The Rp105MD-1 Complex Length = 4e-07
3a79_B562 Crystal Structure Of Tlr2-Tlr6-Pam2csk4 Complex Len 4e-06
2omz_A466 Crystal Structure Of Inla Y369a/hec1 Complex Length 7e-06
2omv_A461 Crystal Structure Of Inla S192n Y369s/hec1 Complex 1e-05
1o6s_A466 Internalin (Listeria Monocytogenes) E-Cadherin (Hum 1e-05
2omy_A461 Crystal Structure Of Inla S192n/hec1 Complex Length 2e-05
2z7x_B520 Crystal Structure Of The Tlr1-Tlr2 Heterodimer Indu 3e-05
3rfs_A272 Design Of A Binding Scaffold Based On Variable Lymp 3e-05
2omu_A462 Crystal Structure Of Inla G194s+s Y369s/hec1 Comple 4e-05
2omt_A462 Crystal Structure Of Inla G194s+sHEC1 COMPLEX Lengt 7e-05
2omx_A462 Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX 8e-05
4g8a_A635 Crystal Structure Of Human Tlr4 Polymorphic Variant 5e-04
2z63_A570 Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 A 5e-04
3fxi_A605 Crystal Structure Of The Human Tlr4-Human Md-2-E.Co 9e-04
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure

Iteration: 1

Score = 212 bits (539), Expect = 1e-54, Method: Compositional matrix adjust. Identities = 209/674 (31%), Positives = 313/674 (46%), Gaps = 58/674 (8%) Query: 196 LFEMNLERNFIGSPL--ITCLKNLTRLKILDISSNQLNGSLPSVISN---LTSLEYLDLS 250 L ++L RN + P+ +T L + + LK L++SSN L+ P +S L SLE LDLS Sbjct: 99 LTSLDLSRNSLSGPVTTLTSLGSCSGLKFLNVSSNTLD--FPGKVSGGLKLNSLEVLDLS 156 Query: 251 HNNFEGMFPLSSLANHS--KLEGLLLSTRNNTLHVKTENWLPTSQLIVLGLTKCNLNGSY 308 N+ G + + + +L+ L +S + V + L L ++ N + Sbjct: 157 ANSISGANVVGWVLSDGCGELKHLAISGNKISGDVDVSRCV---NLEFLDVSSNNFSTGI 213 Query: 309 PDFLLHQYHLKYLDLSHNKLVGNFPTWLLRNNPKLEVLLLKNNSFSGILQLPKAKHDFLH 368 P FL L++LD+S NKL G+F + + +L++L + +N F G +P L Sbjct: 214 P-FLGDCSALQHLDISGNKLSGDF-SRAISTCTELKLLNISSNQFVG--PIPPLPLKSLQ 269 Query: 369 HLDISCNNFRGKLPHNMGVILQKLMYMDISKNCFEGNIPYSAGEMKELSLLDLSRNYFSG 428 +L ++ N F G++P + L +D+S N F G +P G L L LS N FSG Sbjct: 270 YLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSG 329 Query: 429 GLSQSVVTGCFSLELLDLSNNNFEGQFFSEYMNLTRLRHLYFENNNFSGKIKDGLLSSTS 488 L + L++LDLS N F G+ NL S S Sbjct: 330 ELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNL-----------------------SAS 366 Query: 489 LQVLDISNNMLSGHI-PHWMGNFSSELEILSMSKNHLEGNVPVQLNNLERLRILDISENR 547 L LD+S+N SG I P+ N + L+ L + N G +P L+N L L +S N Sbjct: 367 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 426 Query: 548 LSGPIASSL-NLSSVEHLSLQKNALNGLIPGELFRSCKLVTLNLRDNTFSGRIPHQINEH 606 LSG I SSL +LS + L L N L G IP EL L TL L N +G IP ++ Sbjct: 427 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNC 486 Query: 607 SNLRFLLLGGNHLQGPIPDQLCQLQKLAMMDLSRNKFSGSIPPCFANVLS--WRVGSDDV 664 +NL ++ L N L G IP + +L+ LA++ LS N FSG+IP + S W + ++ Sbjct: 487 TNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNL 546 Query: 665 LNGSK-----LNSPELDEEIEFGS----LGNNRSSNTMFGMWRWLSALEKRAAIDERVEI 715 NG+ S ++ G + N+ G L R+ R+ Sbjct: 547 FNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLST 606 Query: 716 EFAMKNRYEIYNG------SNVNRVTGLDLSCNQLTGEIPSDIGQLQAILAXXXXXXXXX 769 +Y G N + LD+S N L+G IP +IG + + Sbjct: 607 RNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDIS 666 Query: 770 GSIPESFSNLKMIESLDISYNKLTGQIPPQLTALNFLSIFNVSYNNLSGRTPDKGQFATF 829 GSIP+ +L+ + LD+S NKL G+IP ++AL L+ ++S NNLSG P+ GQF TF Sbjct: 667 GSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEMGQFETF 726 Query: 830 DESSYRGNPSLCAW 843 + + NP LC + Sbjct: 727 PPAKFLNNPGLCGY 740
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|3RG1|A Chain A, Crystal Structure Of The Rp105MD-1 Complex Length = 612 Back     alignment and structure
>pdb|3A79|B Chain B, Crystal Structure Of Tlr2-Tlr6-Pam2csk4 Complex Length = 562 Back     alignment and structure
>pdb|2OMZ|A Chain A, Crystal Structure Of Inla Y369a/hec1 Complex Length = 466 Back     alignment and structure
>pdb|2OMV|A Chain A, Crystal Structure Of Inla S192n Y369s/hec1 Complex Length = 461 Back     alignment and structure
>pdb|1O6S|A Chain A, Internalin (Listeria Monocytogenes) E-Cadherin (Human) Recognition Complex Length = 466 Back     alignment and structure
>pdb|2OMY|A Chain A, Crystal Structure Of Inla S192n/hec1 Complex Length = 461 Back     alignment and structure
>pdb|2Z7X|B Chain B, Crystal Structure Of The Tlr1-Tlr2 Heterodimer Induced By Binding Of A Tri-Acylated Lipopeptide Length = 520 Back     alignment and structure
>pdb|3RFS|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 272 Back     alignment and structure
>pdb|2OMU|A Chain A, Crystal Structure Of Inla G194s+s Y369s/hec1 Complex Length = 462 Back     alignment and structure
>pdb|2OMT|A Chain A, Crystal Structure Of Inla G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMX|A Chain A, Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|4G8A|A Chain A, Crystal Structure Of Human Tlr4 Polymorphic Variant D299g And T399i In Complex With Md-2 And Lps Length = 635 Back     alignment and structure
>pdb|2Z63|A Chain A, Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 570 Back     alignment and structure
>pdb|3FXI|A Chain A, Crystal Structure Of The Human Tlr4-Human Md-2-E.Coli Lps Ra Complex Length = 605 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query933
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-168
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-82
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-76
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-75
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 6e-66
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-64
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 6e-56
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-53
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-44
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-35
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-29
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-70
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-70
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-63
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-52
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-49
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-32
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-66
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-59
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 8e-59
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-55
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-52
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-39
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 9e-33
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-16
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-09
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-64
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-58
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-55
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-52
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-15
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-09
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-08
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-60
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-59
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-59
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-50
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-41
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-40
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-34
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-18
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-16
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-57
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-54
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-50
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 7e-49
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-40
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 8e-13
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-09
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-07
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-54
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-51
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-45
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-36
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 7e-34
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-27
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-22
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 7e-22
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-21
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 6e-21
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-15
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 8e-49
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-44
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-43
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 9e-27
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-26
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-23
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-47
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-45
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-39
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 9e-28
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-27
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-21
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-07
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-05
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-43
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-41
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-40
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-31
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-30
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-25
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-23
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-14
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-12
1o6v_A466 Internalin A; bacterial infection, extracellular r 7e-39
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-35
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-32
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-17
1o6v_A466 Internalin A; bacterial infection, extracellular r 9e-07
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-06
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-06
1o6v_A 466 Internalin A; bacterial infection, extracellular r 5e-06
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-04
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-34
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-30
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-29
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-27
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-25
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-11
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-09
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-08
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-34
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-26
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-24
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-18
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 8e-16
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 8e-15
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-13
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-07
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 6e-32
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 7e-24
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-23
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-18
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 5e-10
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 6e-08
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 6e-06
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-04
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-30
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 9e-28
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-26
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 9e-24
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-23
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 6e-20
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-19
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-18
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-07
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-05
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-30
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-30
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-29
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-29
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-29
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-15
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-06
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-30
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-21
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-20
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-14
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 7e-13
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 8e-13
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 9e-12
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-11
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-05
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-28
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-25
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-23
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-22
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-21
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-15
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-28
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-27
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-25
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-23
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-23
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-21
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 8e-21
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-20
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 4e-28
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-22
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-18
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-16
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-11
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-07
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-23
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 4e-23
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-19
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-17
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 5e-07
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-04
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-23
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 9e-23
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-21
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-21
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-19
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-18
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-11
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-10
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-09
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 8e-09
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-08
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-08
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-06
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-23
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 6e-21
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-17
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-16
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-04
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-23
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-20
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-19
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-18
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 7e-18
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-14
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 9e-13
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-05
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-05
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-04
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-04
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-22
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 8e-21
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-20
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 7e-19
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-18
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-15
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 8e-21
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-16
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-13
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-13
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 9e-12
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 9e-12
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-11
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-10
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-08
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-07
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-20
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-18
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-18
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-16
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-15
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-07
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-19
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 8e-17
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-16
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-16
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-15
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-05
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-04
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 8e-04
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-19
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-19
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-18
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-18
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-18
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-17
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-16
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-15
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-07
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-06
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 9e-06
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 9e-05
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-04
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-19
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 5e-19
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-17
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-16
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-15
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-13
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-19
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 5e-18
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-17
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-17
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-17
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-17
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-15
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-14
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-13
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-13
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 8e-11
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 1e-05
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 5e-19
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-18
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 9e-18
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-17
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-17
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 5e-17
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-15
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 7e-14
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 8e-13
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-09
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 5e-09
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-18
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-16
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-16
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 7e-16
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-14
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 8e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-17
4ezg_A197 Putative uncharacterized protein; internalin-A, le 7e-16
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-15
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-13
4ezg_A197 Putative uncharacterized protein; internalin-A, le 8e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-05
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 2e-16
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 4e-14
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 3e-13
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 3e-13
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 8e-13
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 3e-11
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 7e-05
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-04
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 5e-04
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-16
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 8e-16
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-14
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-14
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-13
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-12
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-11
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-11
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 6e-08
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-04
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 4e-16
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-15
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-13
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 4e-13
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 4e-11
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 3e-09
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-05
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 6e-16
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-14
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-13
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-12
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-04
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 3e-15
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 3e-06
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 1e-05
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-05
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 5e-15
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 7e-11
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 8e-11
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 9e-11
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-10
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 8e-08
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-04
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 6e-04
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-14
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-13
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-12
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-08
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 9e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-13
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-08
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-08
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 7e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 8e-04
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-12
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-11
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-09
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 5e-09
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 6e-09
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-08
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-07
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 8e-05
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-12
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-09
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-08
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-06
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 6e-05
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-05
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 4e-12
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 6e-12
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 6e-10
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-09
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 3e-09
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 8e-12
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-11
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 5e-10
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-09
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 6e-06
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 7e-06
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 9e-11
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-05
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-10
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 7e-09
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-08
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-06
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 7e-05
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-04
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 6e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-10
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 6e-10
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-08
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-09
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 7e-09
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-08
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-08
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-08
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 8e-08
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-06
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 5e-05
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 7e-05
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-09
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-04
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 4e-09
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 3e-06
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 9e-05
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 9e-09
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 3e-08
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 6e-06
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 4e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-08
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-08
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 8e-07
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 4e-08
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-07
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 6e-07
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 7e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 8e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 2e-07
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 8e-07
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 9e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 8e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 5e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 4e-07
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-05
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 1e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 4e-04
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 4e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 6e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 5e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 5e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 6e-04
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 1e-06
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 4e-05
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-05
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 4e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 4e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 1e-04
3m19_A251 Variable lymphocyte receptor A diversity region; a 8e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  507 bits (1308), Expect = e-168
 Identities = 204/848 (24%), Positives = 319/848 (37%), Gaps = 147/848 (17%)

Query: 27  ACLETERTALLQIKSFFISASDIEYKDSILSSWVDDDDDDGMPSDCCHWQRVKCNATTGR 86
             L  E   L+  K             ++L  W  +        + C +  V C     +
Sbjct: 8   QSLYREIHQLISFKDVLPD-------KNLLPDWSSN-------KNPCTFDGVTCR--DDK 51

Query: 87  VMQLSLKNTTRLNYPYDWFPLLNMSLFHPLEELQSLDLSVNIFTYDSKVAAYDSLRSLKQ 146
           V  + L +   LN  +        S    L  L+SL LS +         +    +    
Sbjct: 52  VTSIDLSS-KPLNVGFSAVS----SSLLSLTGLESLFLSNSHING-----SVSGFKCSAS 101

Query: 147 LKILVLGHNYFDDSIFSY--LNTLPSLCTLILHWNRIEGSQTNQGICELKNLFEMNLERN 204
           L  L L  N     + +   L +   L  L +  N ++      G  +L +L  ++L  N
Sbjct: 102 LTSLDLSRNSLSGPVTTLTSLGSCSGLKFLNVSSNTLDFPGKVSGGLKLNSLEVLDLSAN 161

Query: 205 FIGSPL---ITCLKNLTRLKILDISSNQLNGSLPSVISNLTSLEYLDLSHNNFEGMFPLS 261
            I                LK L IS N+++G +   +S   +LE+LD+S NNF    P  
Sbjct: 162 SISGANVVGWVLSDGCGELKHLAISGNKISGDVD--VSRCVNLEFLDVSSNNFSTGIP-- 217

Query: 262 SLANHSKLEGLLLSTRNNTLHVKTENWLPTSQLIVLGLTKCNLNGSYPDFLLHQYHLKYL 321
            L + S L+ L +S                            L+G +   +     LK L
Sbjct: 218 FLGDCSALQHLDISG-------------------------NKLSGDFSRAISTCTELKLL 252

Query: 322 DLSHNKLVGNFPTWLLRNNPKLEVLLLKNNSFSGILQLPKAKHDFLHHLDISCNNFRGKL 381
           ++S N+ VG  P   L++                           L +L ++ N F G++
Sbjct: 253 NISSNQFVGPIPPLPLKS---------------------------LQYLSLAENKFTGEI 285

Query: 382 PHNMGVILQKLMYMDISKNCFEGNIPYSAGEMKELSLLDLSRNYFSGGLSQSVVTGCFSL 441
           P  +      L  +D+S N F G +P   G    L  L LS N FSG L    +     L
Sbjct: 286 PDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGL 345

Query: 442 ELLDLSNNNFEGQFFSEYMNLT-RLRHLYFENNNFSGKI--KDGLLSSTSLQVLDISNNM 498
           ++LDLS N F G+      NL+  L  L   +NNFSG I          +LQ L + NN 
Sbjct: 346 KVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNG 405

Query: 499 LSGHIPHWMGNFSSELEILSMSKNHLEGNVPVQLNNLERLRILDISENRLSGPIASSL-N 557
            +G IP  + N S  L  L +S N+L G +P  L +L +LR L +  N L G I   L  
Sbjct: 406 FTGKIPPTLSNCSE-LVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMY 464

Query: 558 LSSVEHLSLQKNALNGLIPGELFRSCKLVTLNLRDNTFSGRIPHQINEHSNLRFLLLGGN 617
           + ++E L L  N L G IP  L     L  ++L +N  +G IP  I    NL  L L  N
Sbjct: 465 VKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNN 524

Query: 618 HLQGPIPDQLCQLQKLAMMDLSRNKFSGSIPPCFANVLSWRVGSDDVLNGSKLNSPELDE 677
              G IP +L   + L  +DL+ N F+G+IP                             
Sbjct: 525 SFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSG--------------------- 563

Query: 678 EIEFGSLGNNRSSNTMFGMWRWLSALEKRAAIDERVEIEFAMKNRYEIYNGSNVNRVTGL 737
                 +  N  +   +   +     ++         +EF      ++   S  N     
Sbjct: 564 -----KIAANFIAGKRYVYIKNDGMKKEC--HGAGNLLEFQGIRSEQLNRLSTRNP---C 613

Query: 738 DLSCNQLTGEIPSDIGQLQAILALNLSNNSLSGSIPESFSNLKMIESLDISYNKLTGQIP 797
           +++     G          +++ L++S N LSG IP+   ++  +  L++ +N ++G IP
Sbjct: 614 NITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIP 673

Query: 798 PQLTALNFLSIFNVSYNNLS------------------------GRTPDKGQFATFDESS 833
            ++  L  L+I ++S N L                         G  P+ GQF TF  + 
Sbjct: 674 DEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEMGQFETFPPAK 733

Query: 834 YRGNPSLC 841
           +  NP LC
Sbjct: 734 FLNNPGLC 741


>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query933
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.98
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.98
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.98
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.97
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.96
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.96
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.96
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.96
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.96
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.95
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.95
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.95
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.95
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.94
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.94
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.94
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.94
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.94
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.94
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.94
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.94
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.94
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.94
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.93
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.93
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.93
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.93
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.92
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.92
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.92
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.92
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.91
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.9
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.9
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.89
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.89
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.89
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.89
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.88
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.88
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.88
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.87
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.86
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.86
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.86
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.85
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.85
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.85
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.84
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.84
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.84
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.84
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.83
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.82
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.8
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.79
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.79
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.77
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.77
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.77
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.76
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.75
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.75
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.74
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.74
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.74
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.73
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.73
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.72
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.72
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.71
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.71
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.7
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.7
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.69
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.69
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.68
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.68
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.65
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.64
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.63
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.63
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.62
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.58
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.58
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.57
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.56
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.55
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.54
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.52
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.52
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.49
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.49
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.49
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.48
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.46
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.44
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.43
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.42
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.41
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.4
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.39
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.37
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.25
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.19
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.18
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.17
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.17
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.14
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.96
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.88
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.69
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.68
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.67
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.59
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.28
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.24
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.97
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.83
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.67
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.28
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.91
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.53
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=1.6e-91  Score=856.58  Aligned_cols=716  Identities=31%  Similarity=0.458  Sum_probs=575.9

Q ss_pred             CCCCChHHHHHHHHHhhhhcccccccccCCCCCCCCCCCCCCCCCCCCCcccceeEecCCCCcEEEEecCCCCCCCCCCC
Q 002350           24 GYKACLETERTALLQIKSFFISASDIEYKDSILSSWVDDDDDDGMPSDCCHWQRVKCNATTGRVMQLSLKNTTRLNYPYD  103 (933)
Q Consensus        24 ~~~~~~~~~~~~ll~~k~~~~~~~~~~~~~~~l~~W~~~~~~~~~~~~~C~w~gv~c~~~~~~V~~l~l~~~~~l~l~~~  103 (933)
                      +++.+.++||+|||+||+++.++      . .+++| +.+      ++||+|+||+|+  +|||++++|++...   .|.
T Consensus         5 ~~~~~~~~~~~all~~k~~~~~~------~-~l~~W-~~~------~~~C~w~gv~C~--~~~v~~L~L~~~~l---~g~   65 (768)
T 3rgz_A            5 SPSQSLYREIHQLISFKDVLPDK------N-LLPDW-SSN------KNPCTFDGVTCR--DDKVTSIDLSSKPL---NVG   65 (768)
T ss_dssp             ---CCHHHHHHHHHHHHTTCSCT------T-SSTTC-CTT------SCGGGSTTEEEE--TTEEEEEECTTSCC---CEE
T ss_pred             ccccCCHHHHHHHHHHHhhCCCc------c-cccCC-CCC------CCCcCCcceEEC--CCcEEEEECCCCCc---CCc
Confidence            34566899999999999999643      4 89999 644      689999999998  69999999998764   332


Q ss_pred             CcccccccccCCCCCCCEeeCCCCCCccccCccccccCCCCCCCCEEeCCCCcCCCcchh--hhcCCCCCCEEecCCCcc
Q 002350          104 WFPLLNMSLFHPLEELQSLDLSVNIFTYDSKVAAYDSLRSLKQLKILVLGHNYFDDSIFS--YLNTLPSLCTLILHWNRI  181 (933)
Q Consensus       104 ~~~~~~~~~f~~l~~L~~LdLs~n~~~~~~~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~--~l~~l~~L~~L~Ls~n~i  181 (933)
                      . ..+ ++.|.++++|+.++++.+.+.. .+    ..++++++|++|+|++|.+++.+|.  .++++++|++|+|++|.+
T Consensus        66 ~-~~l-~~~l~~L~~L~~l~~~~~~~~~-l~----~~~~~l~~L~~L~Ls~n~l~~~~~~~~~l~~l~~L~~L~Ls~n~l  138 (768)
T 3rgz_A           66 F-SAV-SSSLLSLTGLESLFLSNSHING-SV----SGFKCSASLTSLDLSRNSLSGPVTTLTSLGSCSGLKFLNVSSNTL  138 (768)
T ss_dssp             H-HHH-HHHTTTCTTCCEEECTTSCEEE-CC----CCCCCCTTCCEEECCSSEEEEEGGGGGGGGGCTTCCEEECCSSEE
T ss_pred             c-Ccc-ChhHhccCcccccCCcCCCcCC-Cc----hhhccCCCCCEEECCCCcCCCcCCChHHHhCCCCCCEEECcCCcc
Confidence            0 012 2467888999999999886532 22    5789999999999999999998888  899999999999999999


Q ss_pred             cCccChhhhcCCCCCCEEECCCCCCCCcchhh---cCCCCCCCEEEccCCcCCCCCchhccCCCCCCEEECCCCcCCCCC
Q 002350          182 EGSQTNQGICELKNLFEMNLERNFIGSPLITC---LKNLTRLKILDISSNQLNGSLPSVISNLTSLEYLDLSHNNFEGMF  258 (933)
Q Consensus       182 ~~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~---l~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~  258 (933)
                      .+..+...+.++++|++|+|++|.+++..+..   +.++++|++|++++|.+++..|.  .++++|++|++++|.+++.+
T Consensus       139 ~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~--~~l~~L~~L~Ls~n~l~~~~  216 (768)
T 3rgz_A          139 DFPGKVSGGLKLNSLEVLDLSANSISGANVVGWVLSDGCGELKHLAISGNKISGDVDV--SRCVNLEFLDVSSNNFSTGI  216 (768)
T ss_dssp             ECCSSCCSCCCCTTCSEEECCSSCCEEETHHHHHHTTCCTTCCEEECCSSEEESCCBC--TTCTTCCEEECCSSCCCSCC
T ss_pred             CCcCCHHHhccCCCCCEEECCCCccCCcCChhhhhhccCCCCCEEECCCCcccccCCc--ccCCcCCEEECcCCcCCCCC
Confidence            98877554589999999999999999888877   88999999999999999877664  78999999999999998766


Q ss_pred             ChhhhhcCCCCceEecccccCccccccCCCCCCCcceEEEccCCCCCCCCchhhhCCCCCCEEEccCCCCcccchhHHHh
Q 002350          259 PLSSLANHSKLEGLLLSTRNNTLHVKTENWLPTSQLIVLGLTKCNLNGSYPDFLLHQYHLKYLDLSHNKLVGNFPTWLLR  338 (933)
Q Consensus       259 ~~~~l~~l~~L~~L~L~~~~~~~~~~~~~~~~~~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~  338 (933)
                      |.  +++                         +++|++|++++|.+++.+|..+..+++|++|++++|.+++.+|..   
T Consensus       217 ~~--l~~-------------------------l~~L~~L~Ls~n~l~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~---  266 (768)
T 3rgz_A          217 PF--LGD-------------------------CSALQHLDISGNKLSGDFSRAISTCTELKLLNISSNQFVGPIPPL---  266 (768)
T ss_dssp             CB--CTT-------------------------CCSCCEEECCSSCCCSCHHHHTTTCSSCCEEECCSSCCEESCCCC---
T ss_pred             cc--ccc-------------------------CCCCCEEECcCCcCCCcccHHHhcCCCCCEEECCCCcccCccCcc---
Confidence            62  444                         445556677777777778888888888888888888888777764   


Q ss_pred             CCCCCCEEEcCCCCCcCcCcCCccc-CCCccEEEccCCcCCCCCChhhhhcCCCccEEEccCCCCCCCcccc-ccCCCCC
Q 002350          339 NNPKLEVLLLKNNSFSGILQLPKAK-HDFLHHLDISCNNFRGKLPHNMGVILQKLMYMDISKNCFEGNIPYS-AGEMKEL  416 (933)
Q Consensus       339 ~l~~L~~L~L~~n~l~~~~~~~~~~-~~~L~~L~Ls~n~l~~~~p~~~~~~l~~L~~L~Ls~n~l~~~~p~~-l~~l~~L  416 (933)
                      .+++|++|++++|.+++..+..+.. +++|++|++++|++++.+|..+. .+++|++|++++|.+.+.+|.. +..+++|
T Consensus       267 ~l~~L~~L~L~~n~l~~~ip~~~~~~~~~L~~L~Ls~n~l~~~~p~~~~-~l~~L~~L~L~~n~l~~~ip~~~l~~l~~L  345 (768)
T 3rgz_A          267 PLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFG-SCSLLESLALSSNNFSGELPMDTLLKMRGL  345 (768)
T ss_dssp             CCTTCCEEECCSSEEEESCCCCSCTTCTTCSEEECCSSEEEECCCGGGG-GCTTCCEEECCSSEEEEECCHHHHTTCTTC
T ss_pred             ccCCCCEEECcCCccCCccCHHHHhhcCcCCEEECcCCcCCCccchHHh-cCCCccEEECCCCcccCcCCHHHHhcCCCC
Confidence            6788888888888887554444443 48888888888888877787775 4888888888888888777765 7888888


Q ss_pred             CEEEcCCCcCCCCcchhhhcCCCCCCEEECcCCcCCCcCchhhcc--cCcCCeEEccCccccccccccccCCCCCCEEEc
Q 002350          417 SLLDLSRNYFSGGLSQSVVTGCFSLELLDLSNNNFEGQFFSEYMN--LTRLRHLYFENNNFSGKIKDGLLSSTSLQVLDI  494 (933)
Q Consensus       417 ~~L~Ls~n~l~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~--l~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~L  494 (933)
                      ++|++++|++.+.+|..+....++|++|++++|.+.+.++..+..  +++|++|++++|.+++.+|..+..+++|++|++
T Consensus       346 ~~L~Ls~n~l~~~~p~~l~~l~~~L~~L~Ls~N~l~~~~~~~~~~~~~~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L  425 (768)
T 3rgz_A          346 KVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHL  425 (768)
T ss_dssp             CEEECCSSEEEECCCTTHHHHTTTCSEEECCSSEEEEECCTTTTCSTTCCCCEEECCSSEEEEECCGGGGGCTTCCEEEC
T ss_pred             CEEeCcCCccCccccHHHHhhhcCCcEEEccCCCcCCCcChhhhhcccCCccEEECCCCccccccCHHHhcCCCCCEEEC
Confidence            888888888887777766432338888888888888877777766  778888888888888888888888888888888


Q ss_pred             cCCcCCCCChhhHhhhccccceeecCCCcCCCCcchhccCCCCCCEEEccCCcCccccCccc-cCCCCceEEeecCcCcc
Q 002350          495 SNNMLSGHIPHWMGNFSSELEILSMSKNHLEGNVPVQLNNLERLRILDISENRLSGPIASSL-NLSSVEHLSLQKNALNG  573 (933)
Q Consensus       495 s~n~l~~~~p~~l~~~~~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~-~l~~L~~L~L~~n~l~~  573 (933)
                      ++|++++.+|..+..++. |+.|++++|++++.+|..+..+++|++|++++|++++.+|..+ .+++|++|++++|++++
T Consensus       426 s~N~l~~~~p~~l~~l~~-L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~L~~N~l~~  504 (768)
T 3rgz_A          426 SFNYLSGTIPSSLGSLSK-LRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTG  504 (768)
T ss_dssp             CSSEEESCCCGGGGGCTT-CCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCS
T ss_pred             cCCcccCcccHHHhcCCC-CCEEECCCCcccCcCCHHHcCCCCceEEEecCCcccCcCCHHHhcCCCCCEEEccCCccCC
Confidence            888888888888888876 8888888888888888888888888888888888888888777 78888888888888888


Q ss_pred             cCchhhccCCCccEEeCcCCcCcccCchhhhcCCCccEEEcCCCcCCCCCchhhhcCCCCCEEEccC---------Cc--
Q 002350          574 LIPGELFRSCKLVTLNLRDNTFSGRIPHQINEHSNLRFLLLGGNHLQGPIPDQLCQLQKLAMMDLSR---------NK--  642 (933)
Q Consensus       574 ~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~Ls~---------N~--  642 (933)
                      .+|..+..+++|++|++++|++++.+|..++.+++|++|++++|+++|.+|..+.....+..+++..         +.  
T Consensus       505 ~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~g~ip~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  584 (768)
T 3rgz_A          505 EIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMK  584 (768)
T ss_dssp             CCCGGGGGCTTCCEEECCSSCCEEECCGGGGGCTTCCEEECCSSEEESBCCGGGGTTTTCBCCSTTCSCEEEEEECCSCC
T ss_pred             cCChHHhcCCCCCEEECCCCcccCcCCHHHcCCCCCCEEECCCCccCCcCChHHhcccchhhhhcccccccccccccccc
Confidence            8888888888888899988888888888888888888999998888888888887766655444333         11  


Q ss_pred             -----------CCCCCCchhhhhhccccCCCCccCCCCCCCCCccchhhcccCCCCCCCccccchhhhhhhhhhhhhchh
Q 002350          643 -----------FSGSIPPCFANVLSWRVGSDDVLNGSKLNSPELDEEIEFGSLGNNRSSNTMFGMWRWLSALEKRAAIDE  711 (933)
Q Consensus       643 -----------l~g~~p~~~~~l~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~l~~~~~~~~  711 (933)
                                 +.|..|..+..+......                              .+....               
T Consensus       585 ~~~~~~~~~~~~~~~~~~~~~~l~~~~~~------------------------------~l~~~~---------------  619 (768)
T 3rgz_A          585 KECHGAGNLLEFQGIRSEQLNRLSTRNPC------------------------------NITSRV---------------  619 (768)
T ss_dssp             TTCCSSEEEEECTTCCGGGGGGGGGTCCS------------------------------CTTSCE---------------
T ss_pred             ccccccccccccccccchhhhcccccccc------------------------------ccccce---------------
Confidence                       222233222222110000                              000000               


Q ss_pred             hhHHhhhhccceeeecCCCCCcccEEEcCCCcCCCCCChhhhhccccCeeeccccccccccchhccCCCCCCEEECcCCe
Q 002350          712 RVEIEFAMKNRYEIYNGSNVNRVTGLDLSCNQLTGEIPSDIGQLQAILALNLSNNSLSGSIPESFSNLKMIESLDISYNK  791 (933)
Q Consensus       712 ~~~~~~~~~~~~~~~~~~~l~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~LdLs~N~  791 (933)
                             ..+.. ......++.|+.|||++|+++|.+|.+++++++|+.|+|++|+++|.+|..|+++++|++||||+|+
T Consensus       620 -------~~g~~-~~~~~~l~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~Ls~N~l~g~ip~~l~~L~~L~~LdLs~N~  691 (768)
T 3rgz_A          620 -------YGGHT-SPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNK  691 (768)
T ss_dssp             -------EEEEC-CCSCSSSBCCCEEECCSSCCBSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSC
T ss_pred             -------ecccC-chhhhccccccEEECcCCcccccCCHHHhccccCCEEeCcCCccCCCCChHHhCCCCCCEEECCCCc
Confidence                   00000 0011346789999999999999999999999999999999999999999999999999999999999


Q ss_pred             ecccCCcCCcCCCCCCeEEccCCcCcccCCCCCcCCccCcccccCCCCCCCccccCCCCCCC
Q 002350          792 LTGQIPPQLTALNFLSIFNVSYNNLSGRTPDKGQFATFDESSYRGNPSLCAWLIQQKYSRTL  853 (933)
Q Consensus       792 l~~~ip~~l~~l~~L~~L~ls~N~l~g~~p~~~~~~~~~~~~~~gN~~lc~~~l~~~~~~~~  853 (933)
                      ++|.||..+..+++|++||+++|+++|.||.+++|.+|+..+|.|||++||.|+. .|....
T Consensus       692 l~g~ip~~l~~l~~L~~L~ls~N~l~g~iP~~~~~~~~~~~~~~gN~~Lcg~~l~-~C~~~~  752 (768)
T 3rgz_A          692 LDGRIPQAMSALTMLTEIDLSNNNLSGPIPEMGQFETFPPAKFLNNPGLCGYPLP-RCDPSN  752 (768)
T ss_dssp             CEECCCGGGGGCCCCSEEECCSSEEEEECCSSSSGGGSCGGGGCSCTEEESTTSC-CCCSCC
T ss_pred             ccCcCChHHhCCCCCCEEECcCCcccccCCCchhhccCCHHHhcCCchhcCCCCc-CCCCCc
Confidence            9999999999999999999999999999999999999999999999999999876 786544



>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 933
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 8e-20
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-15
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-13
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-10
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 7e-08
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 6e-16
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-14
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 8e-13
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-12
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-10
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-10
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-07
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-05
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 9e-16
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-15
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-14
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 9e-13
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-12
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-12
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 7e-06
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 7e-04
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-11
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-11
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 6e-10
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 6e-10
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 8e-10
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 3e-07
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 5e-07
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-10
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-08
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 8e-08
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-06
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-09
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-08
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 4e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 3e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 3e-08
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 8e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 3e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.001
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.002
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-07
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 3e-07
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 4e-07
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 3e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 7e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 4e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 7e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.004
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 3e-06
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 6e-06
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.001
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 4e-06
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.002
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 4e-06
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 7e-04
d1m9la_198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 3e-05
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 4e-05
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 9e-05
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 1e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 8e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.001
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 9e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 5e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 8e-04
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
 Score = 90.4 bits (223), Expect = 8e-20
 Identities = 67/386 (17%), Positives = 116/386 (30%), Gaps = 30/386 (7%)

Query: 193 LKNLFEMNLERNFIGSPLITCLKNLTRLKILDISSNQLNGSLPSVISNLTSLEYLDLSHN 252
           L    +  L +  +   +     +L ++  L      +  S+   +  L +L  ++ S+N
Sbjct: 21  LAEKMKTVLGKTNVTDTVS--QTDLDQVTTLQADRLGIK-SIDG-VEYLNNLTQINFSNN 76

Query: 253 NFEGMFPLSSLANHSKLEGLLLSTRNNTLHVKTENWLPTSQLIVLGLTKCNLNGSYPDFL 312
               + PL +L     +        + T      N    +           L        
Sbjct: 77  QLTDITPLKNLTKLVDILMNNNQIADITPLANLTNLTGLTLFNNQITDIDPLKNLTNLNR 136

Query: 313 LHQYHLKYLDLSHNKLVGNFPTWLLRNNPKLEVLLLKNNSF--------SGILQLPKAKH 364
           L        D+S    + +       N       L    +                 AK 
Sbjct: 137 LELSSNTISDISALSGLTSLQQLSFGNQVTDLKPLANLTTLERLDISSNKVSDISVLAKL 196

Query: 365 DFLHHLDISCNNFRGKLPHNMGVILQKLMYMDISKNCFEGNIPYSAGEMKELSLLDLSRN 424
             L  L  + N      P  +   L +L    ++ N  +     +   +  L+ LDL+ N
Sbjct: 197 TNLESLIATNNQISDITPLGILTNLDEL---SLNGNQLKD--IGTLASLTNLTDLDLANN 251

Query: 425 YFSGGLSQSVVTGCFSLELLDLSNNNFEGQFFSEYMNLTRLRHLYFENNNFSGKIKDGLL 484
             S     S   G   L  L L  N       S    LT L +L    N          L
Sbjct: 252 QISNLAPLS---GLTKLTELKLGANQISN--ISPLAGLTALTNLELNENQLEDISPISNL 306

Query: 485 SSTSLQVLDISNNMLSGHIPHWMGNFSSELEILSMSKNHLEGNVPVQLNNLERLRILDIS 544
              +L  L +  N +S   P  + + +  L+ L  + N +       L NL  +  L   
Sbjct: 307 --KNLTYLTLYFNNISDISP--VSSLTK-LQRLFFANNKVSD--VSSLANLTNINWLSAG 359

Query: 545 ENRLSGPIASSLNLSSVEHLSLQKNA 570
            N++S     + NL+ +  L L   A
Sbjct: 360 HNQISDLTPLA-NLTRITQLGLNDQA 384


>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query933
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.97
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.95
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.94
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.91
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.9
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.89
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.89
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.87
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.86
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.77
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.76
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.75
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.75
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.7
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.7
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.65
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.65
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.65
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.64
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.62
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.62
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.6
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.59
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.56
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.55
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.42
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.39
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.39
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.39
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.39
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.37
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.3
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.25
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.11
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.0
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.37
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.06
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.0
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.83
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.56
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.23
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=100.00  E-value=2.5e-36  Score=325.95  Aligned_cols=295  Identities=26%  Similarity=0.376  Sum_probs=189.1

Q ss_pred             CChHHHHHHHHHhhhhcccccccccCCCCCCCCCCCCCCCCCCCCCcc--cceeEecCCC--CcEEEEecCCCCCCCCCC
Q 002350           27 ACLETERTALLQIKSFFISASDIEYKDSILSSWVDDDDDDGMPSDCCH--WQRVKCNATT--GRVMQLSLKNTTRLNYPY  102 (933)
Q Consensus        27 ~~~~~~~~~ll~~k~~~~~~~~~~~~~~~l~~W~~~~~~~~~~~~~C~--w~gv~c~~~~--~~V~~l~l~~~~~l~l~~  102 (933)
                      -|.++||+||++||+++.++       ..+++| ..+      +|||.  |.||+|+..+  +||++|+|++...   +|
T Consensus         2 ~c~~~e~~aLl~~k~~~~~~-------~~l~sW-~~~------~d~C~~~w~gv~C~~~~~~~~v~~L~L~~~~l---~g   64 (313)
T d1ogqa_           2 LCNPQDKQALLQIKKDLGNP-------TTLSSW-LPT------TDCCNRTWLGVLCDTDTQTYRVNNLDLSGLNL---PK   64 (313)
T ss_dssp             CSCHHHHHHHHHHHHHTTCC-------GGGTTC-CTT------SCTTTTCSTTEEECCSSSCCCEEEEEEECCCC---SS
T ss_pred             CCCHHHHHHHHHHHHHCCCC-------CcCCCC-CCC------CCCCCCcCCCeEEeCCCCcEEEEEEECCCCCC---CC
Confidence            59999999999999999653       368999 655      68994  9999998643  4899999988754   33


Q ss_pred             CCcccccccccCCCCCCCEeeCCC-CCCccccCccccccCCCCCCCCEEeCCCCcCCCcchhhhcCCCCCCEEecCCCcc
Q 002350          103 DWFPLLNMSLFHPLEELQSLDLSV-NIFTYDSKVAAYDSLRSLKQLKILVLGHNYFDDSIFSYLNTLPSLCTLILHWNRI  181 (933)
Q Consensus       103 ~~~~~~~~~~f~~l~~L~~LdLs~-n~~~~~~~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~l~~l~~L~~L~Ls~n~i  181 (933)
                      ..  .+ ++.+.++++|++|||++ |.+.|.+|    ..++++++|++|+|++|++.+..+..+..+.+|+++++++|.+
T Consensus        65 ~~--~l-p~~l~~L~~L~~L~Ls~~N~l~g~iP----~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l~l~~N~~  137 (313)
T d1ogqa_          65 PY--PI-PSSLANLPYLNFLYIGGINNLVGPIP----PAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNAL  137 (313)
T ss_dssp             CE--EC-CGGGGGCTTCSEEEEEEETTEESCCC----GGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSEE
T ss_pred             CC--CC-ChHHhcCccccccccccccccccccc----cccccccccchhhhccccccccccccccchhhhcccccccccc
Confidence            21  11 23566666777777765 56666665    5566666666666666666666666666666666666666666


Q ss_pred             cCccChhhhcCCCCCCEEECCCCCCCCcchhhcCCCCCC-CEEEccCCcCCCCCchhccCCCCCCEEECCCCcCCCCCCh
Q 002350          182 EGSQTNQGICELKNLFEMNLERNFIGSPLITCLKNLTRL-KILDISSNQLNGSLPSVISNLTSLEYLDLSHNNFEGMFPL  260 (933)
Q Consensus       182 ~~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~l~~l~~L-~~L~Ls~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~~~  260 (933)
                      .+..| ..+.++++|+++++++|.+.+.+|..+..+.++ +.+++++|++++..|..+..+..+ .++++.+...+.+| 
T Consensus       138 ~~~~p-~~l~~l~~L~~l~l~~n~l~~~ip~~~~~l~~l~~~l~~~~n~l~~~~~~~~~~l~~~-~l~l~~~~~~~~~~-  214 (313)
T d1ogqa_         138 SGTLP-PSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLNLA-FVDLSRNMLEGDAS-  214 (313)
T ss_dssp             ESCCC-GGGGGCTTCCEEECCSSCCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGGCCCS-EEECCSSEEEECCG-
T ss_pred             cccCc-hhhccCcccceeeccccccccccccccccccccccccccccccccccccccccccccc-cccccccccccccc-
Confidence            65555 456666666666666666666666666665554 566666666666666665555433 56666666555444 


Q ss_pred             hhhhcCCCCceEecccccCccccccCCCCCCCcceEEEccCCCCCCCCchhhhCCCCCCEEEccCCCCcccchhHHHhCC
Q 002350          261 SSLANHSKLEGLLLSTRNNTLHVKTENWLPTSQLIVLGLTKCNLNGSYPDFLLHQYHLKYLDLSHNKLVGNFPTWLLRNN  340 (933)
Q Consensus       261 ~~l~~l~~L~~L~L~~~~~~~~~~~~~~~~~~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~~l  340 (933)
                      ..+..                         +..++.+++.+|.+.+.+| .+..+++|+.|+|++|+++|.+|.++. ++
T Consensus       215 ~~~~~-------------------------~~~l~~l~~~~~~l~~~~~-~~~~~~~L~~L~Ls~N~l~g~iP~~l~-~L  267 (313)
T d1ogqa_         215 VLFGS-------------------------DKNTQKIHLAKNSLAFDLG-KVGLSKNLNGLDLRNNRIYGTLPQGLT-QL  267 (313)
T ss_dssp             GGCCT-------------------------TSCCSEEECCSSEECCBGG-GCCCCTTCCEEECCSSCCEECCCGGGG-GC
T ss_pred             ccccc-------------------------ccccccccccccccccccc-ccccccccccccCccCeecccCChHHh-CC
Confidence            23333                         4455555566666555433 455566666666666666666666653 56


Q ss_pred             CCCCEEEcCCCCCcCcCcCCcccCCCccEEEccCCc
Q 002350          341 PKLEVLLLKNNSFSGILQLPKAKHDFLHHLDISCNN  376 (933)
Q Consensus       341 ~~L~~L~L~~n~l~~~~~~~~~~~~~L~~L~Ls~n~  376 (933)
                      ++|++|+|++|++++..+ .+..+++|+.+++++|+
T Consensus       268 ~~L~~L~Ls~N~l~g~iP-~~~~L~~L~~l~l~~N~  302 (313)
T d1ogqa_         268 KFLHSLNVSFNNLCGEIP-QGGNLQRFDVSAYANNK  302 (313)
T ss_dssp             TTCCEEECCSSEEEEECC-CSTTGGGSCGGGTCSSS
T ss_pred             CCCCEEECcCCcccccCC-CcccCCCCCHHHhCCCc
Confidence            666666666666664321 23456666666677665



>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure