Citrus Sinensis ID: 002428

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920---
MGRKKPSVRDEANLPAVAQGGGKSKKKAVVIDDDEYSIGTELTEEPQEEEAVNNNKKKKGKKGNQKNLQAEDDDSKGEEGEENDAEAIVFTGKKKSKGKKNGGNNALSKSAFELLEGADKDDDDDDSGDKLSKGKYVSLASKGKTKEGLKKGWNKSGSLFAAAAFDAVDGGSESEVIDDDHSVEESDDDDDDVVEKSKKGGKKKSGTTGFSASAFDLLDDEDEDVREDKDEEDEPVIFTDKKKKSKKSGKNSSTFDLLVNENDDVKEDKDEDDEPITFTDKKKKSNKGGRMRSSAFDLLENEDEDDDEKKDKDEEDEPIIFTDKKKKTKSSKKTVSSFSEVLLDEENVVEDAPVLSDVSGAVDTKQQSGDSSIVESDDFKVNKGEVVAQTSKNKKKKKEKEKPRSERTAQEEDDLEKILAELGQGPAPQEEKVQVQPPEPVAPPDAADEKVGEEEKEESAASKKKKKKKEKEKEKKAAAAAAAEDKQQGKSEAVETKKNDGKSKGPEKKMSKQVREMQEALARRKEAEERKKREEEERLRKEEEERKRLEELERQAEEAKRRKKEKEKEKLLKKKQEGKLLTGKQKEEARRLEAMRNQFLAKGIPLPTGDKEAASKRPKYQTKKKSAHHQANGAVPLKEDSIESKEKEQEKQETLLEVDVGETEKVEEGESLTVEEKPEIADAPKENEVEEEDDDDDEEWDAKSWDDVNLNVKGAFDDEEADSEPEPLVKKEIKSAIPSPRDAAEKPAVAVKKAIPEQPLKSQDAVTRKKEPAAKSKEPEVDATPKQAEENLRSPICCIMGHVDTGKTKLLDCIRGTNVQEGEAGGITQQIGATYFPAENIRERTRELKANATLKVPGLLVIDTPGHESFTNLRSRGSGLCDIAILVVDIMHGLEPQTIESLNLLKMRNTEFIVALNKVRFSF
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHcccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccHHcccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcccccccccccccHHHHHHHHHHHHcccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHccccccccccccccHHHHHHHHHHHHHHHHccccccHHHHcccccccccccccccccccccccccccccHHHHHHccccccccccccccccccccccccccHHHHccccccccHHHccccccccccccccccccHHHHHHHHcccccccccccccccccHHHHcccccEEEEEccccccccHHHHHHHccccccccccccccccccEEEccHHHHHHHHHHHHccccccccEEEEccccHHHHHHHHHcccccccEEEEEEEccccccHHHHHHHHHHHHccccEEEEEEcccccc
cccccccccccccccccccccccccccEEEEcccccEEccEcccccccEEEEEccccccccccccccccccccccccccccccccHHEEEcccEccccccccccccHHHHHHHHHcccccccccccccccccccccEEEEEccccccccccccccccHHHHHHHHHHcccccccccccccccccccccccccEEEEEcccccccccccccEEEEEcccccccHHcccccccccccEEEEcccccccccccccccHHHHcccccccccccccccccEEEEcEEccccccccccHHHHHHccccccccccccccccccccEEEcccccccccccccEEEEEccccccccccccccccccccccEEccccccccccccccccccccccEEEEccccccEEEEccccccccccccHHHHHHHHHHccccccccHHHHcccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccHHHHHHcccHHHHHccHHHccccccccHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccHHHHHHcccHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHcccEEEEEcHHHHHHHHHHHcccHHHccccccEEEEEEcccccHHHHHHHHHHccccccccccccEEEcEEEEEcccccccHHHHHccccccccEEEEEccccHHHHHHHHHccccccEEEEEEEEccccccHHHHHHHHHHHHccccEEEEEEcccccc
mgrkkpsvrdeanlpavaqgggkskkkavvidddeysigtelteepqeeeavnnnkkkkgkkgnqknlqaedddskgeegeendAEAIVFTGkkkskgkknggnnalSKSAFELLegadkddddddsgdklskgkyvslaskgktkeglkkgwnksGSLFAAAAfdavdggsesevidddhsveesddddddVVEKskkggkkksgttgfsasafdllddededvredkdeedepviftdkkkkskksgknsstFDLLVnenddvkedkdeddepitftdkkkksnkggrmrssafdllenededddekkdkdeedepiiftdkkkktksskKTVSSFSEVLldeenvvedapvlsdvsgavdtkqqsgdssivesddfkvnkgevVAQTSKnkkkkkekekprsertaqEEDDLEKILAElgqgpapqeekvqvqppepvappdaadekvgeeeKEESAASKKKKKKKEKEKEKKAAAAAAAEDKQQGKSEAVETkkndgkskgpekkMSKQVREMQEALARRKEAEERKKREEEERLRKEEEERKRLEELERQAEEAKRRKKEKEKEKLLKKKQEGKLLTGKQKEEARRLEAMRNQFLakgiplptgdkeaaskrpkyqtkkksahhqangavplkedsieSKEKEQEKQETLLevdvgetekveegesltveekpeiadapkeneveeedddddeewdakswddvnlnvkgafddeeadsepeplvKKEIKsaipsprdaaekPAVAVkkaipeqplksqdavtrkkepaakskepevdatpkqaeenlrspiccimghvdtgktklldcirgtnvqegeaggitqqigatyfpaenIRERTRELKAnatlkvpgllvidtpghesftnlrsrgsglcdiAILVVDImhglepqtiESLNLLKMRNTEFIVALNKVRFSF
mgrkkpsvrdeanlpavaqgggkskkkavviDDDEYSigtelteepqeeeavnnnkkkkgkkgnqknlqaedddskgeegeendaeaivftgkkkskgkknggnnalSKSAFELLEGadkddddddsgdklskgkyvslaskgktkeglkkgWNKSGSLFAAAAFDAVDGGSEsevidddhsveesddddddvvekskkggkkksgttgfsasafdllddededvredkdeedepviftdkkkkskksgknsstfdllvnenddvkedkdeddepitftdkkkksnkggrmrssafdllenededddekkdkdeedepiiftdkkkktksskktvssfsevlldeenvvedapvlsdvsgavdtkqqsgdssivesddfkvnkgevvaqtsknkkkkkekekprsertaqeedDLEKILAELGQGPapqeekvqvqppepvAPPDAAdekvgeeekeesaaskkkkkkkekeKEKKAAAaaaaedkqqgkseavetkkndgkskgpekkmskqVREMQEALARrkeaeerkkreeeerlrkeeeerkrleelerQAEEakrrkkekekekllkkkqegklltgkqkeEARRLEAMRNQFlakgiplptgdkeaASKRPKYqtkkksahhqangavplkedsiesKEKEqekqetllevdvgetekveegesltveekpeiadapkeneveeedddddeewdakswddvnLNVKGAfddeeadsepeplvkkeiksaipsprdaaEKPAVAVKkaipeqplksqdavtrkkepaakskepevdatpkqaeenlrspiCCIMGHVDTGKTKLLDCIRGTNvqegeaggitqqigatyFPAENIRERTRELKanatlkvpgllvidtpGHESFTNLRSRGSGLCDIAILVVDIMHGLEPQTIESLNLLKMRNTEFIVAlnkvrfsf
MGRKKPSVRDEANLPAVAQGGGKSKKKAVVIDDDEYSIGTelteepqeeeAVnnnkkkkgkkgnqknLQAedddskgeegeendAEAIVFTgkkkskgkknggnnalsksAFELLEGAdkddddddsgdklskgkYVSLASKGKTKEGLKKGWNKSGSLfaaaafdavdggsesevidddhsveesddddddvvekskkggkkksgTTGFSASAFdllddededvredkdeedePVIFTDkkkkskksgknssTFDLLvnenddvkedkdeddePITFTDKKKKSNKGGRMRSSAFDLLenededddekkdkdeedePIIFTDkkkktksskktvssfsevlldeenvvedAPVLSDVSGAVDTKQQSGDSSIVESDDFKVNKGEVVAQTSknkkkkkekekPRSERTAQEEDDLEKILAELGQGpapqeekvqvqppepvappdaadekvgeeekeesaaskkkkkkkekekekkaaaaaaaedkqqgkSEAVETKKNDGKSKGPEKKMSKQVREMqealarrkeaeerkkreeeerlrkeeeerkrleelerqaeeakrrkkekekekllkkkqeGKLLTGKQKEEARRLEAMRNQFLAKGIPLPTGDKEAASKRPKYQTKKKSAHHQANGAVPLkedsieskekeqekqeTLLEVDVGETEKVEEGESLTVEEKPEIAdapkeneveeedddddeewdakswddVNLNVKGAFDDEEADSEPEPLVKKEIKSAIPSPRDaaekpavavkkaipeQPLKSQDAVTRkkepaakskepeVDATPKQAEENLRSPICCIMGHVDTGKTKLLDCIRGTNVQEGEAGGITQQIGATYFPAENIRERTRELKANATLKVPGLLVIDTPGHESFTNLRSRGSGLCDIAILVVDIMHGLEPQTIESLNLLKMRNTEFIVALNKVRFSF
**************************************************************************************************************************************************************LFAAAAF*****************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************PICCIMGHVDTGKTKLLDCIRGTNVQEGEAGGITQQIGATYFPAENIRERTRELKANATLKVPGLLVIDTPGHESFTNLRSRGSGLCDIAILVVDIMHGLEPQTIESLNLLKMRNTEFIVALNKVR***
********************************DDEYSIGT****************************************EENDAEA***********************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************PLKSQDAVTRKKEPAA*****************LRSPICCIMGHVDTGKTKLLDCIRGTNVQEGEAGGITQQIGATYFPAENIRERTRELKANATLKVPGLLVIDTPGHESFTNLRSRGSGLCDIAILVVDIMHGLEPQTIESLNLLKMRNTEFIVALNKVRFSF
**********EANLPAV**********AVVIDDDEYSIGTEL******************************************AEAIVFTGK*********GNNALSKSAFELLEGA***********KLSKGKYVSLASKGKTKEGLKKGWNKSGSLFAAAAFDAV***************************************TGFSASAFDLLDDED***********EPVIFT*************STFDLLVNENDD**********PITFT************RSSAFDLLE**************EDEPIIFTD**************FSEVLLDEENVVEDAPVLSDVSG**************ESDDFKVNKGEVV**************************DLEKILAELGQGP*************************************************************************************************************************************************LKKKQEGKLLTGKQKEEARRLEAMRNQFLAKGIPLPTG*************************VPLKE***************LLEVDVGETEKVEEGESLTVEEKPEIA********************AKSWDDVNLNVKGAFD***********VKKEIKSA*************AVKKAIPEQP****************************AEENLRSPICCIMGHVDTGKTKLLDCIRGTNVQEGEAGGITQQIGATYFPAENIRERTRELKANATLKVPGLLVIDTPGHESFTNLRSRGSGLCDIAILVVDIMHGLEPQTIESLNLLKMRNTEFIVALNKVRFSF
*************************KKAVVIDDDEYSIGTELTEEPQEEEAVNNNK**************************NDAEAIVFTGKKK***************************************KYVSLASKG******************************************SDDDDDDVVEKSKKG*******TGFSASAFDLLDDED***********EP**FT********************************DDEPITFTDKKKK*********************************P******************************************************************EVVAQTSKNKKKKKEK******************L*ELG**********************************************************************************************QEALARRKE**************************E************K*KEKLLKKKQEGKLLTGKQKEEAR*LE*****FLAK*******************************************************************************************************DDVNLNVKGAFDDEEADSEPEPLVKKEIKSAIPSPRDAAEKPAVAVKKAIPEQPLKSQDAVTRKKEPAAKSKEPEVDATPKQAEENLRSPICCIMGHVDTGKTKLLDCIRGTNVQEGEAGGITQQIGATYFPAENIRERTRELKANATLKVPGLLVIDTPGHESFTNLRSRGSGLCDIAILVVDIMHGLEPQTIESLNLLKMRNTEFIVALNKVRF**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGRKKPSVRDEANLPAVAQGGGKSKKKAVVIDDDEYSIGTELTEEPQEEEAVNNNKKKKGKKGNQKNLQAEDDDSKGEEGEENDAEAIVFTGKKKSKGKKNGGNNALSKSAFELLEGADKDDDDDDSGDKLSKGKYVSLASKGKTKEGLKKGWNKSGSLFAAAAFDAVDGGSESEVIDDDHSVEESDDDDDDVVEKSKKGGKKKSGTTGFSASAFDLLDDEDEDVREDKDEEDEPVIFTDKKKKSKKSGKNSSTFDLLVNENDDVKEDKDEDDEPITFTDKKKKSNKGGRMRSSAFDLLENEDEDDDEKKDKDEEDEPIIFTDKKKKTKSSKKTVSSFSEVLLDEENVVEDAPVLSDVSGAVDTKQQSGDSSIVESDDFKVNKGEVVAQTSKNKKKKKEKEKPRSERTAQEEDDLEKILAELGQGPAPQEEKVQVQPPEPVAPPDAADEKVGxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxGKSEAVETKKNDGKSKGPEKKxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxGKLLTGKQKEEARRLEAMRNQFLAKGIPLPTGDKEAASKRPKYQTKKKSAHHQANGAVPLKEDSIESKEKEQEKQETLLEVDVGETEKVEEGESLTVEEKPEIADAPKENEVEEEDDDDDEEWDAKSWDDVNLNVKGAFDDEEADSEPEPLVKKEIKSAIPSPRDAAEKPAVAVKKAIPEQPLKSQDAVTRKKEPAAKSKEPEVDATPKQAEENLRSPICCIMGHVDTGKTKLLDCIRGTNVQEGEAGGITQQIGATYFPAENIRERTRELKANATLKVPGLLVIDTPGHESFTNLRSRGSGLCDIAILVVDIMHGLEPQTIESLNLLKMRNTEFIVALNKVRFSF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query923 2.2.26 [Sep-21-2011]
Q10251 1079 Eukaryotic translation in yes no 0.156 0.133 0.666 3e-56
Q54XP6 1045 Eukaryotic translation in yes no 0.152 0.134 0.671 1e-53
P39730 1002 Eukaryotic translation in yes no 0.139 0.128 0.725 5e-53
O60841 1220 Eukaryotic translation in yes no 0.140 0.106 0.689 4e-52
Q05D44 1216 Eukaryotic translation in yes no 0.140 0.106 0.681 1e-51
B2GUV7 1216 Eukaryotic translation in yes no 0.140 0.106 0.681 2e-51
A0B8Q6 602 Probable translation init yes no 0.136 0.209 0.612 2e-38
Q12Z93 591 Probable translation init yes no 0.143 0.223 0.560 5e-38
Q8TQL5 597 Probable translation init yes no 0.139 0.216 0.581 7e-38
Q0W8X2 594 Probable translation init yes no 0.147 0.228 0.540 7e-38
>sp|Q10251|IF2P_SCHPO Eukaryotic translation initiation factor 5B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC56F8.03 PE=1 SV=1 Back     alignment and function desciption
 Score =  220 bits (561), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 102/153 (66%), Positives = 123/153 (80%), Gaps = 9/153 (5%)

Query: 776 SKEPEVDATPKQA-------EENLRSPICCIMGHVDTGKTKLLDCIRGTNVQEGEAGGIT 828
           SK  +VD  P+ A       E +LRSPICCI+GHVDTGKTKLLD +R +NVQEGEAGGIT
Sbjct: 459 SKTDKVDDIPQAAPAESNVSESDLRSPICCILGHVDTGKTKLLDNLRRSNVQEGEAGGIT 518

Query: 829 QQIGATYFPAENIRERTREL--KANATLKVPGLLVIDTPGHESFTNLRSRGSGLCDIAIL 886
           QQIGATYFP E+I+++T+ +  K      +PGLL+IDTPGHESFTNLRSRG+ LC+IAIL
Sbjct: 519 QQIGATYFPIESIKQKTKVVNKKGKLQYNIPGLLIIDTPGHESFTNLRSRGTSLCNIAIL 578

Query: 887 VVDIMHGLEPQTIESLNLLKMRNTEFIVALNKV 919
           V+DIMHGLEPQTIES+ LL+ + T F+VALNKV
Sbjct: 579 VIDIMHGLEPQTIESIRLLRDQKTPFVVALNKV 611
Function in general translation initiation by promoting the binding of the formylmethionine-tRNA to ribosomes. Seems to function along with eIF-2.
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (taxid: 284812)
>sp|Q54XP6|IF2P_DICDI Eukaryotic translation initiation factor 5B OS=Dictyostelium discoideum GN=eif5b PE=3 SV=1 Back     alignment and function description
>sp|P39730|IF2P_YEAST Eukaryotic translation initiation factor 5B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FUN12 PE=1 SV=2 Back     alignment and function description
>sp|O60841|IF2P_HUMAN Eukaryotic translation initiation factor 5B OS=Homo sapiens GN=EIF5B PE=1 SV=4 Back     alignment and function description
>sp|Q05D44|IF2P_MOUSE Eukaryotic translation initiation factor 5B OS=Mus musculus GN=Eif5b PE=1 SV=2 Back     alignment and function description
>sp|B2GUV7|IF2P_RAT Eukaryotic translation initiation factor 5B OS=Rattus norvegicus GN=Eif5b PE=1 SV=1 Back     alignment and function description
>sp|A0B8Q6|IF2P_METTP Probable translation initiation factor IF-2 OS=Methanosaeta thermophila (strain DSM 6194 / PT) GN=infB PE=3 SV=1 Back     alignment and function description
>sp|Q12Z93|IF2P_METBU Probable translation initiation factor IF-2 OS=Methanococcoides burtonii (strain DSM 6242) GN=infB PE=3 SV=1 Back     alignment and function description
>sp|Q8TQL5|IF2P_METAC Probable translation initiation factor IF-2 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=infB PE=3 SV=1 Back     alignment and function description
>sp|Q0W8X2|IF2P_UNCMA Probable translation initiation factor IF-2 OS=Uncultured methanogenic archaeon RC-I GN=infB PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query923
224120424 1331 predicted protein [Populus trichocarpa] 0.577 0.400 0.682 1e-146
359493041 1393 PREDICTED: uncharacterized protein LOC10 0.725 0.480 0.603 1e-139
297842433 1252 hypothetical protein ARALYDRAFT_895554 [ 0.695 0.512 0.549 1e-126
357443693 1438 Eukaryotic translation initiation factor 0.733 0.470 0.569 1e-125
449443744 1370 PREDICTED: uncharacterized protein LOC10 0.578 0.389 0.622 1e-125
449475431 1370 PREDICTED: LOW QUALITY PROTEIN: uncharac 0.578 0.389 0.619 1e-125
297842443 1257 hypothetical protein ARALYDRAFT_476840 [ 0.643 0.472 0.562 1e-122
147842127887 hypothetical protein VITISV_037414 [Viti 0.339 0.352 0.674 1e-114
6143896 1280 putative translation initiation factor I 0.682 0.492 0.543 1e-113
42563275 1294 translation initiation factor eIF-5B [Ar 0.683 0.487 0.533 1e-112
>gi|224120424|ref|XP_002318326.1| predicted protein [Populus trichocarpa] gi|222858999|gb|EEE96546.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  525 bits (1352), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 394/577 (68%), Positives = 444/577 (76%), Gaps = 44/577 (7%)

Query: 372 SIVESDDFKVNKGEVVAQTSKNKKKKKEKEKPRSERTAQEEDDLEKILAELGQGPA---- 427
           +IVE++D KV K E VA+TSKNKKKKK K    S RTAQEEDDL+KILAELG G +    
Sbjct: 312 NIVEANDSKVTKSEAVAETSKNKKKKKGK----SGRTAQEEDDLDKILAELGGGASTLKP 367

Query: 428 ----PQEEKVQVQPPEPVAPPDAA----DEKVGEEEKEESAASKKKKKKKEKEKEKKAAA 479
               PQEEK+ VQP EPVA PDA      E+  EE        KKK+K+KEK+    AAA
Sbjct: 368 SESPPQEEKLNVQP-EPVAVPDALVEKEGEEEKEESAAAKKKKKKKEKEKEKKVAAAAAA 426

Query: 480 AAAAEDKQQGKSEAVETKKNDGKSKGPEKKMSKQVREMQEALARRKEAEERKKREEEERL 539
           AA  E  ++ K+E  E KK D K K  EKK+ K VREMQEALARRKE EERK +EEEE+ 
Sbjct: 427 AAKEEKLEEAKAETSEPKKTDAKGKAAEKKLPKHVREMQEALARRKEMEERKAKEEEEKR 486

Query: 540 RKEEEERKRLEELERQAEEAKRRKKEKEKEKLLKKKQEGKLLTGKQKEEARRLEAMRNQF 599
           RKEEEER R EELERQAEEA+RRKKE+EKEKLLKKKQEGKLLTGKQKEE RRLEAMRNQ 
Sbjct: 487 RKEEEERLRQEELERQAEEARRRKKEREKEKLLKKKQEGKLLTGKQKEEQRRLEAMRNQI 546

Query: 600 LAK-GIPLPTGDKE-AASKRPKYQTKK-KSAHHQANGAVPLK-EDSIESKEKEQEKQETL 655
           LA  GI +PT D++ A +KRP+YQTKK K AHHQANG   +K E+ +E+K KEQE+QE +
Sbjct: 547 LANAGITVPTADRDNAPTKRPRYQTKKSKPAHHQANG---IKIEEHVEAKGKEQEEQEEV 603

Query: 656 LEVDVGETEKVEEGESLTVEEKPEIADAPKENEVEEEDDDDDEEWDAKSWDDVNLNVKGA 715
            EV+  E EK E  E    EEK E+A  P+EN +EE+DDD  EEWDAKSWDDVNLNVKGA
Sbjct: 604 HEVETVELEKAEPVE----EEKTEVASVPEENGMEEDDDD--EEWDAKSWDDVNLNVKGA 657

Query: 716 FDDEEADSEPEPLVKKEIKSAIPSPRDAAEKPAVAVKKAIPEQPLKSQDA---------- 765
           FDDEE DSEPEP++KKE KS++P+ R A  KPA+AV+K +  QP+ S+D           
Sbjct: 658 FDDEE-DSEPEPVLKKETKSSVPASRGADAKPAIAVRKPVTSQPMDSRDVENKKIQTEVE 716

Query: 766 ---VTRKKEPAAKSKEPEVDATPKQAEENLRSPICCIMGHVDTGKTKLLDCIRGTNVQEG 822
                RKK+ A K+K    DA PKQ EENLRSPICCIMGHVDTGKTKLLDCIRGTNVQEG
Sbjct: 717 VSDKNRKKDAAVKNKGAVSDAIPKQGEENLRSPICCIMGHVDTGKTKLLDCIRGTNVQEG 776

Query: 823 EAGGITQQIGATYFPAENIRERTRELKANATLKVPGLLVIDTPGHESFTNLRSRGSGLCD 882
           EAGGITQQIGATYFPAENIRERT+ELKA+A L VPGLLVIDTPGHESFTNLRSRGSGLCD
Sbjct: 777 EAGGITQQIGATYFPAENIRERTKELKADAKLNVPGLLVIDTPGHESFTNLRSRGSGLCD 836

Query: 883 IAILVVDIMHGLEPQTIESLNLLKMRNTEFIVALNKV 919
           IAILVVDIMHGLEPQTIESLNLL+MRNTEFIVALNKV
Sbjct: 837 IAILVVDIMHGLEPQTIESLNLLRMRNTEFIVALNKV 873

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359493041|ref|XP_002267014.2| PREDICTED: uncharacterized protein LOC100242745 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297842433|ref|XP_002889098.1| hypothetical protein ARALYDRAFT_895554 [Arabidopsis lyrata subsp. lyrata] gi|297334939|gb|EFH65357.1| hypothetical protein ARALYDRAFT_895554 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|357443693|ref|XP_003592124.1| Eukaryotic translation initiation factor 5B [Medicago truncatula] gi|355481172|gb|AES62375.1| Eukaryotic translation initiation factor 5B [Medicago truncatula] Back     alignment and taxonomy information
>gi|449443744|ref|XP_004139637.1| PREDICTED: uncharacterized protein LOC101204360 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449475431|ref|XP_004154455.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101204360 [Cucumis sativus] Back     alignment and taxonomy information
>gi|297842443|ref|XP_002889103.1| hypothetical protein ARALYDRAFT_476840 [Arabidopsis lyrata subsp. lyrata] gi|297334944|gb|EFH65362.1| hypothetical protein ARALYDRAFT_476840 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|147842127|emb|CAN78095.1| hypothetical protein VITISV_037414 [Vitis vinifera] Back     alignment and taxonomy information
>gi|6143896|gb|AAF04442.1|AC010718_11 putative translation initiation factor IF-2; 73082-68138 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|42563275|ref|NP_177807.3| translation initiation factor eIF-5B [Arabidopsis thaliana] gi|332197770|gb|AEE35891.1| translation initiation factor eIF-5B [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query923
TAIR|locus:2030116 1294 AT1G76810 [Arabidopsis thalian 0.366 0.261 0.533 1.1e-104
TAIR|locus:2030041 1191 AT1G76720 "AT1G76720" [Arabido 0.354 0.274 0.512 3.4e-92
TAIR|locus:2030126 1166 AT1G76820 [Arabidopsis thalian 0.357 0.283 0.504 7.2e-91
TAIR|locus:2199562 1092 AT1G21160 "AT1G21160" [Arabido 0.357 0.302 0.478 4.6e-82
UNIPROTKB|F1N6Y7 1220 EIF5B "Uncharacterized protein 0.140 0.106 0.681 4.4e-57
FB|FBgn0026259 1144 eIF5B "eIF5B" [Drosophila mela 0.149 0.120 0.65 4.9e-57
UNIPROTKB|J9P504 1219 EIF5B "Uncharacterized protein 0.140 0.106 0.681 2.9e-56
POMBASE|SPAC56F8.03 1079 SPAC56F8.03 "translation initi 0.172 0.147 0.621 6.9e-56
ASPGD|ASPL0000017318 1072 AN4038 [Emericella nidulans (t 0.149 0.128 0.714 4.9e-55
RGD|1591046 1216 Eif5b-ps1 "eukaryotic translat 0.140 0.106 0.681 2.2e-54
TAIR|locus:2030116 AT1G76810 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 806 (288.8 bits), Expect = 1.1e-104, Sum P(5) = 1.1e-104
 Identities = 191/358 (53%), Positives = 218/358 (60%)

Query:   578 GKLLTGKQKEEARRLEAMRNQFLAKGIPLPTGDKEA---ASKRPKYQTKKKSAHHQANGA 634
             GKLLT KQK EA++ EA +NQ LA G  LP  D +    +SKRP Y  KKKS+  +    
Sbjct:   477 GKLLTAKQKTEAQKREAFKNQLLAAGGGLPVADNDGDATSSKRPIYANKKKSSRQKGIDT 536

Query:   635 VPLXXXXXXXXXXXXXXXXTLLEVDVGETEKVEEGESLTVEEKPEIAXXXXXXXXXXXXX 694
                                TL EV + +T KV+  E +  +E    A             
Sbjct:   537 SVQGEDEVEPKENQADEQDTLGEVGLTDTGKVDLIELVNTDENSGPADVAQENGVEEDDE 596

Query:   695 XXXXXXXXXXXXXVNLNVKGAFDDEEADSEPEPLVKKEIKSAIPSPRDXXXXXXXXXXX- 753
                          V+LN+KG FDDEE   E +P+VKKE+K AI    D            
Sbjct:   597 EDEWDAKSWGT--VDLNLKGDFDDEE--EEAQPVVKKELKDAISKAHDSEPEAEKPTAKP 652

Query:   754 XXXXQPL----KS----QDAV-TRXXXXXXXXXXXXVDATPKQA---EENLRSPICCIMG 801
                 +PL    K+    +DA  T+                P ++   EENLRSPICCIMG
Sbjct:   653 AGTGKPLIAAVKATPEVEDATRTKRATRAKDASKKGKGLAPSESIEGEENLRSPICCIMG 712

Query:   802 HVDTGKTKLLDCIRGTNVQEGEAGGITQQIGATYFPAENIRERTRELKANATLKVPGLLV 861
             HVDTGKTKLLDCIRGTNVQEGEAGGITQQIGATYFPAENIRERT+ELKA+A LKVPGLLV
Sbjct:   713 HVDTGKTKLLDCIRGTNVQEGEAGGITQQIGATYFPAENIRERTKELKADAKLKVPGLLV 772

Query:   862 IDTPGHESFTNLRSRGSGLCDIAILVVDIMHGLEPQTIESLNLLKMRNTEFIVALNKV 919
             IDTPGHESFTNLRSRGS LCD+AILVVDIMHGLEPQTIESLNLL+MRNTEFIVALNKV
Sbjct:   773 IDTPGHESFTNLRSRGSSLCDLAILVVDIMHGLEPQTIESLNLLRMRNTEFIVALNKV 830
GO:0003924 "GTPase activity" evidence=IEA
GO:0005525 "GTP binding" evidence=IEA
GO:0005737 "cytoplasm" evidence=ISM
GO:0008135 "translation factor activity, nucleic acid binding" evidence=ISS
GO:0005886 "plasma membrane" evidence=IDA
GO:0005829 "cytosol" evidence=RCA
TAIR|locus:2030041 AT1G76720 "AT1G76720" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2030126 AT1G76820 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2199562 AT1G21160 "AT1G21160" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|F1N6Y7 EIF5B "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
FB|FBgn0026259 eIF5B "eIF5B" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|J9P504 EIF5B "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
POMBASE|SPAC56F8.03 SPAC56F8.03 "translation initiation factor IF2 (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
ASPGD|ASPL0000017318 AN4038 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
RGD|1591046 Eif5b-ps1 "eukaryotic translation initiation factor 5B, pseudogene 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
estExt_fgenesh4_pg.C_LG_XII0050
hypothetical protein (1332 aa)
(Populus trichocarpa)
Predicted Functional Partners:
gw1.XVI.1402.1
hypothetical protein (482 aa)
  ••• • 0.522
gw1.VI.2308.1
hypothetical protein (550 aa)
  • • • 0.484
estExt_fgenesh4_pm.C_LG_VIII0372
SubName- Full=Putative uncharacterized protein; (160 aa)
  •   • 0.479
estExt_Genewise1_v1.C_LG_X0940
SubName- Full=Putative uncharacterized protein; (159 aa)
  •   • 0.475
estExt_Genewise1_v1.C_LG_VI0968
SubName- Full=Putative uncharacterized protein; (160 aa)
  •     0.474
estExt_fgenesh4_pm.C_LG_XVIII0351
SubName- Full=Putative uncharacterized protein; (160 aa)
  •     0.473
grail3.0035003102
hypothetical protein (152 aa)
  •  •  0.446
estExt_fgenesh4_pg.C_LG_II1328
SubName- Full=Putative uncharacterized protein; (152 aa)
  •  •  0.445
eugene3.00121232
hypothetical protein (152 aa)
  •  •  0.439
grail3.0005049701
SubName- Full=Putative uncharacterized protein; (152 aa)
  •  •  0.436

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query923
cd01887169 cd01887, IF2_eIF5B, Initiation Factor 2 (IF2)/ euk 6e-67
PRK04004 586 PRK04004, PRK04004, translation initiation factor 2e-55
COG0532 509 COG0532, InfB, Translation initiation factor 2 (IF 2e-51
TIGR00491 590 TIGR00491, aIF-2, translation initiation factor aI 4e-39
pfam00009184 pfam00009, GTP_EFTU, Elongation factor Tu GTP bind 7e-33
PRK14845 1049 PRK14845, PRK14845, translation initiation factor 2e-30
PRK05306 746 PRK05306, infB, translation initiation factor IF-2 2e-28
TIGR00487 587 TIGR00487, IF-2, translation initiation factor IF- 1e-27
CHL00189 742 CHL00189, infB, translation initiation factor 2; P 9e-27
cd00881183 cd00881, GTP_translation_factor, GTP translation f 1e-21
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 1e-11
cd04171170 cd04171, SelB, SelB, the dedicated elongation fact 4e-11
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 6e-11
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 8e-11
TIGR00475 581 TIGR00475, selB, selenocysteine-specific elongatio 2e-10
cd01890179 cd01890, LepA, LepA also known as Elongation Facto 5e-10
PRK10512 614 PRK10512, PRK10512, selenocysteinyl-tRNA-specific 2e-09
TIGR00231162 TIGR00231, small_GTP, small GTP-binding protein do 3e-09
PTZ001212084 PTZ00121, PTZ00121, MAEBL; Provisional 7e-09
cd01889192 cd01889, SelB_euk, SelB, the dedicated elongation 7e-09
COG0480 697 COG0480, FusA, Translation elongation factors (GTP 1e-08
TIGR009271096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 2e-08
COG3276 447 COG3276, SelB, Selenocysteine-specific translation 3e-08
cd01885218 cd01885, EF2, Elongation Factor 2 (EF2) in archaea 1e-07
TIGR01393 595 TIGR01393, lepA, GTP-binding protein LepA 2e-07
COG0481 603 COG0481, LepA, Membrane GTPase LepA [Cell envelope 3e-07
cd04167213 cd04167, Snu114p, Snu114p, a spliceosome protein, 3e-06
TIGR02794346 TIGR02794, tolA_full, TolA protein 4e-06
PRK05306 746 PRK05306, infB, translation initiation factor IF-2 5e-06
cd04166209 cd04166, CysN_ATPS, CysN, together with protein Cy 5e-06
COG2895 431 COG2895, CysN, GTPases - Sulfate adenylate transfe 6e-06
COG5271 4600 COG5271, MDN1, AAA ATPase containing von Willebran 8e-06
PRK12704520 PRK12704, PRK12704, phosphodiesterase; Provisional 1e-05
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 1e-05
TIGR02034 406 TIGR02034, CysN, sulfate adenylyltransferase, larg 2e-05
cd00882161 cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like s 2e-05
cd04169 268 cd04169, RF3, Release Factor 3 (RF3) protein invol 2e-05
TIGR009271096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 3e-05
PRK00409782 PRK00409, PRK00409, recombination and DNA strand e 3e-05
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 3e-05
PRK05306 746 PRK05306, infB, translation initiation factor IF-2 4e-05
PRK05124 474 PRK05124, cysN, sulfate adenylyltransferase subuni 4e-05
PRK09510387 PRK09510, tolA, cell envelope integrity inner memb 5e-05
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 6e-05
PRK09510387 PRK09510, tolA, cell envelope integrity inner memb 6e-05
PTZ001081388 PTZ00108, PTZ00108, DNA topoisomerase 2-like prote 6e-05
TIGR03319514 TIGR03319, RNase_Y, ribonuclease Y 8e-05
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 1e-04
PRK00409782 PRK00409, PRK00409, recombination and DNA strand e 1e-04
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 1e-04
COG4372499 COG4372, COG4372, Uncharacterized protein conserve 1e-04
PRK13351 687 PRK13351, PRK13351, elongation factor G; Reviewed 1e-04
PRK05306 746 PRK05306, infB, translation initiation factor IF-2 2e-04
cd01891194 cd01891, TypA_BipA, Tyrosine phosphorylated protei 2e-04
COG4108 528 COG4108, PrfC, Peptide chain release factor RF-3 [ 2e-04
pfam13904261 pfam13904, DUF4207, Domain of unknown function (DU 2e-04
PRK12704520 PRK12704, PRK12704, phosphodiesterase; Provisional 3e-04
PRK09510387 PRK09510, tolA, cell envelope integrity inner memb 3e-04
PRK05703424 PRK05703, flhF, flagellar biosynthesis regulator F 3e-04
PRK05035695 PRK05035, PRK05035, electron transport complex pro 3e-04
TIGR02794346 TIGR02794, tolA_full, TolA protein 4e-04
PRK05433 600 PRK05433, PRK05433, GTP-binding protein LepA; Prov 4e-04
pfam024631162 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain 4e-04
cd01884195 cd01884, EF_Tu, Elongation Factor Tu (EF-Tu) GTP-b 4e-04
TIGR009271096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 5e-04
PTZ001081388 PTZ00108, PTZ00108, DNA topoisomerase 2-like prote 5e-04
pfam07946322 pfam07946, DUF1682, Protein of unknown function (D 5e-04
pfam10243506 pfam10243, MIP-T3, Microtubule-binding protein MIP 5e-04
TIGR03680 406 TIGR03680, eif2g_arch, translation initiation fact 5e-04
PLN032371465 PLN03237, PLN03237, DNA topoisomerase 2; Provision 6e-04
pfam02463 1162 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain 8e-04
PRK05901 509 PRK05901, PRK05901, RNA polymerase sigma factor; P 8e-04
PRK05306 746 PRK05306, infB, translation initiation factor IF-2 0.001
pfam07946322 pfam07946, DUF1682, Protein of unknown function (D 0.001
COG4942420 COG4942, COG4942, Membrane-bound metallopeptidase 0.001
PRK00741 526 PRK00741, prfC, peptide chain release factor 3; Pr 0.001
pfam05262489 pfam05262, Borrelia_P83, Borrelia P83/100 protein 0.001
pfam09731493 pfam09731, Mitofilin, Mitochondrial inner membrane 0.001
TIGR00503 527 TIGR00503, prfC, peptide chain release factor 3 0.001
COG3064387 COG3064, TolA, Membrane protein involved in colici 0.001
PRK108111068 PRK10811, rne, ribonuclease E; Reviewed 0.001
PRK05506 632 PRK05506, PRK05506, bifunctional sulfate adenylylt 0.001
COG2268548 COG2268, COG2268, Uncharacterized protein conserve 0.001
PRK00247429 PRK00247, PRK00247, putative inner membrane protei 0.001
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 0.002
PRK05035695 PRK05035, PRK05035, electron transport complex pro 0.002
cd01886 270 cd01886, EF-G, Elongation factor G (EF-G) family i 0.002
pfam07767387 pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) 0.002
PTZ001081388 PTZ00108, PTZ00108, DNA topoisomerase 2-like prote 0.003
TIGR03319514 TIGR03319, RNase_Y, ribonuclease Y 0.003
pfam10243506 pfam10243, MIP-T3, Microtubule-binding protein MIP 0.003
COG3064387 COG3064, TolA, Membrane protein involved in colici 0.003
PTZ00266 1021 PTZ00266, PTZ00266, NIMA-related protein kinase; P 0.003
pfam03154979 pfam03154, Atrophin-1, Atrophin-1 family 0.003
pfam05793528 pfam05793, TFIIF_alpha, Transcription initiation f 0.003
TIGR00484 689 TIGR00484, EF-G, translation elongation factor EF- 0.003
COG2433652 COG2433, COG2433, Uncharacterized conserved protei 0.003
PRK05306 746 PRK05306, infB, translation initiation factor IF-2 0.004
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 0.004
PRK07735430 PRK07735, PRK07735, NADH dehydrogenase subunit C; 0.004
pfam12569516 pfam12569, NARP1, NMDA receptor-regulated protein 0.004
>gnl|CDD|206674 cd01887, IF2_eIF5B, Initiation Factor 2 (IF2)/ eukaryotic Initiation Factor 5B (eIF5B) family Back     alignment and domain information 
 Score =  220 bits (563), Expect = 6e-67
 Identities = 66/125 (52%), Positives = 82/125 (65%), Gaps = 14/125 (11%)

Query: 795 PICCIMGHVDTGKTKLLDCIRGTNVQEGEAGGITQQIGATYFPAENIRERTRELKANATL 854
           P+  +MGHVD GKT LLD IR TNV  GEAGGITQ IGA   P +              +
Sbjct: 1   PVVTVMGHVDHGKTTLLDKIRKTNVAAGEAGGITQHIGAYQVPID--------------V 46

Query: 855 KVPGLLVIDTPGHESFTNLRSRGSGLCDIAILVVDIMHGLEPQTIESLNLLKMRNTEFIV 914
           K+PG+  IDTPGHE+FTN+R+RG+ + DIAILVV    G+ PQTIE++N  K  N   IV
Sbjct: 47  KIPGITFIDTPGHEAFTNMRARGASVTDIAILVVAADDGVMPQTIEAINHAKAANVPIIV 106

Query: 915 ALNKV 919
           A+NK+
Sbjct: 107 AINKI 111

IF2/eIF5B contribute to ribosomal subunit joining and function as GTPases that are maximally activated by the presence of both ribosomal subunits. As seen in other GTPases, IF2/IF5B undergoes conformational changes between its GTP- and GDP-bound states. Eukaryotic IF2/eIF5Bs possess three characteristic segments, including a divergent N-terminal region followed by conserved central and C-terminal segments. This core region is conserved among all known eukaryotic and archaeal IF2/eIF5Bs and eubacterial IF2s. Length = 169
>gnl|CDD|235195 PRK04004, PRK04004, translation initiation factor IF-2; Validated Back     alignment and domain information
>gnl|CDD|223606 COG0532, InfB, Translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|129582 TIGR00491, aIF-2, translation initiation factor aIF-2/yIF-2 Back     alignment and domain information
>gnl|CDD|215653 pfam00009, GTP_EFTU, Elongation factor Tu GTP binding domain Back     alignment and domain information
>gnl|CDD|237833 PRK14845, PRK14845, translation initiation factor IF-2; Provisional Back     alignment and domain information
>gnl|CDD|235401 PRK05306, infB, translation initiation factor IF-2; Validated Back     alignment and domain information
>gnl|CDD|232995 TIGR00487, IF-2, translation initiation factor IF-2 Back     alignment and domain information
>gnl|CDD|177089 CHL00189, infB, translation initiation factor 2; Provisional Back     alignment and domain information
>gnl|CDD|206647 cd00881, GTP_translation_factor, GTP translation factor family primarily contains translation initiation, elongation and release factors Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|206734 cd04171, SelB, SelB, the dedicated elongation factor for delivery of selenocysteinyl-tRNA to the ribosome Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|129567 TIGR00475, selB, selenocysteine-specific elongation factor SelB Back     alignment and domain information
>gnl|CDD|206677 cd01890, LepA, LepA also known as Elongation Factor 4 (EF4) Back     alignment and domain information
>gnl|CDD|182508 PRK10512, PRK10512, selenocysteinyl-tRNA-specific translation factor; Provisional Back     alignment and domain information
>gnl|CDD|232886 TIGR00231, small_GTP, small GTP-binding protein domain Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|206676 cd01889, SelB_euk, SelB, the dedicated elongation factor for delivery of selenocysteinyl-tRNA to the ribosome Back     alignment and domain information
>gnl|CDD|223556 COG0480, FusA, Translation elongation factors (GTPases) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|225815 COG3276, SelB, Selenocysteine-specific translation elongation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|206672 cd01885, EF2, Elongation Factor 2 (EF2) in archaea and eukarya Back     alignment and domain information
>gnl|CDD|130460 TIGR01393, lepA, GTP-binding protein LepA Back     alignment and domain information
>gnl|CDD|223557 COG0481, LepA, Membrane GTPase LepA [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|206730 cd04167, Snu114p, Snu114p, a spliceosome protein, is a GTPase Back     alignment and domain information
>gnl|CDD|234017 TIGR02794, tolA_full, TolA protein Back     alignment and domain information
>gnl|CDD|235401 PRK05306, infB, translation initiation factor IF-2; Validated Back     alignment and domain information
>gnl|CDD|206729 cd04166, CysN_ATPS, CysN, together with protein CysD, forms the ATP sulfurylase (ATPS) complex Back     alignment and domain information
>gnl|CDD|225448 COG2895, CysN, GTPases - Sulfate adenylate transferase subunit 1 [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|227596 COG5271, MDN1, AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|213679 TIGR02034, CysN, sulfate adenylyltransferase, large subunit Back     alignment and domain information
>gnl|CDD|206648 cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like superfamily of small guanosine triphosphatases (GTPases) Back     alignment and domain information
>gnl|CDD|206732 cd04169, RF3, Release Factor 3 (RF3) protein involved in the terminal step of translocation in bacteria Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|234750 PRK00409, PRK00409, recombination and DNA strand exchange inhibitor protein; Reviewed Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|235401 PRK05306, infB, translation initiation factor IF-2; Validated Back     alignment and domain information
>gnl|CDD|235349 PRK05124, cysN, sulfate adenylyltransferase subunit 1; Provisional Back     alignment and domain information
>gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional Back     alignment and domain information
>gnl|CDD|240271 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; Provisional Back     alignment and domain information
>gnl|CDD|188306 TIGR03319, RNase_Y, ribonuclease Y Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|234750 PRK00409, PRK00409, recombination and DNA strand exchange inhibitor protein; Reviewed Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|226809 COG4372, COG4372, Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] Back     alignment and domain information
>gnl|CDD|237358 PRK13351, PRK13351, elongation factor G; Reviewed Back     alignment and domain information
>gnl|CDD|235401 PRK05306, infB, translation initiation factor IF-2; Validated Back     alignment and domain information
>gnl|CDD|206678 cd01891, TypA_BipA, Tyrosine phosphorylated protein A (TypA)/BipA family belongs to ribosome-binding GTPases Back     alignment and domain information
>gnl|CDD|226593 COG4108, PrfC, Peptide chain release factor RF-3 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|222447 pfam13904, DUF4207, Domain of unknown function (DUF4207) Back     alignment and domain information
>gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional Back     alignment and domain information
>gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional Back     alignment and domain information
>gnl|CDD|235570 PRK05703, flhF, flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>gnl|CDD|235334 PRK05035, PRK05035, electron transport complex protein RnfC; Provisional Back     alignment and domain information
>gnl|CDD|234017 TIGR02794, tolA_full, TolA protein Back     alignment and domain information
>gnl|CDD|235462 PRK05433, PRK05433, GTP-binding protein LepA; Provisional Back     alignment and domain information
>gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain Back     alignment and domain information
>gnl|CDD|206671 cd01884, EF_Tu, Elongation Factor Tu (EF-Tu) GTP-binding proteins Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|240271 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; Provisional Back     alignment and domain information
>gnl|CDD|219655 pfam07946, DUF1682, Protein of unknown function (DUF1682) Back     alignment and domain information
>gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 Back     alignment and domain information
>gnl|CDD|211860 TIGR03680, eif2g_arch, translation initiation factor 2 subunit gamma Back     alignment and domain information
>gnl|CDD|215641 PLN03237, PLN03237, DNA topoisomerase 2; Provisional Back     alignment and domain information
>gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain Back     alignment and domain information
>gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional Back     alignment and domain information
>gnl|CDD|235401 PRK05306, infB, translation initiation factor IF-2; Validated Back     alignment and domain information
>gnl|CDD|219655 pfam07946, DUF1682, Protein of unknown function (DUF1682) Back     alignment and domain information
>gnl|CDD|227278 COG4942, COG4942, Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|179105 PRK00741, prfC, peptide chain release factor 3; Provisional Back     alignment and domain information
>gnl|CDD|114011 pfam05262, Borrelia_P83, Borrelia P83/100 protein Back     alignment and domain information
>gnl|CDD|220369 pfam09731, Mitofilin, Mitochondrial inner membrane protein Back     alignment and domain information
>gnl|CDD|129594 TIGR00503, prfC, peptide chain release factor 3 Back     alignment and domain information
>gnl|CDD|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|236766 PRK10811, rne, ribonuclease E; Reviewed Back     alignment and domain information
>gnl|CDD|180120 PRK05506, PRK05506, bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional Back     alignment and domain information
>gnl|CDD|225177 COG2268, COG2268, Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>gnl|CDD|178945 PRK00247, PRK00247, putative inner membrane protein translocase component YidC; Validated Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|235334 PRK05035, PRK05035, electron transport complex protein RnfC; Provisional Back     alignment and domain information
>gnl|CDD|206673 cd01886, EF-G, Elongation factor G (EF-G) family involved in both the elongation and ribosome recycling phases of protein synthesis Back     alignment and domain information
>gnl|CDD|219563 pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) Back     alignment and domain information
>gnl|CDD|240271 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; Provisional Back     alignment and domain information
>gnl|CDD|188306 TIGR03319, RNase_Y, ribonuclease Y Back     alignment and domain information
>gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 Back     alignment and domain information
>gnl|CDD|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|173502 PTZ00266, PTZ00266, NIMA-related protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family Back     alignment and domain information
>gnl|CDD|218752 pfam05793, TFIIF_alpha, Transcription initiation factor IIF, alpha subunit (TFIIF-alpha) Back     alignment and domain information
>gnl|CDD|129575 TIGR00484, EF-G, translation elongation factor EF-G Back     alignment and domain information
>gnl|CDD|225288 COG2433, COG2433, Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>gnl|CDD|235401 PRK05306, infB, translation initiation factor IF-2; Validated Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|236081 PRK07735, PRK07735, NADH dehydrogenase subunit C; Validated Back     alignment and domain information
>gnl|CDD|221641 pfam12569, NARP1, NMDA receptor-regulated protein 1 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 923
KOG1144 1064 consensus Translation initiation factor 5B (eIF-5B 100.0
COG0532 509 InfB Translation initiation factor 2 (IF-2; GTPase 99.86
TIGR00491 590 aIF-2 translation initiation factor aIF-2/yIF-2. T 99.78
PRK04004 586 translation initiation factor IF-2; Validated 99.77
PRK05306 787 infB translation initiation factor IF-2; Validated 99.74
cd01887168 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryo 99.74
TIGR00487 587 IF-2 translation initiation factor IF-2. This mode 99.73
PF00009188 GTP_EFTU: Elongation factor Tu GTP binding domain; 99.73
KOG1145 683 consensus Mitochondrial translation initiation fac 99.7
CHL00189 742 infB translation initiation factor 2; Provisional 99.69
cd04171164 SelB SelB subfamily. SelB is an elongation factor 99.69
cd01890179 LepA LepA subfamily. LepA belongs to the GTPase fa 99.66
cd01885222 EF2 EF2 (for archaea and eukarya). Translocation r 99.65
cd01891194 TypA_BipA TypA (tyrosine phosphorylated protein A) 99.65
cd01884195 EF_Tu EF-Tu subfamily. This subfamily includes ort 99.65
cd04169 267 RF3 RF3 subfamily. Peptide chain release factor 3 99.64
cd00881189 GTP_translation_factor GTP translation factor fami 99.63
cd04124161 RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily 99.62
cd01886 270 EF-G Elongation factor G (EF-G) subfamily. Translo 99.61
cd04167213 Snu114p Snu114p subfamily. Snu114p is one of sever 99.61
cd01889192 SelB_euk SelB subfamily. SelB is an elongation fac 99.6
cd04168 237 TetM_like Tet(M)-like subfamily. Tet(M), Tet(O), T 99.6
cd04166208 CysN_ATPS CysN_ATPS subfamily. CysN, together with 99.6
cd04113161 Rab4 Rab4 subfamily. Rab4 has been implicated in n 99.6
cd04119168 RJL RJL (RabJ-Like) subfamily. RJLs are found in m 99.59
TIGR00475 581 selB selenocysteine-specific elongation factor Sel 99.59
cd04138162 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, 99.59
TIGR01394 594 TypA_BipA GTP-binding protein TypA/BipA. This bact 99.59
cd01864165 Rab19 Rab19 subfamily. Rab19 proteins are associat 99.59
PRK14845 1049 translation initiation factor IF-2; Provisional 99.59
cd01894157 EngA1 EngA1 subfamily. This CD represents the firs 99.59
cd01875191 RhoG RhoG subfamily. RhoG is a GTPase with high se 99.59
cd04106162 Rab23_lke Rab23-like subfamily. Rab23 is a member 99.58
cd01861161 Rab6 Rab6 subfamily. Rab6 is involved in microtubu 99.58
cd01862172 Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th 99.58
cd04145164 M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf 99.58
cd04115170 Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is u 99.58
CHL00071 409 tufA elongation factor Tu 99.58
cd01895174 EngA2 EngA2 subfamily. This CD represents the seco 99.58
PLN00116 843 translation elongation factor EF-2 subunit; Provis 99.57
cd01866168 Rab2 Rab2 subfamily. Rab2 is localized on cis-Golg 99.57
cd04132187 Rho4_like Rho4-like subfamily. Rho4 is a GTPase th 99.57
COG1159 298 Era GTPase [General function prediction only] 99.57
smart00175164 RAB Rab subfamily of small GTPases. Rab GTPases ar 99.57
cd04107201 Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38 99.57
cd04122166 Rab14 Rab14 subfamily. Rab14 GTPases are localized 99.57
PLN03126 478 Elongation factor Tu; Provisional 99.57
cd04136163 Rap_like Rap-like subfamily. The Rap subfamily con 99.57
cd04140165 ARHI_like ARHI subfamily. ARHI (A Ras homolog memb 99.57
PRK12736 394 elongation factor Tu; Reviewed 99.57
cd04157162 Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a sub 99.56
smart00173164 RAS Ras subfamily of RAS small GTPases. Similar in 99.56
cd04141172 Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like p 99.56
PLN03127 447 Elongation factor Tu; Provisional 99.56
cd01869166 Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev 99.56
cd01867167 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp 99.56
cd04127180 Rab27A Rab27a subfamily. The Rab27a subfamily cons 99.56
PTZ00369189 Ras-like protein; Provisional 99.56
cd04154173 Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are 99.56
cd04163168 Era Era subfamily. Era (E. coli Ras-like protein) 99.56
cd01860163 Rab5_related Rab5-related subfamily. This subfamil 99.56
cd01897168 NOG NOG1 is a nucleolar GTP-binding protein presen 99.56
TIGR03598179 GTPase_YsxC ribosome biogenesis GTP-binding protei 99.55
cd04120202 Rab12 Rab12 subfamily. Rab12 was first identified 99.55
cd04170 268 EF-G_bact Elongation factor G (EF-G) subfamily. Tr 99.55
cd01874175 Cdc42 Cdc42 subfamily. Cdc42 is an essential GTPas 99.55
PRK05433 600 GTP-binding protein LepA; Provisional 99.55
cd04133176 Rop_like Rop subfamily. The Rop (Rho-related prote 99.55
COG0480 697 FusA Translation elongation factors (GTPases) [Tra 99.55
cd04116170 Rab9 Rab9 subfamily. Rab9 is found in late endosom 99.55
smart00174174 RHO Rho (Ras homology) subfamily of Ras-like small 99.55
cd04172182 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily. Rnd3/RhoE 99.55
PF02421156 FeoB_N: Ferrous iron transport protein B; InterPro 99.55
PRK00741 526 prfC peptide chain release factor 3; Provisional 99.55
cd00154159 Rab Rab family. Rab GTPases form the largest famil 99.55
cd04175164 Rap1 Rap1 subgroup. The Rap1 subgroup is part of t 99.55
TIGR01393 595 lepA GTP-binding protein LepA. LepA (GUF1 in Sacca 99.54
cd01865165 Rab3 Rab3 subfamily. The Rab3 subfamily contains R 99.54
PRK10218 607 GTP-binding protein; Provisional 99.54
cd00877166 Ran Ran (Ras-related nuclear proteins) /TC4 subfam 99.54
TIGR00485 394 EF-Tu translation elongation factor TU. This align 99.54
PLN03071219 GTP-binding nuclear protein Ran; Provisional 99.54
PRK00089 292 era GTPase Era; Reviewed 99.54
cd04160167 Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote 99.54
cd01863161 Rab18 Rab18 subfamily. Mammalian Rab18 is implicat 99.54
PRK12735 396 elongation factor Tu; Reviewed 99.54
cd01871174 Rac1_like Rac1-like subfamily. The Rac1-like subfa 99.54
PRK12317 425 elongation factor 1-alpha; Reviewed 99.54
cd04164157 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein 99.54
cd04114169 Rab30 Rab30 subfamily. Rab30 appears to be associa 99.54
cd04176163 Rap2 Rap2 subgroup. The Rap2 subgroup is part of t 99.54
cd01888203 eIF2_gamma eIF2-gamma (gamma subunit of initiation 99.54
cd04131178 Rnd Rnd subfamily. The Rnd subfamily contains Rnd1 99.54
PRK10512 614 selenocysteinyl-tRNA-specific translation factor; 99.54
cd04152183 Arl4_Arl7 Arl4/Arl7 subfamily. Arl4 (Arf-like 4) i 99.54
cd04123162 Rab21 Rab21 subfamily. The localization and functi 99.54
cd00157171 Rho Rho (Ras homology) family. Members of the Rho 99.54
cd01868165 Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a 99.54
cd04101164 RabL4 RabL4 (Rab-like4) subfamily. RabL4s are nove 99.54
cd04134189 Rho3 Rho3 subfamily. Rho3 is a member of the Rho f 99.53
cd01883219 EF1_alpha Eukaryotic elongation factor 1 (EF1) alp 99.53
TIGR00484 689 EF-G translation elongation factor EF-G. After pep 99.53
cd01898170 Obg Obg subfamily. The Obg nucleotide binding prot 99.53
cd01879158 FeoB Ferrous iron transport protein B (FeoB) subfa 99.53
cd04144190 Ras2 Ras2 subfamily. The Ras2 subfamily, found exc 99.53
cd00878158 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik 99.52
PRK00049 396 elongation factor Tu; Reviewed 99.52
KOG0084205 consensus GTPase Rab1/YPT1, small G protein superf 99.52
cd04162164 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9 99.52
cd04110199 Rab35 Rab35 subfamily. Rab35 is one of several Rab 99.52
PRK12739 691 elongation factor G; Reviewed 99.52
TIGR00503 527 prfC peptide chain release factor 3. This translat 99.52
cd01893166 Miro1 Miro1 subfamily. Miro (mitochondrial Rho) pr 99.52
cd04135174 Tc10 TC10 subfamily. TC10 is a Rho family protein 99.52
TIGR00436 270 era GTP-binding protein Era. Era is an essential G 99.52
cd04165224 GTPBP1_like GTPBP1-like. Mammalian GTP binding pro 99.52
PRK00007 693 elongation factor G; Reviewed 99.52
cd04112191 Rab26 Rab26 subfamily. First identified in rat pan 99.52
cd04174 232 Rnd1_Rho6 Rnd1/Rho6 subfamily. Rnd1/Rho6 is a memb 99.52
cd04151158 Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes t 99.52
TIGR02034 406 CysN sulfate adenylyltransferase, large subunit. H 99.52
cd04149168 Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor 99.52
cd04118193 Rab24 Rab24 subfamily. Rab24 is distinct from othe 99.51
cd04109215 Rab28 Rab28 subfamily. First identified in maize, 99.51
cd04102202 RabL3 RabL3 (Rab-like3) subfamily. RabL3s are nove 99.51
KOG0462 650 consensus Elongation factor-type GTP-binding prote 99.51
TIGR00231161 small_GTP small GTP-binding protein domain. This m 99.51
cd04159159 Arl10_like Arl10-like subfamily. Arl9/Arl10 was id 99.51
PRK03003 472 GTP-binding protein Der; Reviewed 99.51
cd04156160 ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su 99.51
PF01926116 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I 99.51
cd01878204 HflX HflX subfamily. A distinct conserved domain w 99.5
cd04108170 Rab36_Rab34 Rab34/Rab36 subfamily. Rab34, found pr 99.5
cd04139164 RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) 99.5
cd04161167 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 ( 99.5
cd04150159 Arf1_5_like Arf1-Arf5-like subfamily. This subfami 99.5
cd01870175 RhoA_like RhoA-like subfamily. The RhoA subfamily 99.5
smart00177175 ARF ARF-like small GTPases; ARF, ADP-ribosylation 99.5
cd04105203 SR_beta Signal recognition particle receptor, beta 99.5
cd01892169 Miro2 Miro2 subfamily. Miro (mitochondrial Rho) pr 99.5
cd04121189 Rab40 Rab40 subfamily. This subfamily contains Rab 99.5
PTZ00141 446 elongation factor 1- alpha; Provisional 99.5
PRK05124 474 cysN sulfate adenylyltransferase subunit 1; Provis 99.5
cd04130173 Wrch_1 Wrch-1 subfamily. Wrch-1 (Wnt-1 responsive 99.49
cd04125188 RabA_like RabA-like subfamily. RabA was first iden 99.49
TIGR03594 429 GTPase_EngA ribosome-associated GTPase EngA. EngA 99.49
PTZ00416 836 elongation factor 2; Provisional 99.49
cd04117161 Rab15 Rab15 subfamily. Rab15 colocalizes with the 99.49
TIGR03594 429 GTPase_EngA ribosome-associated GTPase EngA. EngA 99.49
cd04153174 Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) a 99.49
cd04173 222 Rnd2_Rho7 Rnd2/Rho7 subfamily. Rnd2/Rho7 is a memb 99.49
PRK00093 435 GTP-binding protein Der; Reviewed 99.49
PLN03118211 Rab family protein; Provisional 99.49
PLN03110216 Rab GTPase; Provisional 99.49
cd00879190 Sar1 Sar1 subfamily. Sar1 is an essential componen 99.48
KOG0394210 consensus Ras-related GTPase [General function pre 99.48
cd04126 220 Rab20 Rab20 subfamily. Rab20 is one of several Rab 99.48
smart00178184 SAR Sar1p-like members of the Ras-family of small 99.48
PLN00223181 ADP-ribosylation factor; Provisional 99.48
PRK15494 339 era GTPase Era; Provisional 99.48
cd04147198 Ras_dva Ras-dva subfamily. Ras-dva (Ras - dorsal-v 99.48
PRK04213201 GTP-binding protein; Provisional 99.47
cd04137180 RheB Rheb (Ras Homolog Enriched in Brain) subfamil 99.47
TIGR00483 426 EF-1_alpha translation elongation factor EF-1 alph 99.47
cd04111211 Rab39 Rab39 subfamily. Found in eukaryotes, Rab39 99.47
cd04146165 RERG_RasL11_like RERG/RasL11-like subfamily. RERG 99.47
TIGR03680 406 eif2g_arch translation initiation factor 2 subunit 99.47
PRK00093 435 GTP-binding protein Der; Reviewed 99.47
cd00880163 Era_like Era (E. coli Ras-like protein)-like. This 99.47
PLN00043 447 elongation factor 1-alpha; Provisional 99.47
cd04158169 ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor 99.47
KOG0092200 consensus GTPase Rab5/YPT51 and related small G pr 99.46
cd04177168 RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the 99.46
PRK13351 687 elongation factor G; Reviewed 99.46
cd04128182 Spg1 Spg1p. Spg1p (septum-promoting GTPase) was fi 99.46
PLN03108210 Rab family protein; Provisional 99.46
PF08477119 Miro: Miro-like protein; InterPro: IPR013684 Mitoc 99.46
cd00876160 Ras Ras family. The Ras family of the Ras superfam 99.46
PTZ00133182 ADP-ribosylation factor; Provisional 99.46
PRK07560 731 elongation factor EF-2; Reviewed 99.46
COG1217 603 TypA Predicted membrane GTPase involved in stress 99.46
PRK03003 472 GTP-binding protein Der; Reviewed 99.46
PLN00023 334 GTP-binding protein; Provisional 99.46
COG5256 428 TEF1 Translation elongation factor EF-1alpha (GTPa 99.45
PTZ00327 460 eukaryotic translation initiation factor 2 gamma s 99.45
TIGR00490 720 aEF-2 translation elongation factor aEF-2. This mo 99.44
cd04142198 RRP22 RRP22 subfamily. RRP22 (Ras-related protein 99.44
cd04143 247 Rhes_like Rhes_like subfamily. This subfamily incl 99.44
TIGR00450 442 mnmE_trmE_thdF tRNA modification GTPase TrmE. TrmE 99.44
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f 99.44
PRK05506 632 bifunctional sulfate adenylyltransferase subunit 1 99.44
COG1160 444 Predicted GTPases [General function prediction onl 99.44
TIGR03156351 GTP_HflX GTP-binding protein HflX. This protein fa 99.43
KOG0094221 consensus GTPase Rab6/YPT6/Ryh1, small G protein s 99.43
smart00176200 RAN Ran (Ras-related nuclear proteins) /TC4 subfam 99.43
PF00071162 Ras: Ras family; InterPro: IPR001806 Small GTPases 99.43
TIGR02528142 EutP ethanolamine utilization protein, EutP. This 99.43
PRK00454196 engB GTP-binding protein YsxC; Reviewed 99.43
KOG0098216 consensus GTPase Rab2, small G protein superfamily 99.42
cd01881176 Obg_like The Obg-like subfamily consists of five w 99.41
PRK09518 712 bifunctional cytidylate kinase/GTPase Der; Reviewe 99.41
COG1100219 GTPase SAR1 and related small G proteins [General 99.41
PRK04000 411 translation initiation factor IF-2 subunit gamma; 99.4
PRK05291 449 trmE tRNA modification GTPase TrmE; Reviewed 99.39
KOG0080209 consensus GTPase Rab18, small G protein superfamil 99.39
KOG0087222 consensus GTPase Rab11/YPT3, small G protein super 99.39
COG4108 528 PrfC Peptide chain release factor RF-3 [Translatio 99.39
cd00882157 Ras_like_GTPase Ras-like GTPase superfamily. The R 99.39
PRK09518 712 bifunctional cytidylate kinase/GTPase Der; Reviewe 99.39
KOG0467 887 consensus Translation elongation factor 2/ribosome 99.39
cd04148 221 RGK RGK subfamily. The RGK (Rem, Rem2, Rad, Gem/Ki 99.39
PRK11058 426 GTPase HflX; Provisional 99.38
COG0218200 Predicted GTPase [General function prediction only 99.38
PTZ00132215 GTP-binding nuclear protein Ran; Provisional 99.38
KOG0078207 consensus GTP-binding protein SEC4, small G protei 99.38
COG2895 431 CysN GTPases - Sulfate adenylate transferase subun 99.38
PRK12299335 obgE GTPase CgtA; Reviewed 99.37
COG1084346 Predicted GTPase [General function prediction only 99.36
cd04129187 Rho2 Rho2 subfamily. Rho2 is a fungal GTPase that 99.36
PF00025175 Arf: ADP-ribosylation factor family The prints ent 99.36
KOG0095213 consensus GTPase Rab30, small G protein superfamil 99.36
cd01876170 YihA_EngB The YihA (EngB) subfamily. This subfamil 99.35
cd01873195 RhoBTB RhoBTB subfamily. Members of the RhoBTB sub 99.35
KOG0468 971 consensus U5 snRNP-specific protein [Translation, 99.35
COG0481 603 LepA Membrane GTPase LepA [Cell envelope biogenesi 99.34
TIGR02729329 Obg_CgtA Obg family GTPase CgtA. This model descri 99.33
PRK09554 772 feoB ferrous iron transport protein B; Reviewed 99.32
cd04103158 Centaurin_gamma Centaurin gamma. The centaurins (a 99.32
PRK12298 390 obgE GTPase CgtA; Reviewed 99.32
COG2229187 Predicted GTPase [General function prediction only 99.31
KOG0093193 consensus GTPase Rab3, small G protein superfamily 99.3
KOG0086214 consensus GTPase Rab4, small G protein superfamily 99.3
PRK15467158 ethanolamine utilization protein EutP; Provisional 99.28
KOG0079198 consensus GTP-binding protein H-ray, small G prote 99.28
COG0050 394 TufB GTPases - translation elongation factors [Tra 99.28
PRK12296 500 obgE GTPase CgtA; Reviewed 99.27
PRK12297 424 obgE GTPase CgtA; Reviewed 99.27
COG1160 444 Predicted GTPases [General function prediction onl 99.27
KOG0458 603 consensus Elongation factor 1 alpha [Translation, 99.26
cd01882225 BMS1 Bms1. Bms1 is an essential, evolutionarily co 99.26
PF09439181 SRPRB: Signal recognition particle receptor beta s 99.26
cd01850 276 CDC_Septin CDC/Septin. Septins are a conserved fam 99.25
cd04104197 p47_IIGP_like p47 (47-kDa) family. The p47 GTPase 99.25
PRK12740 668 elongation factor G; Reviewed 99.25
KOG0395196 consensus Ras-related GTPase [General function pre 99.23
cd01852196 AIG1 AIG1 (avrRpt2-induced gene 1). This represent 99.22
COG0486 454 ThdF Predicted GTPase [General function prediction 99.21
KOG0073185 consensus GTP-binding ADP-ribosylation factor-like 99.2
KOG0465 721 consensus Mitochondrial elongation factor [Transla 99.19
PF00350168 Dynamin_N: Dynamin family; InterPro: IPR001401 Mem 99.18
cd01896 233 DRG The developmentally regulated GTP-binding prot 99.17
KOG0097215 consensus GTPase Rab14, small G protein superfamil 99.16
smart00053240 DYNc Dynamin, GTPase. Large GTPases that mediate v 99.14
KOG0088218 consensus GTPase Rab21, small G protein superfamil 99.13
KOG1423 379 consensus Ras-like GTPase ERA [Cell cycle control, 99.12
KOG0461 522 consensus Selenocysteine-specific elongation facto 99.12
TIGR00437 591 feoB ferrous iron transporter FeoB. FeoB (773 amin 99.12
COG3276 447 SelB Selenocysteine-specific translation elongatio 99.11
KOG1532 366 consensus GTPase XAB1, interacts with DNA repair p 99.1
KOG0464 753 consensus Elongation factor G [Translation, riboso 99.1
KOG0460 449 consensus Mitochondrial translation elongation fac 99.09
COG0370 653 FeoB Fe2+ transport system protein B [Inorganic io 99.06
PRK09866 741 hypothetical protein; Provisional 99.05
COG3596 296 Predicted GTPase [General function prediction only 99.05
PF10662143 PduV-EutP: Ethanolamine utilisation - propanediol 99.05
KOG1490 620 consensus GTP-binding protein CRFG/NOG1 (ODN super 99.04
KOG0075186 consensus GTP-binding ADP-ribosylation factor-like 99.03
COG5257 415 GCD11 Translation initiation factor 2, gamma subun 99.01
KOG0091213 consensus GTPase Rab39, small G protein superfamil 99.01
cd01853249 Toc34_like Toc34-like (Translocon at the Outer-env 99.0
KOG1954 532 consensus Endocytosis/signaling protein EHD1 [Sign 98.98
KOG0070181 consensus GTP-binding ADP-ribosylation factor Arf1 98.96
KOG3883198 consensus Ras family small GTPase [Signal transduc 98.94
KOG0469 842 consensus Elongation factor 2 [Translation, riboso 98.93
KOG0074185 consensus GTP-binding ADP-ribosylation factor-like 98.93
PF04670 232 Gtr1_RagA: Gtr1/RagA G protein conserved region; I 98.92
TIGR00991 313 3a0901s02IAP34 GTP-binding protein (Chloroplast En 98.92
KOG0393198 consensus Ras-related small GTPase, Rho type [Gene 98.87
PF04548212 AIG1: AIG1 family; InterPro: IPR006703 This entry 98.86
PF00735 281 Septin: Septin; InterPro: IPR000038 Septins consti 98.86
KOG1144 1064 consensus Translation initiation factor 5B (eIF-5B 98.83
PF03029238 ATP_bind_1: Conserved hypothetical ATP binding pro 98.83
KOG0083192 consensus GTPase Rab26/Rab37, small G protein supe 98.83
KOG1489366 consensus Predicted GTP-binding protein (ODN super 98.82
KOG1191 531 consensus Mitochondrial GTPase [Translation, ribos 98.8
PF05049 376 IIGP: Interferon-inducible GTPase (IIGP); InterPro 98.79
KOG4252 246 consensus GTP-binding protein [Signal transduction 98.79
KOG1707 625 consensus Predicted Ras related/Rac-GTP binding pr 98.77
KOG0081219 consensus GTPase Rab27, small G protein superfamil 98.76
COG2262411 HflX GTPases [General function prediction only] 98.75
PRK13768253 GTPase; Provisional 98.74
KOG0071180 consensus GTP-binding ADP-ribosylation factor Arf6 98.74
COG0536369 Obg Predicted GTPase [General function prediction 98.71
KOG0076197 consensus GTP-binding ADP-ribosylation factor-like 98.7
COG5258 527 GTPBP1 GTPase [General function prediction only] 98.68
KOG0090238 consensus Signal recognition particle receptor, be 98.67
COG5192 1077 BMS1 GTP-binding protein required for 40S ribosome 98.62
TIGR02836 492 spore_IV_A stage IV sporulation protein A. A compa 98.61
KOG1143 591 consensus Predicted translation elongation factor 98.61
cd01899 318 Ygr210 Ygr210 subfamily. Ygr210 is a member of Obg 98.6
PTZ00258 390 GTP-binding protein; Provisional 98.6
COG5019 373 CDC3 Septin family protein [Cell division and chro 98.58
TIGR00993 763 3a0901s04IAP86 chloroplast protein import componen 98.58
KOG0096216 consensus GTPase Ran/TC4/GSP1 (nuclear protein tra 98.57
PTZ00099176 rab6; Provisional 98.57
PRK09601 364 GTP-binding protein YchF; Reviewed 98.57
PRK09602 396 translation-associated GTPase; Reviewed 98.56
KOG0463 641 consensus GTP-binding protein GP-1 [General functi 98.55
KOG2655 366 consensus Septin family protein (P-loop GTPase) [C 98.53
KOG0077193 consensus Vesicle coat complex COPII, GTPase subun 98.49
KOG0072182 consensus GTP-binding ADP-ribosylation factor-like 98.49
cd01900 274 YchF YchF subfamily. YchF is a member of the Obg f 98.47
KOG2486320 consensus Predicted GTPase [General function predi 98.46
KOG1673205 consensus Ras GTPases [General function prediction 98.4
COG1163 365 DRG Predicted GTPase [General function prediction 98.35
COG0012 372 Predicted GTPase, probable translation factor [Tra 98.34
cd03112158 CobW_like The function of this protein family is u 98.34
smart00275342 G_alpha G protein alpha subunit. Subunit of G prot 98.33
KOG1547 336 consensus Septin CDC10 and related P-loop GTPases 98.29
TIGR00750 300 lao LAO/AO transport system ATPase. Mutations have 98.27
KOG0466 466 consensus Translation initiation factor 2, gamma s 98.26
PRK09435 332 membrane ATPase/protein kinase; Provisional 98.25
cd00066317 G-alpha G protein alpha subunit. The alpha subunit 98.25
TIGR00073207 hypB hydrogenase accessory protein HypB. HypB is i 98.22
KOG0410 410 consensus Predicted GTP binding protein [General f 98.2
COG4917148 EutP Ethanolamine utilization protein [Amino acid 98.19
KOG0459 501 consensus Polypeptide release factor 3 [Translatio 98.18
TIGR01425 429 SRP54_euk signal recognition particle protein SRP5 98.14
cd01858157 NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei 98.1
cd01851224 GBP Guanylate-binding protein (GBP), N-terminal do 98.09
PRK14722 374 flhF flagellar biosynthesis regulator FlhF; Provis 98.06
cd04178172 Nucleostemin_like Nucleostemin-like. Nucleostemin 98.05
PF02492178 cobW: CobW/HypB/UreG, nucleotide-binding domain; I 98.04
TIGR00092 368 GTP-binding protein YchF. This predicted GTP-bindi 98.02
KOG4423229 consensus GTP-binding protein-like, RAS superfamil 97.96
COG0523 323 Putative GTPases (G3E family) [General function pr 97.95
cd01849155 YlqF_related_GTPase YlqF-related GTPases. These pr 97.94
PRK14974336 cell division protein FtsY; Provisional 97.93
TIGR03597360 GTPase_YqeH ribosome biogenesis GTPase YqeH. This 97.92
TIGR00064272 ftsY signal recognition particle-docking protein F 97.92
cd01857141 HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t 97.92
PF03193161 DUF258: Protein of unknown function, DUF258; Inter 97.92
cd03115173 SRP The signal recognition particle (SRP) mediates 97.89
KOG3886 295 consensus GTP-binding protein [Signal transduction 97.87
PRK10416318 signal recognition particle-docking protein FtsY; 97.87
cd01855190 YqeH YqeH. YqeH is an essential GTP-binding protei 97.86
KOG0448 749 consensus Mitofusin 1 GTPase, involved in mitochon 97.86
cd03110179 Fer4_NifH_child This protein family's function is 97.85
KOG0082354 consensus G-protein alpha subunit (small G protein 97.84
cd03114148 ArgK-like The function of this protein family is u 97.83
KOG1491 391 consensus Predicted GTP-binding protein (ODN super 97.83
TIGR00101199 ureG urease accessory protein UreG. This model rep 97.83
TIGR03348 1169 VI_IcmF type VI secretion protein IcmF. Members of 97.82
PRK09563287 rbgA GTPase YlqF; Reviewed 97.81
TIGR03596276 GTPase_YlqF ribosome biogenesis GTP-binding protei 97.81
KOG3859 406 consensus Septins (P-loop GTPases) [Cell cycle con 97.81
PF00503389 G-alpha: G-protein alpha subunit; InterPro: IPR001 97.81
PRK11537 318 putative GTP-binding protein YjiA; Provisional 97.8
smart00010124 small_GTPase Small GTPase of the Ras superfamily; 97.79
PRK00771 437 signal recognition particle protein Srp54; Provisi 97.78
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 97.76
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 97.73
TIGR02475 341 CobW cobalamin biosynthesis protein CobW. A broade 97.73
COG3640255 CooC CO dehydrogenase maturation factor [Cell divi 97.71
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 97.7
cd01856171 YlqF YlqF. Proteins of the YlqF family contain all 97.7
KOG1707625 consensus Predicted Ras related/Rac-GTP binding pr 97.68
PF03308266 ArgK: ArgK protein; InterPro: IPR005129 Bacterial 97.67
KOG1534273 consensus Putative transcription factor FET5 [Tran 97.67
COG1161322 Predicted GTPases [General function prediction onl 97.66
PRK12288347 GTPase RsgA; Reviewed 97.59
cd02036179 MinD Bacterial cell division requires the formatio 97.56
PRK10867 433 signal recognition particle protein; Provisional 97.53
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 97.52
PRK12289352 GTPase RsgA; Reviewed 97.52
TIGR00959 428 ffh signal recognition particle protein. This mode 97.5
COG1703 323 ArgK Putative periplasmic protein kinase ArgK and 97.5
COG1162301 Predicted GTPases [General function prediction onl 97.5
cd01859156 MJ1464 MJ1464. This family represents archaeal GTP 97.48
TIGR00157245 ribosome small subunit-dependent GTPase A. The Aqu 97.47
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 97.46
PRK13695174 putative NTPase; Provisional 97.46
KOG1486 364 consensus GTP-binding protein DRG2 (ODN superfamil 97.45
KOG0447 980 consensus Dynamin-like GTP binding protein [Genera 97.43
cd02038139 FleN-like FleN is a member of the Fer4_NifH superf 97.42
PRK14721420 flhF flagellar biosynthesis regulator FlhF; Provis 97.41
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Valida 97.41
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 97.4
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 97.38
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 97.35
cd0198399 Fer4_NifH The Fer4_NifH superfamily contains a var 97.35
PRK10463290 hydrogenase nickel incorporation protein HypB; Pro 97.35
cd01859 156 MJ1464 MJ1464. This family represents archaeal GTP 97.31
COG3523 1188 IcmF Type VI protein secretion system component Va 97.3
PRK14723 767 flhF flagellar biosynthesis regulator FlhF; Provis 97.28
cd01854287 YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtil 97.28
cd02037169 MRP-like MRP (Multiple Resistance and pH adaptatio 97.28
PRK00098298 GTPase RsgA; Reviewed 97.26
KOG1424 562 consensus Predicted GTP-binding protein MMR1 [Gene 97.25
cd01857141 HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t 97.23
KOG2485335 consensus Conserved ATP/GTP binding protein [Gener 97.2
KOG3905 473 consensus Dynein light intermediate chain [Cell mo 97.19
KOG1533 290 consensus Predicted GTPase [General function predi 97.18
KOG0052 391 consensus Translation elongation factor EF-1 alpha 97.12
cd02042104 ParA ParA and ParB of Caulobacter crescentus belon 97.12
PRK13796365 GTPase YqeH; Provisional 97.11
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 97.09
cd03111106 CpaE_like This protein family consists of proteins 97.06
KOG1487 358 consensus GTP-binding protein DRG1 (ODN superfamil 97.04
COG0378202 HypB Ni2+-binding GTPase involved in regulation of 97.04
KOG3887 347 consensus Predicted small GTPase involved in nucle 97.03
PF09547 492 Spore_IV_A: Stage IV sporulation protein A (spore_ 96.94
PF03266168 NTPase_1: NTPase; InterPro: IPR004948 This entry r 96.89
KOG4181 491 consensus Uncharacterized conserved protein [Funct 96.85
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 96.85
KOG2743 391 consensus Cobalamin synthesis protein [Coenzyme tr 96.84
COG1618179 Predicted nucleotide kinase [Nucleotide transport 96.73
KOG2484435 consensus GTPase [General function prediction only 96.7
cd01855 190 YqeH YqeH. YqeH is an essential GTP-binding protei 96.69
TIGR01969251 minD_arch cell division ATPase MinD, archaeal. Thi 96.68
PF05621 302 TniB: Bacterial TniB protein; InterPro: IPR008868 96.67
cd01856 171 YlqF YlqF. Proteins of the YlqF family contain all 96.66
COG0552340 FtsY Signal recognition particle GTPase [Intracell 96.62
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 96.61
smart00382148 AAA ATPases associated with a variety of cellular 96.54
PRK13849231 putative crown gall tumor protein VirC1; Provision 96.49
TIGR03596 276 GTPase_YlqF ribosome biogenesis GTP-binding protei 96.46
cd02032267 Bchl_like This family of proteins contains bchL an 96.45
PHA02518211 ParA-like protein; Provisional 96.43
TIGR00157 245 ribosome small subunit-dependent GTPase A. The Aqu 96.31
COG0541 451 Ffh Signal recognition particle GTPase [Intracellu 96.27
KOG0099379 consensus G protein subunit Galphas, small G prote 96.25
PF01656195 CbiA: CobQ/CobB/MinD/ParA nucleotide binding domai 96.24
TIGR01281268 DPOR_bchL light-independent protochlorophyllide re 96.18
PF0685858 NOG1: Nucleolar GTP-binding protein 1 (NOG1); Inte 96.17
cd02117212 NifH_like This family contains the NifH (iron prot 96.12
PF03205140 MobB: Molybdopterin guanine dinucleotide synthesis 96.07
KOG0446 657 consensus Vacuolar sorting protein VPS1, dynamin, 96.06
PRK09563 287 rbgA GTPase YlqF; Reviewed 96.05
PF05783 472 DLIC: Dynein light intermediate chain (DLIC); Inte 96.04
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 95.97
PRK11670369 antiporter inner membrane protein; Provisional 95.96
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 95.95
PRK01889356 GTPase RsgA; Reviewed 95.93
KOG0780 483 consensus Signal recognition particle, subunit Srp 95.87
KOG10291118 consensus Endocytic adaptor protein intersectin [S 95.87
TIGR03371246 cellulose_yhjQ cellulose synthase operon protein Y 95.86
PRK08099399 bifunctional DNA-binding transcriptional repressor 95.85
PRK10751173 molybdopterin-guanine dinucleotide biosynthesis pr 95.78
KOG2423 572 consensus Nucleolar GTPase [General function predi 95.71
PF05729166 NACHT: NACHT domain 95.7
CHL00072 290 chlL photochlorophyllide reductase subunit L 95.7
cd01393226 recA_like RecA is a bacterial enzyme which has rol 95.68
cd01124187 KaiC KaiC is a circadian clock protein primarily f 95.66
PRK11519719 tyrosine kinase; Provisional 95.64
KOG3022300 consensus Predicted ATPase, nucleotide-binding [Ce 95.63
TIGR03878259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 95.58
PRK13185270 chlL protochlorophyllide reductase iron-sulfur ATP 95.57
TIGR01005754 eps_transp_fam exopolysaccharide transport protein 95.56
TIGR03877237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 95.54
cd02035217 ArsA ArsA ATPase functionas as an efflux pump loca 95.52
TIGR03597 360 GTPase_YqeH ribosome biogenesis GTPase YqeH. This 95.51
PRK09841726 cryptic autophosphorylating protein tyrosine kinas 95.49
PRK04195 482 replication factor C large subunit; Provisional 95.49
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 95.47
PF00004132 AAA: ATPase family associated with various cellula 95.45
TIGR02012 321 tigrfam_recA protein RecA. This model describes or 95.44
PRK00098 298 GTPase RsgA; Reviewed 95.4
KOG2749 415 consensus mRNA cleavage and polyadenylation factor 95.33
PRK12289 352 GTPase RsgA; Reviewed 95.29
PRK09354 349 recA recombinase A; Provisional 95.28
PRK05057172 aroK shikimate kinase I; Reviewed 95.26
PRK04328249 hypothetical protein; Provisional 95.24
COG0563178 Adk Adenylate kinase and related kinases [Nucleoti 95.19
cd01122 271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 95.17
COG1120 258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 95.13
PRK05800170 cobU adenosylcobinamide kinase/adenosylcobinamide- 95.13
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 95.09
PF13479213 AAA_24: AAA domain 95.08
PRK07261171 topology modulation protein; Provisional 95.08
PRK08118167 topology modulation protein; Reviewed 95.06
KOG1029 1118 consensus Endocytic adaptor protein intersectin [S 95.06
PRK04296190 thymidine kinase; Provisional 95.01
KOG0781587 consensus Signal recognition particle receptor, al 94.99
PRK06762166 hypothetical protein; Provisional 94.95
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 94.92
TIGR02858270 spore_III_AA stage III sporulation protein AA. Mem 94.89
KOG0066807 consensus eIF2-interacting protein ABC50 (ABC supe 94.88
PRK01889 356 GTPase RsgA; Reviewed 94.84
PRK05416 288 glmZ(sRNA)-inactivating NTPase; Provisional 94.8
PRK05973237 replicative DNA helicase; Provisional 94.79
PHA00729226 NTP-binding motif containing protein 94.78
COG0455262 flhG Antiactivator of flagellar biosynthesis FleN, 94.78
PRK14737186 gmk guanylate kinase; Provisional 94.7
PF05879 742 RHD3: Root hair defective 3 GTP-binding protein (R 94.7
PF07015231 VirC1: VirC1 protein; InterPro: IPR009744 This fam 94.7
PRK13232273 nifH nitrogenase reductase; Reviewed 94.67
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 94.62
PTZ001212084 MAEBL; Provisional 94.56
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexame 94.55
>KOG1144 consensus Translation initiation factor 5B (eIF-5B) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information 
Probab=100.00  E-value=1.5e-71  Score=633.31  Aligned_cols=586  Identities=54%  Similarity=0.748  Sum_probs=377.8

Q ss_pred             cccccccccCCCCCCCcccccccC---CCcccccccCCCCCCC-cccccccccccccCCcccccccccccccccccccCC
Q 002428          278 FTDKKKKSNKGGRMRSSAFDLLEN---EDEDDDEKKDKDEEDE-PIIFTDKKKKTKSSKKTVSSFSEVLLDEENVVEDAP  353 (923)
Q Consensus       278 f~~kkk~s~~~~~~~~~~~~~~~~---~~~~~~~~~~~~~~~~-~i~fsgkKk~sk~~~~~~~~~~~~~~~~~~~~~~~~  353 (923)
                      |.+|.|+++..+-+.+.+|++|+.   ....++...+++.+.. +++|+|.|++.+++...+  +   ..|+ -.+.+++
T Consensus         1 ~~kk~KK~k~~kwd~d~~ea~l~~~~~~~~~d~~~~de~~~~~~~~a~s~~kk~~~~g~~~s--~---~~dd-see~e~~   74 (1064)
T KOG1144|consen    1 FKKKGKKSKSKKWDGDASEALLAELLVATDKDDEEEDEDAKKASTLAFSGAKKKKKKGLKLS--S---PGDD-SEELEEP   74 (1064)
T ss_pred             CCCcccccccccccccHHHHHHHHHhcCCCCCChhhccchhhhhhhhccccccccccccccc--C---CCcc-cccccCC
Confidence            556667777666677778888852   2222222223333333 499999998844433332  2   1111 1111111


Q ss_pred             ccccccccccccccCCCCccccccccccccchhhhhhhhhhhhhhhhcCcchhhhhccHHHHHHHHHHcCCCCCCcccc-
Q 002428          354 VLSDVSGAVDTKQQSGDSSIVESDDFKVNKGEVVAQTSKNKKKKKEKEKPRSERTAQEEDDLEKILAELGQGPAPQEEK-  432 (923)
Q Consensus       354 ~~~~~s~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~kkkk~k~k~K~~~~~~~~ed~dk~lael~~~~~~~~~~-  432 (923)
                      .     |+                 ......+++..+.++++++++  +++++++.++++|++++|+.++..+.+.... 
T Consensus        75 e-----~k-----------------~~~ta~~e~~e~~~skkkk~~--K~~kk~~~eE~~d~dkllas~~ek~~~~s~~e  130 (1064)
T KOG1144|consen   75 E-----GK-----------------TKKTAKVEVVETGKSKKKKKK--KKKKKGKAEEEDDLDKLLASLGEKDEPASEKE  130 (1064)
T ss_pred             C-----CC-----------------cccccccchhhccccchhhhc--ccccccccccccchHHHhhhcCCCCCccchhh
Confidence            1     11                 112223333366666666554  3355567799999999999999887432211 


Q ss_pred             -ccCCCCCCCCCCCCccccccchhhhhhHHHHHHhhhHHHHHHHHHHHHHHHh--------hhhhcchhhhhhhccCCCC
Q 002428          433 -VQVQPPEPVAPPDAADEKVGEEEKEESAASKKKKKKKEKEKEKKAAAAAAAE--------DKQQGKSEAVETKKNDGKS  503 (923)
Q Consensus       433 -~~~~~~~~~~~~~a~~~~~~ee~e~~~aa~kkKKKKKeKekekkaa~~~aaa--------~~~e~~~e~~e~~k~~~k~  503 (923)
                       ...++ .+.+++.++..+    ....+++.+|+++|+++++.+..++++++-        +++.+...+.++.++.++.
T Consensus       131 ~~~~qp-e~va~~eaa~~~----ekkek~~akKkkeKkek~~~~~~~~~a~~~~~~e~ke~~~ek~~~~p~e~ekk~ak~  205 (1064)
T KOG1144|consen  131 KKEAQP-ENVAPVEAAGEK----EKKEKAAAKKKKEKKEKEKKKEDSAAAAAEKSVEAKEEKKEKSVTEPAEPEKKEAKG  205 (1064)
T ss_pred             hhhcCc-cccCCccCCCch----hhHHHHHHhhhhhhhhhhhhhhhhhhccchhhhhHHHHhhhhcccCcccccccchhh
Confidence             11111 222222222211    244455555555555555554432222111        2344455556666777788


Q ss_pred             CCCCcchhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhccccch
Q 002428          504 KGPEKKMSKQVREMQEALARRKEAEERKKREEEERLRKEEEERKRLEELERQAEEAKRRKKEKEKEKLLKKKQEGKLLTG  583 (923)
Q Consensus       504 k~~~KK~~a~~~~~qe~l~~~keeEE~~kreEEEr~rreEEE~~~~eEeer~~eE~k~~kkekekekke~~KkEGKlLTk  583 (923)
                      +...++.+++|++||++|+++++++|+++|++||++|+++|+++++++++++++|++++++++++++++++|++|+|||+
T Consensus       206 Kk~~kk~~Kgv~~~qe~La~~qe~eE~qkreeEE~~r~eeEEer~~ee~E~~~eEak~kkKekekek~er~KaeGklLTa  285 (1064)
T KOG1144|consen  206 KKAEKKKPKGVRAMQEALAKRQEEEERQKREEEERLRREEEEERRREEEEAQEEEAKEKKKEKEKEKKERKKAEGKLLTA  285 (1064)
T ss_pred             cccccccchhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhcccchH
Confidence            88889999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHcC--CCCCCCCCccccCCccccccccccccccCCCCCcccchhhhHHHHHHHhhh-hhhccc
Q 002428          584 KQKEEARRLEAMRNQFLAKG--IPLPTGDKEAASKRPKYQTKKKSAHHQANGAVPLKEDSIESKEKEQEKQET-LLEVDV  660 (923)
Q Consensus       584 KQKeekar~ea~~~~Lla~G--v~v~~~~~~~~kKk~~y~~kkkk~~~~~~~~~~~~~~~~~~~~~~~e~~~~-~~~~~~  660 (923)
                      +||+++++++++|++||++|  +.|+..+ ...+|||||.++|++..++.....++...      ...++.+. .+++.+
T Consensus       286 kQK~~~a~aea~l~~ll~sg~~~~va~kd-g~~kKrpiY~nKKk~~rq~~~~~~s~~~~------~~~~~~e~~~~~~~~  358 (1064)
T KOG1144|consen  286 KQKEEAALAEAFLKQLLASGGGLPVADKD-GDSKKRPIYANKKKKARQKGNDRTSVEKL------GEVEAKENHAGDVGS  358 (1064)
T ss_pred             hhHHHHHHHHHHHHHHHhcCCCCCCCccc-CCcccCcccccccccccccccchhhhhhc------ccCchhhhccCCCCC
Confidence            99999999999999999997  5555544 34899999999999876655443222111      11111110 011111


Q ss_pred             ccchhhhccccccccCCcc-ccCCCCCccccccCCCCchhhhccCccccccccCCCCCccccCCCCChhhhhhhhccCCC
Q 002428          661 GETEKVEEGESLTVEEKPE-IADAPKENEVEEEDDDDDEEWDAKSWDDVNLNVKGAFDDEEADSEPEPLVKKEIKSAIPS  739 (923)
Q Consensus       661 ~~~~~~~~~~~~~~~~~~~-~~~~~~e~~~~~~~e~~~d~wd~~~~d~~~~~~~~~~~~ee~~~~~~~~~~~~~~~~~~~  739 (923)
                      .+.+.++..+.+.+.+... +.++++++..      ..++|++.    +++...+++++.++  ..++...++.+....+
T Consensus       359 ~d~~~~~~~e~~~~~e~e~~~~dv~~e~g~------~e~~~~~k----~~~~~~~d~dd~ee--~~~e~~~~e~~e~~~~  426 (1064)
T KOG1144|consen  359 VDTEEVDLEEDSNTDEKEGTPEDVDQEEGE------EEDDWDAK----VDLAIDGDDDDDEE--ELQEEVDKELKEAEEE  426 (1064)
T ss_pred             CcchhhccccccCCcccccCCCChhhhhcc------cchhhhcc----ccccccccccchhh--hhchhhhhcccccccc
Confidence            1222222212222222211 1111111111      12336553    34444454444332  1222222222111100


Q ss_pred             CCCccCCchhhccccCCCCCCcchhhhhcccchhhhccCccccCCCccccccCCCCEEEEEcCCCCCHHHHHHHHHcCcc
Q 002428          740 PRDAAEKPAVAVKKAIPEQPLKSQDAVTRKKEPAAKSKEPEVDATPKQAEENLRSPICCIMGHVDTGKTKLLDCIRGTNV  819 (923)
Q Consensus       740 ~~~~~~~~~~~~~~~~~~~~~~~e~~~~~~~~~~~rr~~r~~~~l~~~~~enlRnp~I~VLG~~GSGKSTLLN~LlgtnV  819 (923)
                      ... ...+.  ........+ ..++..++..+  ++...+........+++++|+|+||||||+++|||.||++|+++||
T Consensus       427 ~e~-s~~~~--~~a~~k~~~-~~~d~~t~~~~--~~~~~~~~~~~~~~~~~~lRSPIcCilGHVDTGKTKlld~ir~tNV  500 (1064)
T KOG1144|consen  427 EED-SEKPT--EDAAVKAIS-KVEDAATRTKR--AKIAKRATNESANESTENLRSPICCILGHVDTGKTKLLDKIRGTNV  500 (1064)
T ss_pred             hhh-ccccc--ccccccccc-ccchhhhhhhh--cchhccCchhhccccchhcCCceEEEeecccccchHHHHHhhcccc
Confidence            000 00000  000111111 22232222211  1122333344455677899999999999999999999999999999


Q ss_pred             ccCCCCcceeecceeeecccccccceeeeccccc--cCCCCEEEEeCCCCcchhhHHHhhccCCCEEEEEEeCCCCCCHh
Q 002428          820 QEGEAGGITQQIGATYFPAENIRERTRELKANAT--LKVPGLLVIDTPGHESFTNLRSRGSGLCDIAILVVDIMHGLEPQ  897 (923)
Q Consensus       820 q~geagGIT~qIgat~~p~e~i~ekt~~I~~~~~--~k~~~L~IIDTPGhEsf~nlrs~~ls~aDiVILVVDas~gle~q  897 (923)
                      +.++++|||++||++|||..+++.++..+..+..  |..|+|+|||||||++|.+++++++++||++|||||||||+.+|
T Consensus       501 qegeaggitqqIgAt~fp~~ni~e~tk~~~~~~K~~~kvPg~lvIdtpghEsFtnlRsrgsslC~~aIlvvdImhGlepq  580 (1064)
T KOG1144|consen  501 QEGEAGGITQQIGATYFPAENIREKTKELKKDAKKRLKVPGLLVIDTPGHESFTNLRSRGSSLCDLAILVVDIMHGLEPQ  580 (1064)
T ss_pred             ccccccceeeeccccccchHHHHHHHHHHHhhhhhhcCCCeeEEecCCCchhhhhhhhccccccceEEEEeehhccCCcc
Confidence            9999999999999999999999998888877655  88999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHhcCCcEEEEEeCCCcCC
Q 002428          898 TIESLNLLKMRNTEFIVALNKVRFSF  923 (923)
Q Consensus       898 tiEsL~lLkk~~iP~IVVLNKIDLL~  923 (923)
                      ++++|++|+.+++||||+|||||+||
T Consensus       581 tiESi~lLR~rktpFivALNKiDRLY  606 (1064)
T KOG1144|consen  581 TIESINLLRMRKTPFIVALNKIDRLY  606 (1064)
T ss_pred             hhHHHHHHHhcCCCeEEeehhhhhhc
Confidence            99999999999999999999999998

>COG0532 InfB Translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00491 aIF-2 translation initiation factor aIF-2/yIF-2 Back     alignment and domain information
>PRK04004 translation initiation factor IF-2; Validated Back     alignment and domain information
>PRK05306 infB translation initiation factor IF-2; Validated Back     alignment and domain information
>cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily Back     alignment and domain information
>TIGR00487 IF-2 translation initiation factor IF-2 Back     alignment and domain information
>PF00009 GTP_EFTU: Elongation factor Tu GTP binding domain; InterPro: IPR000795 Elongation factors belong to a family of proteins that promote the GTP-dependent binding of aminoacyl tRNA to the A site of ribosomes during protein biosynthesis, and catalyse the translocation of the synthesised protein chain from the A to the P site Back     alignment and domain information
>KOG1145 consensus Mitochondrial translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>CHL00189 infB translation initiation factor 2; Provisional Back     alignment and domain information
>cd04171 SelB SelB subfamily Back     alignment and domain information
>cd01890 LepA LepA subfamily Back     alignment and domain information
>cd01885 EF2 EF2 (for archaea and eukarya) Back     alignment and domain information
>cd01891 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA subfamily Back     alignment and domain information
>cd01884 EF_Tu EF-Tu subfamily Back     alignment and domain information
>cd04169 RF3 RF3 subfamily Back     alignment and domain information
>cd00881 GTP_translation_factor GTP translation factor family Back     alignment and domain information
>cd04124 RabL2 RabL2 subfamily Back     alignment and domain information
>cd01886 EF-G Elongation factor G (EF-G) subfamily Back     alignment and domain information
>cd04167 Snu114p Snu114p subfamily Back     alignment and domain information
>cd01889 SelB_euk SelB subfamily Back     alignment and domain information
>cd04168 TetM_like Tet(M)-like subfamily Back     alignment and domain information
>cd04166 CysN_ATPS CysN_ATPS subfamily Back     alignment and domain information
>cd04113 Rab4 Rab4 subfamily Back     alignment and domain information
>cd04119 RJL RJL (RabJ-Like) subfamily Back     alignment and domain information
>TIGR00475 selB selenocysteine-specific elongation factor SelB Back     alignment and domain information
>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily Back     alignment and domain information
>TIGR01394 TypA_BipA GTP-binding protein TypA/BipA Back     alignment and domain information
>cd01864 Rab19 Rab19 subfamily Back     alignment and domain information
>PRK14845 translation initiation factor IF-2; Provisional Back     alignment and domain information
>cd01894 EngA1 EngA1 subfamily Back     alignment and domain information
>cd01875 RhoG RhoG subfamily Back     alignment and domain information
>cd04106 Rab23_lke Rab23-like subfamily Back     alignment and domain information
>cd01861 Rab6 Rab6 subfamily Back     alignment and domain information
>cd01862 Rab7 Rab7 subfamily Back     alignment and domain information
>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily Back     alignment and domain information
>cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily Back     alignment and domain information
>CHL00071 tufA elongation factor Tu Back     alignment and domain information
>cd01895 EngA2 EngA2 subfamily Back     alignment and domain information
>PLN00116 translation elongation factor EF-2 subunit; Provisional Back     alignment and domain information
>cd01866 Rab2 Rab2 subfamily Back     alignment and domain information
>cd04132 Rho4_like Rho4-like subfamily Back     alignment and domain information
>COG1159 Era GTPase [General function prediction only] Back     alignment and domain information
>smart00175 RAB Rab subfamily of small GTPases Back     alignment and domain information
>cd04107 Rab32_Rab38 Rab38/Rab32 subfamily Back     alignment and domain information
>cd04122 Rab14 Rab14 subfamily Back     alignment and domain information
>PLN03126 Elongation factor Tu; Provisional Back     alignment and domain information
>cd04136 Rap_like Rap-like subfamily Back     alignment and domain information
>cd04140 ARHI_like ARHI subfamily Back     alignment and domain information
>PRK12736 elongation factor Tu; Reviewed Back     alignment and domain information
>cd04157 Arl6 Arl6 subfamily Back     alignment and domain information
>smart00173 RAS Ras subfamily of RAS small GTPases Back     alignment and domain information
>cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily Back     alignment and domain information
>PLN03127 Elongation factor Tu; Provisional Back     alignment and domain information
>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily Back     alignment and domain information
>cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2 Back     alignment and domain information
>cd04127 Rab27A Rab27a subfamily Back     alignment and domain information
>PTZ00369 Ras-like protein; Provisional Back     alignment and domain information
>cd04154 Arl2 Arl2 subfamily Back     alignment and domain information
>cd04163 Era Era subfamily Back     alignment and domain information
>cd01860 Rab5_related Rab5-related subfamily Back     alignment and domain information
>cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans Back     alignment and domain information
>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB Back     alignment and domain information
>cd04120 Rab12 Rab12 subfamily Back     alignment and domain information
>cd04170 EF-G_bact Elongation factor G (EF-G) subfamily Back     alignment and domain information
>cd01874 Cdc42 Cdc42 subfamily Back     alignment and domain information
>PRK05433 GTP-binding protein LepA; Provisional Back     alignment and domain information
>cd04133 Rop_like Rop subfamily Back     alignment and domain information
>COG0480 FusA Translation elongation factors (GTPases) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd04116 Rab9 Rab9 subfamily Back     alignment and domain information
>smart00174 RHO Rho (Ras homology) subfamily of Ras-like small GTPases Back     alignment and domain information
>cd04172 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily Back     alignment and domain information
>PF02421 FeoB_N: Ferrous iron transport protein B; InterPro: IPR011619 Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions Back     alignment and domain information
>PRK00741 prfC peptide chain release factor 3; Provisional Back     alignment and domain information
>cd00154 Rab Rab family Back     alignment and domain information
>cd04175 Rap1 Rap1 subgroup Back     alignment and domain information
>TIGR01393 lepA GTP-binding protein LepA Back     alignment and domain information
>cd01865 Rab3 Rab3 subfamily Back     alignment and domain information
>PRK10218 GTP-binding protein; Provisional Back     alignment and domain information
>cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>TIGR00485 EF-Tu translation elongation factor TU Back     alignment and domain information
>PLN03071 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>PRK00089 era GTPase Era; Reviewed Back     alignment and domain information
>cd04160 Arfrp1 Arfrp1 subfamily Back     alignment and domain information
>cd01863 Rab18 Rab18 subfamily Back     alignment and domain information
>PRK12735 elongation factor Tu; Reviewed Back     alignment and domain information
>cd01871 Rac1_like Rac1-like subfamily Back     alignment and domain information
>PRK12317 elongation factor 1-alpha; Reviewed Back     alignment and domain information
>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes Back     alignment and domain information
>cd04114 Rab30 Rab30 subfamily Back     alignment and domain information
>cd04176 Rap2 Rap2 subgroup Back     alignment and domain information
>cd01888 eIF2_gamma eIF2-gamma (gamma subunit of initiation factor 2) Back     alignment and domain information
>cd04131 Rnd Rnd subfamily Back     alignment and domain information
>PRK10512 selenocysteinyl-tRNA-specific translation factor; Provisional Back     alignment and domain information
>cd04152 Arl4_Arl7 Arl4/Arl7 subfamily Back     alignment and domain information
>cd04123 Rab21 Rab21 subfamily Back     alignment and domain information
>cd00157 Rho Rho (Ras homology) family Back     alignment and domain information
>cd01868 Rab11_like Rab11-like Back     alignment and domain information
>cd04101 RabL4 RabL4 (Rab-like4) subfamily Back     alignment and domain information
>cd04134 Rho3 Rho3 subfamily Back     alignment and domain information
>cd01883 EF1_alpha Eukaryotic elongation factor 1 (EF1) alpha subfamily Back     alignment and domain information
>TIGR00484 EF-G translation elongation factor EF-G Back     alignment and domain information
>cd01898 Obg Obg subfamily Back     alignment and domain information
>cd01879 FeoB Ferrous iron transport protein B (FeoB) subfamily Back     alignment and domain information
>cd04144 Ras2 Ras2 subfamily Back     alignment and domain information
>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases Back     alignment and domain information
>PRK00049 elongation factor Tu; Reviewed Back     alignment and domain information
>KOG0084 consensus GTPase Rab1/YPT1, small G protein superfamily, and related GTP-binding proteins [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd04162 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily Back     alignment and domain information
>cd04110 Rab35 Rab35 subfamily Back     alignment and domain information
>PRK12739 elongation factor G; Reviewed Back     alignment and domain information
>TIGR00503 prfC peptide chain release factor 3 Back     alignment and domain information
>cd01893 Miro1 Miro1 subfamily Back     alignment and domain information
>cd04135 Tc10 TC10 subfamily Back     alignment and domain information
>TIGR00436 era GTP-binding protein Era Back     alignment and domain information
>cd04165 GTPBP1_like GTPBP1-like Back     alignment and domain information
>PRK00007 elongation factor G; Reviewed Back     alignment and domain information
>cd04112 Rab26 Rab26 subfamily Back     alignment and domain information
>cd04174 Rnd1_Rho6 Rnd1/Rho6 subfamily Back     alignment and domain information
>cd04151 Arl1 Arl1 subfamily Back     alignment and domain information
>TIGR02034 CysN sulfate adenylyltransferase, large subunit Back     alignment and domain information
>cd04149 Arf6 Arf6 subfamily Back     alignment and domain information
>cd04118 Rab24 Rab24 subfamily Back     alignment and domain information
>cd04109 Rab28 Rab28 subfamily Back     alignment and domain information
>cd04102 RabL3 RabL3 (Rab-like3) subfamily Back     alignment and domain information
>KOG0462 consensus Elongation factor-type GTP-binding protein [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00231 small_GTP small GTP-binding protein domain Back     alignment and domain information
>cd04159 Arl10_like Arl10-like subfamily Back     alignment and domain information
>PRK03003 GTP-binding protein Der; Reviewed Back     alignment and domain information
>cd04156 ARLTS1 ARLTS1 subfamily Back     alignment and domain information
>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse Back     alignment and domain information
>cd01878 HflX HflX subfamily Back     alignment and domain information
>cd04108 Rab36_Rab34 Rab34/Rab36 subfamily Back     alignment and domain information
>cd04139 RalA_RalB RalA/RalB subfamily Back     alignment and domain information
>cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily Back     alignment and domain information
>cd04150 Arf1_5_like Arf1-Arf5-like subfamily Back     alignment and domain information
>cd01870 RhoA_like RhoA-like subfamily Back     alignment and domain information
>smart00177 ARF ARF-like small GTPases; ARF, ADP-ribosylation factor Back     alignment and domain information
>cd04105 SR_beta Signal recognition particle receptor, beta subunit (SR-beta) Back     alignment and domain information
>cd01892 Miro2 Miro2 subfamily Back     alignment and domain information
>cd04121 Rab40 Rab40 subfamily Back     alignment and domain information
>PTZ00141 elongation factor 1- alpha; Provisional Back     alignment and domain information
>PRK05124 cysN sulfate adenylyltransferase subunit 1; Provisional Back     alignment and domain information
>cd04130 Wrch_1 Wrch-1 subfamily Back     alignment and domain information
>cd04125 RabA_like RabA-like subfamily Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>PTZ00416 elongation factor 2; Provisional Back     alignment and domain information
>cd04117 Rab15 Rab15 subfamily Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>cd04153 Arl5_Arl8 Arl5/Arl8 subfamily Back     alignment and domain information
>cd04173 Rnd2_Rho7 Rnd2/Rho7 subfamily Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>PLN03118 Rab family protein; Provisional Back     alignment and domain information
>PLN03110 Rab GTPase; Provisional Back     alignment and domain information
>cd00879 Sar1 Sar1 subfamily Back     alignment and domain information
>KOG0394 consensus Ras-related GTPase [General function prediction only] Back     alignment and domain information
>cd04126 Rab20 Rab20 subfamily Back     alignment and domain information
>smart00178 SAR Sar1p-like members of the Ras-family of small GTPases Back     alignment and domain information
>PLN00223 ADP-ribosylation factor; Provisional Back     alignment and domain information
>PRK15494 era GTPase Era; Provisional Back     alignment and domain information
>cd04147 Ras_dva Ras-dva subfamily Back     alignment and domain information
>PRK04213 GTP-binding protein; Provisional Back     alignment and domain information
>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily Back     alignment and domain information
>TIGR00483 EF-1_alpha translation elongation factor EF-1 alpha Back     alignment and domain information
>cd04111 Rab39 Rab39 subfamily Back     alignment and domain information
>cd04146 RERG_RasL11_like RERG/RasL11-like subfamily Back     alignment and domain information
>TIGR03680 eif2g_arch translation initiation factor 2 subunit gamma Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>cd00880 Era_like Era (E Back     alignment and domain information
>PLN00043 elongation factor 1-alpha; Provisional Back     alignment and domain information
>cd04158 ARD1 ARD1 subfamily Back     alignment and domain information
>KOG0092 consensus GTPase Rab5/YPT51 and related small G protein superfamily GTPases [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd04177 RSR1 RSR1 subgroup Back     alignment and domain information
>PRK13351 elongation factor G; Reviewed Back     alignment and domain information
>cd04128 Spg1 Spg1p Back     alignment and domain information
>PLN03108 Rab family protein; Provisional Back     alignment and domain information
>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases Back     alignment and domain information
>cd00876 Ras Ras family Back     alignment and domain information
>PTZ00133 ADP-ribosylation factor; Provisional Back     alignment and domain information
>PRK07560 elongation factor EF-2; Reviewed Back     alignment and domain information
>COG1217 TypA Predicted membrane GTPase involved in stress response [Signal transduction mechanisms] Back     alignment and domain information
>PRK03003 GTP-binding protein Der; Reviewed Back     alignment and domain information
>PLN00023 GTP-binding protein; Provisional Back     alignment and domain information
>COG5256 TEF1 Translation elongation factor EF-1alpha (GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PTZ00327 eukaryotic translation initiation factor 2 gamma subunit; Provisional Back     alignment and domain information
>TIGR00490 aEF-2 translation elongation factor aEF-2 Back     alignment and domain information
>cd04142 RRP22 RRP22 subfamily Back     alignment and domain information
>cd04143 Rhes_like Rhes_like subfamily Back     alignment and domain information
>TIGR00450 mnmE_trmE_thdF tRNA modification GTPase TrmE Back     alignment and domain information
>cd04155 Arl3 Arl3 subfamily Back     alignment and domain information
>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional Back     alignment and domain information
>COG1160 Predicted GTPases [General function prediction only] Back     alignment and domain information
>TIGR03156 GTP_HflX GTP-binding protein HflX Back     alignment and domain information
>KOG0094 consensus GTPase Rab6/YPT6/Ryh1, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>smart00176 RAN Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>PF00071 Ras: Ras family; InterPro: IPR001806 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>TIGR02528 EutP ethanolamine utilization protein, EutP Back     alignment and domain information
>PRK00454 engB GTP-binding protein YsxC; Reviewed Back     alignment and domain information
>KOG0098 consensus GTPase Rab2, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd01881 Obg_like The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1 Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>COG1100 GTPase SAR1 and related small G proteins [General function prediction only] Back     alignment and domain information
>PRK04000 translation initiation factor IF-2 subunit gamma; Validated Back     alignment and domain information
>PRK05291 trmE tRNA modification GTPase TrmE; Reviewed Back     alignment and domain information
>KOG0080 consensus GTPase Rab18, small G protein superfamily [General function prediction only] Back     alignment and domain information
>KOG0087 consensus GTPase Rab11/YPT3, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG4108 PrfC Peptide chain release factor RF-3 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd00882 Ras_like_GTPase Ras-like GTPase superfamily Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>KOG0467 consensus Translation elongation factor 2/ribosome biogenesis protein RIA1 and related proteins [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd04148 RGK RGK subfamily Back     alignment and domain information
>PRK11058 GTPase HflX; Provisional Back     alignment and domain information
>COG0218 Predicted GTPase [General function prediction only] Back     alignment and domain information
>PTZ00132 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>KOG0078 consensus GTP-binding protein SEC4, small G protein superfamily, and related Ras family GTP-binding proteins [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG2895 CysN GTPases - Sulfate adenylate transferase subunit 1 [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK12299 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>COG1084 Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd04129 Rho2 Rho2 subfamily Back     alignment and domain information
>PF00025 Arf: ADP-ribosylation factor family The prints entry specific to Sar1 proteins The Prosite entry specific to Sar1 proteins; InterPro: IPR006689 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>KOG0095 consensus GTPase Rab30, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd01876 YihA_EngB The YihA (EngB) subfamily Back     alignment and domain information
>cd01873 RhoBTB RhoBTB subfamily Back     alignment and domain information
>KOG0468 consensus U5 snRNP-specific protein [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0481 LepA Membrane GTPase LepA [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR02729 Obg_CgtA Obg family GTPase CgtA Back     alignment and domain information
>PRK09554 feoB ferrous iron transport protein B; Reviewed Back     alignment and domain information
>cd04103 Centaurin_gamma Centaurin gamma Back     alignment and domain information
>PRK12298 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>COG2229 Predicted GTPase [General function prediction only] Back     alignment and domain information
>KOG0093 consensus GTPase Rab3, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0086 consensus GTPase Rab4, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK15467 ethanolamine utilization protein EutP; Provisional Back     alignment and domain information
>KOG0079 consensus GTP-binding protein H-ray, small G protein superfamily [General function prediction only] Back     alignment and domain information
>COG0050 TufB GTPases - translation elongation factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK12296 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>PRK12297 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>COG1160 Predicted GTPases [General function prediction only] Back     alignment and domain information
>KOG0458 consensus Elongation factor 1 alpha [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd01882 BMS1 Bms1 Back     alignment and domain information
>PF09439 SRPRB: Signal recognition particle receptor beta subunit; InterPro: IPR019009 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>cd01850 CDC_Septin CDC/Septin Back     alignment and domain information
>cd04104 p47_IIGP_like p47 (47-kDa) family Back     alignment and domain information
>PRK12740 elongation factor G; Reviewed Back     alignment and domain information
>KOG0395 consensus Ras-related GTPase [General function prediction only] Back     alignment and domain information
>cd01852 AIG1 AIG1 (avrRpt2-induced gene 1) Back     alignment and domain information
>COG0486 ThdF Predicted GTPase [General function prediction only] Back     alignment and domain information
>KOG0073 consensus GTP-binding ADP-ribosylation factor-like protein ARL2 [Intracellular trafficking, secretion, and vesicular transport; Cytoskeleton] Back     alignment and domain information
>KOG0465 consensus Mitochondrial elongation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF00350 Dynamin_N: Dynamin family; InterPro: IPR001401 Membrane transport between compartments in eukaryotic cells requires proteins that allow the budding and scission of nascent cargo vesicles from one compartment and their targeting and fusion with another Back     alignment and domain information
>cd01896 DRG The developmentally regulated GTP-binding protein (DRG) subfamily is an uncharacterized member of the Obg family, an evolutionary branch of GTPase superfamily proteins Back     alignment and domain information
>KOG0097 consensus GTPase Rab14, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>smart00053 DYNc Dynamin, GTPase Back     alignment and domain information
>KOG0088 consensus GTPase Rab21, small G protein superfamily [General function prediction only] Back     alignment and domain information
>KOG1423 consensus Ras-like GTPase ERA [Cell cycle control, cell division, chromosome partitioning; Signal transduction mechanisms] Back     alignment and domain information
>KOG0461 consensus Selenocysteine-specific elongation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00437 feoB ferrous iron transporter FeoB Back     alignment and domain information
>COG3276 SelB Selenocysteine-specific translation elongation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1532 consensus GTPase XAB1, interacts with DNA repair protein XPA [Replication, recombination and repair] Back     alignment and domain information
>KOG0464 consensus Elongation factor G [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0460 consensus Mitochondrial translation elongation factor Tu [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0370 FeoB Fe2+ transport system protein B [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK09866 hypothetical protein; Provisional Back     alignment and domain information
>COG3596 Predicted GTPase [General function prediction only] Back     alignment and domain information
>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways Back     alignment and domain information
>KOG1490 consensus GTP-binding protein CRFG/NOG1 (ODN superfamily) [General function prediction only] Back     alignment and domain information
>KOG0075 consensus GTP-binding ADP-ribosylation factor-like protein [General function prediction only] Back     alignment and domain information
>COG5257 GCD11 Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0091 consensus GTPase Rab39, small G protein superfamily [General function prediction only] Back     alignment and domain information
>cd01853 Toc34_like Toc34-like (Translocon at the Outer-envelope membrane of Chloroplasts) Back     alignment and domain information
>KOG1954 consensus Endocytosis/signaling protein EHD1 [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0070 consensus GTP-binding ADP-ribosylation factor Arf1 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3883 consensus Ras family small GTPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0469 consensus Elongation factor 2 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0074 consensus GTP-binding ADP-ribosylation factor-like protein ARL3 [General function prediction only] Back     alignment and domain information
>PF04670 Gtr1_RagA: Gtr1/RagA G protein conserved region; InterPro: IPR006762 GTR1 was first identified in Saccharomyces cerevisiae (Baker's yeast) as a suppressor of a mutation in RCC1 Back     alignment and domain information
>TIGR00991 3a0901s02IAP34 GTP-binding protein (Chloroplast Envelope Protein Translocase) Back     alignment and domain information
>KOG0393 consensus Ras-related small GTPase, Rho type [General function prediction only] Back     alignment and domain information
>PF04548 AIG1: AIG1 family; InterPro: IPR006703 This entry represents a domain found in Arabidopsis protein AIG1 which appears to be involved in plant resistance to bacteria Back     alignment and domain information
>PF00735 Septin: Septin; InterPro: IPR000038 Septins constitute a eukaryotic family of guanine nucleotide-binding proteins, most of which polymerise to form filaments [] Back     alignment and domain information
>KOG1144 consensus Translation initiation factor 5B (eIF-5B) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity Back     alignment and domain information
>KOG0083 consensus GTPase Rab26/Rab37, small G protein superfamily [General function prediction only] Back     alignment and domain information
>KOG1489 consensus Predicted GTP-binding protein (ODN superfamily) [General function prediction only] Back     alignment and domain information
>KOG1191 consensus Mitochondrial GTPase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF05049 IIGP: Interferon-inducible GTPase (IIGP); InterPro: IPR007743 Interferon-inducible GTPase (IIGP) is thought to play a role in in intracellular defence Back     alignment and domain information
>KOG4252 consensus GTP-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG1707 consensus Predicted Ras related/Rac-GTP binding protein [Defense mechanisms] Back     alignment and domain information
>KOG0081 consensus GTPase Rab27, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG2262 HflX GTPases [General function prediction only] Back     alignment and domain information
>PRK13768 GTPase; Provisional Back     alignment and domain information
>KOG0071 consensus GTP-binding ADP-ribosylation factor Arf6 (dArf3) [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG0536 Obg Predicted GTPase [General function prediction only] Back     alignment and domain information
>KOG0076 consensus GTP-binding ADP-ribosylation factor-like protein yARL3 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5258 GTPBP1 GTPase [General function prediction only] Back     alignment and domain information
>KOG0090 consensus Signal recognition particle receptor, beta subunit (small G protein superfamily) [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5192 BMS1 GTP-binding protein required for 40S ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR02836 spore_IV_A stage IV sporulation protein A Back     alignment and domain information
>KOG1143 consensus Predicted translation elongation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd01899 Ygr210 Ygr210 subfamily Back     alignment and domain information
>PTZ00258 GTP-binding protein; Provisional Back     alignment and domain information
>COG5019 CDC3 Septin family protein [Cell division and chromosome partitioning / Cytoskeleton] Back     alignment and domain information
>TIGR00993 3a0901s04IAP86 chloroplast protein import component Toc86/159, G and M domains Back     alignment and domain information
>KOG0096 consensus GTPase Ran/TC4/GSP1 (nuclear protein transport pathway), small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PTZ00099 rab6; Provisional Back     alignment and domain information
>PRK09601 GTP-binding protein YchF; Reviewed Back     alignment and domain information
>PRK09602 translation-associated GTPase; Reviewed Back     alignment and domain information
>KOG0463 consensus GTP-binding protein GP-1 [General function prediction only] Back     alignment and domain information
>KOG2655 consensus Septin family protein (P-loop GTPase) [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0077 consensus Vesicle coat complex COPII, GTPase subunit SAR1 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0072 consensus GTP-binding ADP-ribosylation factor-like protein ARL1 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd01900 YchF YchF subfamily Back     alignment and domain information
>KOG2486 consensus Predicted GTPase [General function prediction only] Back     alignment and domain information
>KOG1673 consensus Ras GTPases [General function prediction only] Back     alignment and domain information
>COG1163 DRG Predicted GTPase [General function prediction only] Back     alignment and domain information
>COG0012 Predicted GTPase, probable translation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd03112 CobW_like The function of this protein family is unkown Back     alignment and domain information
>smart00275 G_alpha G protein alpha subunit Back     alignment and domain information
>KOG1547 consensus Septin CDC10 and related P-loop GTPases [Cell cycle control, cell division, chromosome partitioning; Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>TIGR00750 lao LAO/AO transport system ATPase Back     alignment and domain information
>KOG0466 consensus Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK09435 membrane ATPase/protein kinase; Provisional Back     alignment and domain information
>cd00066 G-alpha G protein alpha subunit Back     alignment and domain information
>TIGR00073 hypB hydrogenase accessory protein HypB Back     alignment and domain information
>KOG0410 consensus Predicted GTP binding protein [General function prediction only] Back     alignment and domain information
>COG4917 EutP Ethanolamine utilization protein [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0459 consensus Polypeptide release factor 3 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>cd01858 NGP_1 NGP-1 Back     alignment and domain information
>cd01851 GBP Guanylate-binding protein (GBP), N-terminal domain Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd04178 Nucleostemin_like Nucleostemin-like Back     alignment and domain information
>PF02492 cobW: CobW/HypB/UreG, nucleotide-binding domain; InterPro: IPR003495 Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt Back     alignment and domain information
>TIGR00092 GTP-binding protein YchF Back     alignment and domain information
>KOG4423 consensus GTP-binding protein-like, RAS superfamily [Signal transduction mechanisms] Back     alignment and domain information
>COG0523 Putative GTPases (G3E family) [General function prediction only] Back     alignment and domain information
>cd01849 YlqF_related_GTPase YlqF-related GTPases Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>TIGR03597 GTPase_YqeH ribosome biogenesis GTPase YqeH Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>cd01857 HSR1_MMR1 HSR1/MMR1 Back     alignment and domain information
>PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>KOG3886 consensus GTP-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>cd01855 YqeH YqeH Back     alignment and domain information
>KOG0448 consensus Mitofusin 1 GTPase, involved in mitochondrila biogenesis [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03110 Fer4_NifH_child This protein family's function is unkown Back     alignment and domain information
>KOG0082 consensus G-protein alpha subunit (small G protein superfamily) [Cell cycle control, cell division, chromosome partitioning; Signal transduction mechanisms] Back     alignment and domain information
>cd03114 ArgK-like The function of this protein family is unkown Back     alignment and domain information
>KOG1491 consensus Predicted GTP-binding protein (ODN superfamily) [General function prediction only] Back     alignment and domain information
>TIGR00101 ureG urease accessory protein UreG Back     alignment and domain information
>TIGR03348 VI_IcmF type VI secretion protein IcmF Back     alignment and domain information
>PRK09563 rbgA GTPase YlqF; Reviewed Back     alignment and domain information
>TIGR03596 GTPase_YlqF ribosome biogenesis GTP-binding protein YlqF Back     alignment and domain information
>KOG3859 consensus Septins (P-loop GTPases) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF00503 G-alpha: G-protein alpha subunit; InterPro: IPR001019 Guanine nucleotide binding proteins (G proteins) are membrane-associated, heterotrimeric proteins composed of three subunits: alpha (IPR001019 from INTERPRO), beta (IPR001632 from INTERPRO) and gamma (IPR001770 from INTERPRO) [] Back     alignment and domain information
>PRK11537 putative GTP-binding protein YjiA; Provisional Back     alignment and domain information
>smart00010 small_GTPase Small GTPase of the Ras superfamily; ill-defined subfamily Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR02475 CobW cobalamin biosynthesis protein CobW Back     alignment and domain information
>COG3640 CooC CO dehydrogenase maturation factor [Cell division and chromosome partitioning] Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>cd01856 YlqF YlqF Back     alignment and domain information
>KOG1707 consensus Predicted Ras related/Rac-GTP binding protein [Defense mechanisms] Back     alignment and domain information
>PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components Back     alignment and domain information
>KOG1534 consensus Putative transcription factor FET5 [Transcription] Back     alignment and domain information
>COG1161 Predicted GTPases [General function prediction only] Back     alignment and domain information
>PRK12288 GTPase RsgA; Reviewed Back     alignment and domain information
>cd02036 MinD Bacterial cell division requires the formation of a septum at mid-cell Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK12289 GTPase RsgA; Reviewed Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] Back     alignment and domain information
>COG1162 Predicted GTPases [General function prediction only] Back     alignment and domain information
>cd01859 MJ1464 MJ1464 Back     alignment and domain information
>TIGR00157 ribosome small subunit-dependent GTPase A Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK13695 putative NTPase; Provisional Back     alignment and domain information
>KOG1486 consensus GTP-binding protein DRG2 (ODN superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0447 consensus Dynamin-like GTP binding protein [General function prediction only] Back     alignment and domain information
>cd02038 FleN-like FleN is a member of the Fer4_NifH superfamily Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain Back     alignment and domain information
>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional Back     alignment and domain information
>cd01859 MJ1464 MJ1464 Back     alignment and domain information
>COG3523 IcmF Type VI protein secretion system component VasK [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd01854 YjeQ_engC YjeQ/EngC Back     alignment and domain information
>cd02037 MRP-like MRP (Multiple Resistance and pH adaptation) is a homologue of the Fer4_NifH superfamily Back     alignment and domain information
>PRK00098 GTPase RsgA; Reviewed Back     alignment and domain information
>KOG1424 consensus Predicted GTP-binding protein MMR1 [General function prediction only] Back     alignment and domain information
>cd01857 HSR1_MMR1 HSR1/MMR1 Back     alignment and domain information
>KOG2485 consensus Conserved ATP/GTP binding protein [General function prediction only] Back     alignment and domain information
>KOG3905 consensus Dynein light intermediate chain [Cell motility] Back     alignment and domain information
>KOG1533 consensus Predicted GTPase [General function prediction only] Back     alignment and domain information
>KOG0052 consensus Translation elongation factor EF-1 alpha/Tu [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd02042 ParA ParA and ParB of Caulobacter crescentus belong to a conserved family of bacterial proteins implicated in chromosome segregation Back     alignment and domain information
>PRK13796 GTPase YqeH; Provisional Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>cd03111 CpaE_like This protein family consists of proteins similar to the cpaE protein of the Caulobacter pilus assembly and the orf4 protein of Actinobacillus pilus formation gene cluster Back     alignment and domain information
>KOG1487 consensus GTP-binding protein DRG1 (ODN superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>COG0378 HypB Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase [Posttranslational modification, protein turnover, chaperones / Transcription] Back     alignment and domain information
>KOG3887 consensus Predicted small GTPase involved in nuclear protein import [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF09547 Spore_IV_A: Stage IV sporulation protein A (spore_IV_A); InterPro: IPR014201 This entry is designated stage IV sporulation protein A Back     alignment and domain information
>PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] Back     alignment and domain information
>KOG4181 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>KOG2743 consensus Cobalamin synthesis protein [Coenzyme transport and metabolism] Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG2484 consensus GTPase [General function prediction only] Back     alignment and domain information
>cd01855 YqeH YqeH Back     alignment and domain information
>TIGR01969 minD_arch cell division ATPase MinD, archaeal Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>cd01856 YlqF YlqF Back     alignment and domain information
>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PRK13849 putative crown gall tumor protein VirC1; Provisional Back     alignment and domain information
>TIGR03596 GTPase_YlqF ribosome biogenesis GTP-binding protein YlqF Back     alignment and domain information
>cd02032 Bchl_like This family of proteins contains bchL and chlL Back     alignment and domain information
>PHA02518 ParA-like protein; Provisional Back     alignment and domain information
>TIGR00157 ribosome small subunit-dependent GTPase A Back     alignment and domain information
>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0099 consensus G protein subunit Galphas, small G protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>PF01656 CbiA: CobQ/CobB/MinD/ParA nucleotide binding domain; InterPro: IPR002586 This entry consists of various cobyrinic acid a,c-diamide synthases Back     alignment and domain information
>TIGR01281 DPOR_bchL light-independent protochlorophyllide reductase, iron-sulfur ATP-binding protein Back     alignment and domain information
>PF06858 NOG1: Nucleolar GTP-binding protein 1 (NOG1); InterPro: IPR010674 This domain represents a conserved region of approximately 60 residues in length within nucleolar GTP-binding protein 1 (NOG1) Back     alignment and domain information
>cd02117 NifH_like This family contains the NifH (iron protein) of nitrogenase, L subunit (BchL/ChlL) of the protochlorophyllide reductase and the BchX subunit of the Chlorophyllide reductase Back     alignment and domain information
>PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A Back     alignment and domain information
>KOG0446 consensus Vacuolar sorting protein VPS1, dynamin, and related proteins [Intracellular trafficking, secretion, and vesicular transport; General function prediction only] Back     alignment and domain information
>PRK09563 rbgA GTPase YlqF; Reviewed Back     alignment and domain information
>PF05783 DLIC: Dynein light intermediate chain (DLIC); InterPro: IPR022780 This entry consists of several eukaryotic dynein light intermediate chain proteins Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>PRK11670 antiporter inner membrane protein; Provisional Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>PRK01889 GTPase RsgA; Reviewed Back     alignment and domain information
>KOG0780 consensus Signal recognition particle, subunit Srp54 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR03371 cellulose_yhjQ cellulose synthase operon protein YhjQ Back     alignment and domain information
>PRK08099 bifunctional DNA-binding transcriptional repressor/ NMN adenylyltransferase; Provisional Back     alignment and domain information
>PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional Back     alignment and domain information
>KOG2423 consensus Nucleolar GTPase [General function prediction only] Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>CHL00072 chlL photochlorophyllide reductase subunit L Back     alignment and domain information
>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>PRK11519 tyrosine kinase; Provisional Back     alignment and domain information
>KOG3022 consensus Predicted ATPase, nucleotide-binding [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>PRK13185 chlL protochlorophyllide reductase iron-sulfur ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01005 eps_transp_fam exopolysaccharide transport protein family Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>cd02035 ArsA ArsA ATPase functionas as an efflux pump located on the inner membrane of the cell Back     alignment and domain information
>TIGR03597 GTPase_YqeH ribosome biogenesis GTPase YqeH Back     alignment and domain information
>PRK09841 cryptic autophosphorylating protein tyrosine kinase Etk; Provisional Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA Back     alignment and domain information
>PRK00098 GTPase RsgA; Reviewed Back     alignment and domain information
>KOG2749 consensus mRNA cleavage and polyadenylation factor IA/II complex, subunit CLP1 [RNA processing and modification] Back     alignment and domain information
>PRK12289 GTPase RsgA; Reviewed Back     alignment and domain information
>PRK09354 recA recombinase A; Provisional Back     alignment and domain information
>PRK05057 aroK shikimate kinase I; Reviewed Back     alignment and domain information
>PRK04328 hypothetical protein; Provisional Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PF13479 AAA_24: AAA domain Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>KOG0781 consensus Signal recognition particle receptor, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK06762 hypothetical protein; Provisional Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02858 spore_III_AA stage III sporulation protein AA Back     alignment and domain information
>KOG0066 consensus eIF2-interacting protein ABC50 (ABC superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK01889 GTPase RsgA; Reviewed Back     alignment and domain information
>PRK05416 glmZ(sRNA)-inactivating NTPase; Provisional Back     alignment and domain information
>PRK05973 replicative DNA helicase; Provisional Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>COG0455 flhG Antiactivator of flagellar biosynthesis FleN, an ATPase [Cell motility] Back     alignment and domain information
>PRK14737 gmk guanylate kinase; Provisional Back     alignment and domain information
>PF05879 RHD3: Root hair defective 3 GTP-binding protein (RHD3); InterPro: IPR008803 This family consists of several eukaryotic root hair defective 3 like GTP-binding proteins Back     alignment and domain information
>PF07015 VirC1: VirC1 protein; InterPro: IPR009744 This family consists of several bacterial VirC1 proteins Back     alignment and domain information
>PRK13232 nifH nitrogenase reductase; Reviewed Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PTZ00121 MAEBL; Provisional Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query923
1g7s_A 594 X-Ray Structure Of Translation Initiation Factor If 2e-34
1g7r_A 594 X-Ray Structure Of Translation Initiation Factor If 1e-33
2lkc_A178 Free B.St If2-G2 Length = 178 4e-24
1zo1_I 501 If2, If1, And Trna Fitted To Cryo-Em Data Of E. Col 3e-21
3izy_P 537 Mammalian Mitochondrial Translation Initiation Fact 5e-19
4ac9_A 482 Crystal Structure Of Translation Elongation Factor 2e-06
2ywg_A 600 Crystal Structure Of Gtp-Bound Lepa From Aquifex Ae 1e-05
3cb4_D 599 The Crystal Structure Of Lepa Length = 599 2e-05
3deg_C 545 Complex Of Elongating Escherichia Coli 70s Ribosome 2e-05
2ywe_A 600 Crystal Structure Of Lepa From Aquifex Aeolicus Len 2e-05
1zun_B 434 Crystal Structure Of A Gtp-Regulated Atp Sulfurylas 2e-05
3vqt_A 548 Crystal Structure Analysis Of The Translation Facto 1e-04
3tr5_A 528 Structure Of A Peptide Chain Release Factor 3 (Prfc 3e-04
>pdb|1G7S|A Chain A, X-Ray Structure Of Translation Initiation Factor If2EIF5B Complexed With Gdp Length = 594 Back     alignment and structure 
Iteration: 1

 Score =  144 bits (364), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 70/130 (53%), Positives = 89/130 (68%), Gaps = 2/130 (1%)
Query: 792 LRSPICCIMGHVDTGKTKLLDCIRGTNVQEGEAGGITQQIGATYFPAENIRERTRELKAN 851
           +RSPI  ++GHVD GKT LLD IRG+ V   EAGGITQ IGAT  P + I     +    
Sbjct: 3   IRSPIVSVLGHVDHGKTTLLDHIRGSAVASREAGGITQHIGATEIPMDVIEGICGDFLKK 62
Query: 852 ATLK--VPGLLVIDTPGHESFTNLRSRGSGLCDIAILVVDIMHGLEPQTIESLNLLKMRN 909
            +++  +PGL  IDTPGHE+FT LR RG  L D+AIL+VDI  G +PQT E+LN+L+M  
Sbjct: 63  FSIRETLPGLFFIDTPGHEAFTTLRKRGGALADLAILIVDINEGFKPQTQEALNILRMYR 122
Query: 910 TEFIVALNKV 919
           T F+VA NK+
Sbjct: 123 TPFVVAANKI 132
>pdb|1G7R|A Chain A, X-Ray Structure Of Translation Initiation Factor If2EIF5B Length = 594 Back     alignment and structure
>pdb|2LKC|A Chain A, Free B.St If2-G2 Length = 178 Back     alignment and structure
>pdb|1ZO1|I Chain I, If2, If1, And Trna Fitted To Cryo-Em Data Of E. Coli 70s Initiation Complex Length = 501 Back     alignment and structure
>pdb|3IZY|P Chain P, Mammalian Mitochondrial Translation Initiation Factor 2 Length = 537 Back     alignment and structure
>pdb|4AC9|A Chain A, Crystal Structure Of Translation Elongation Factor Selb From Methanococcus Maripaludis In Complex With Gdp Length = 482 Back     alignment and structure
>pdb|2YWG|A Chain A, Crystal Structure Of Gtp-Bound Lepa From Aquifex Aeolicus Length = 600 Back     alignment and structure
>pdb|3CB4|D Chain D, The Crystal Structure Of Lepa Length = 599 Back     alignment and structure
>pdb|3DEG|C Chain C, Complex Of Elongating Escherichia Coli 70s Ribosome And Ef4(Lepa)- Gmppnp Length = 545 Back     alignment and structure
>pdb|2YWE|A Chain A, Crystal Structure Of Lepa From Aquifex Aeolicus Length = 600 Back     alignment and structure
>pdb|1ZUN|B Chain B, Crystal Structure Of A Gtp-Regulated Atp Sulfurylase Heterodimer From Pseudomonas Syringae Length = 434 Back     alignment and structure
>pdb|3VQT|A Chain A, Crystal Structure Analysis Of The Translation Factor Rf3 Length = 548 Back     alignment and structure
>pdb|3TR5|A Chain A, Structure Of A Peptide Chain Release Factor 3 (Prfc) From Coxiella Burnetii Length = 528 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query923
1g7s_A 594 Translation initiation factor IF2/EIF5B; translati 1e-74
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 2e-36
3izy_P 537 Translation initiation factor IF-2, mitochondrial; 3e-33
1zo1_I 501 IF2, translation initiation factor 2; E. coli, rib 3e-32
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 4e-11
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 5e-11
1n0u_A 842 EF-2, elongation factor 2; G-protein, CIS-proline, 8e-11
1g8x_A1010 Myosin II heavy chain fused to alpha-actinin 3; mo 9e-10
1g8x_A1010 Myosin II heavy chain fused to alpha-actinin 3; mo 2e-09
1g8x_A1010 Myosin II heavy chain fused to alpha-actinin 3; mo 7e-08
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 1e-09
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 2e-08
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 5e-07
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 7e-06
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 1e-05
1wb1_A 482 Translation elongation factor SELB; selenocysteine 3e-09
2zuo_A861 MVP, major vault protein; repeat domains, protein- 2e-07
2zuo_A861 MVP, major vault protein; repeat domains, protein- 4e-06
2zuo_A861 MVP, major vault protein; repeat domains, protein- 6e-05
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 4e-07
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 6e-06
2ycu_A995 Non muscle myosin 2C, alpha-actinin; motor protein 7e-07
2ycu_A995 Non muscle myosin 2C, alpha-actinin; motor protein 1e-06
1zun_B 434 Sulfate adenylate transferase, subunit 1/adenylyls 2e-06
2elf_A 370 Protein translation elongation factor 1A; tRNA, py 3e-06
3gdb_A 937 Endo-D, putative uncharacterized protein SPR0440; 6e-06
2qag_C418 Septin-7; cell cycle, cell division, GTP-binding, 2e-05
2qag_C418 Septin-7; cell cycle, cell division, GTP-binding, 8e-04
3tr5_A 528 RF-3, peptide chain release factor 3; protein synt 3e-05
2h5e_A 529 Peptide chain release factor RF-3; beta barrel, tr 3e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-05
2qag_B427 Septin-6, protein NEDD5; cell cycle, cell division 7e-05
2qag_B427 Septin-6, protein NEDD5; cell cycle, cell division 3e-04
2ywe_A 600 GTP-binding protein LEPA; G domain, beta-barrel, f 2e-04
2a6h_D 1524 DNA-directed RNA polymerase beta' chain; RNA polym 2e-04
2a6h_D 1524 DNA-directed RNA polymerase beta' chain; RNA polym 4e-04
2i1j_A575 Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, 2e-04
3cb4_D 599 GTP-binding protein LEPA; GTPase, OB-fold, membran 2e-04
1s0u_A 408 EIF-2-gamma, translation initiation factor 2 gamma 5e-04
1f5n_A592 Interferon-induced guanylate-binding protein 1; GB 8e-04
>1g7s_A Translation initiation factor IF2/EIF5B; translational GTPase; HET: GDP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: b.43.3.1 b.43.3.1 c.20.1.1 c.37.1.8 PDB: 1g7r_A* 1g7t_A* Length = 594 Back     alignment and structure
 Score =  255 bits (654), Expect = 1e-74
 Identities = 71/130 (54%), Positives = 88/130 (67%), Gaps = 2/130 (1%)

Query: 792 LRSPICCIMGHVDTGKTKLLDCIRGTNVQEGEAGGITQQIGATYFPAENIRERTREL--K 849
           +RSPI  ++GHVD GKT LLD IRG+ V   EAGGITQ IGAT  P + I     +   K
Sbjct: 3   IRSPIVSVLGHVDHGKTTLLDHIRGSAVASREAGGITQHIGATEIPMDVIEGICGDFLKK 62

Query: 850 ANATLKVPGLLVIDTPGHESFTNLRSRGSGLCDIAILVVDIMHGLEPQTIESLNLLKMRN 909
            +    +PGL  IDTPGHE+FT LR RG  L D+AIL+VDI  G +PQT E+LN+L+M  
Sbjct: 63  FSIRETLPGLFFIDTPGHEAFTTLRKRGGALADLAILIVDINEGFKPQTQEALNILRMYR 122

Query: 910 TEFIVALNKV 919
           T F+VA NK+
Sbjct: 123 TPFVVAANKI 132
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Length = 178 Back     alignment and structure
>3izy_P Translation initiation factor IF-2, mitochondrial; E coli, RNA, ribosomal; 10.80A {Bos taurus} Length = 537 Back     alignment and structure
>1zo1_I IF2, translation initiation factor 2; E. coli, ribosome, initiation of protein synthesis, cryo-eletron microscopy, translation/RNA complex; 13.80A {Escherichia coli} Length = 501 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>1n0u_A EF-2, elongation factor 2; G-protein, CIS-proline, translation; HET: SO1; 2.12A {Saccharomyces cerevisiae} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1n0v_C 1s1h_T 2e1r_A* 2npf_A* 2p8w_T* 3dny_T 3b82_A* 1zm2_A* 1zm3_A* 1zm4_A* 1zm9_A* 2p8x_T* 2p8y_T* 2p8z_T* 2zit_A* 1u2r_A* 3b78_A* 3b8h_A* Length = 842 Back     alignment and structure
>1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 Back     alignment and structure
>1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 Back     alignment and structure
>1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1wb1_A Translation elongation factor SELB; selenocysteine, protein synthesis, selenium, ribosome; HET: GDP DXC; 3.0A {Methanococcus maripaludis} SCOP: b.43.3.1 b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1wb2_A* 1wb3_A* Length = 482 Back     alignment and structure
>2zuo_A MVP, major vault protein; repeat domains, protein-protein complex, cytoplasm, ribonucleoprotein, structural protein; 3.50A {Rattus norvegicus} PDB: 2zv4_N 2zv5_a 2qzv_A Length = 861 Back     alignment and structure
>2zuo_A MVP, major vault protein; repeat domains, protein-protein complex, cytoplasm, ribonucleoprotein, structural protein; 3.50A {Rattus norvegicus} PDB: 2zv4_N 2zv5_a 2qzv_A Length = 861 Back     alignment and structure
>2zuo_A MVP, major vault protein; repeat domains, protein-protein complex, cytoplasm, ribonucleoprotein, structural protein; 3.50A {Rattus norvegicus} PDB: 2zv4_N 2zv5_a 2qzv_A Length = 861 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
>2ycu_A Non muscle myosin 2C, alpha-actinin; motor protein; HET: AOV; 2.25A {Homo sapiens} PDB: 1br1_A* 1br4_A* 1br2_A* Length = 995 Back     alignment and structure
>2ycu_A Non muscle myosin 2C, alpha-actinin; motor protein; HET: AOV; 2.25A {Homo sapiens} PDB: 1br1_A* 1br4_A* 1br2_A* Length = 995 Back     alignment and structure
>1zun_B Sulfate adenylate transferase, subunit 1/adenylylsulfate kinase; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae PV} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Length = 434 Back     alignment and structure
>2elf_A Protein translation elongation factor 1A; tRNA, pyrrolysine, structural genomics, NPPSFA; HET: CIT; 1.70A {Methanosarcina mazei} Length = 370 Back     alignment and structure
>3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Length = 418 Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Length = 418 Back     alignment and structure
>3tr5_A RF-3, peptide chain release factor 3; protein synthesis, translation; HET: GDP; 2.11A {Coxiella burnetii} Length = 528 Back     alignment and structure
>2h5e_A Peptide chain release factor RF-3; beta barrel, translation; HET: GDP; 2.80A {Escherichia coli} PDB: 2o0f_A 3sfs_W* 3zvo_Y* 3uoq_W* Length = 529 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Length = 427 Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Length = 427 Back     alignment and structure
>2ywe_A GTP-binding protein LEPA; G domain, beta-barrel, ferredoxin-like domain, structural GE NPPSFA; 2.05A {Aquifex aeolicus} PDB: 2ywf_A* 2ywg_A* 2ywh_A* Length = 600 Back     alignment and structure
>2a6h_D DNA-directed RNA polymerase beta' chain; RNA polymerase holoenzyme, streptolydigin, antibiotic, transcription regulation; HET: STD; 2.40A {Thermus thermophilus} SCOP: e.29.1.2 PDB: 1smy_D* 1zyr_D* 1iw7_D* 2a69_D* 2a6e_D 2a68_D* 2be5_D* 2cw0_D 2o5i_D 2o5j_D* 2ppb_D* 3aoh_D* 3aoi_D* 3dxj_D* 3eql_D* 1ynj_D* 1l9z_D 1l9u_D* 1ynn_D* 2auj_D Length = 1524 Back     alignment and structure
>2a6h_D DNA-directed RNA polymerase beta' chain; RNA polymerase holoenzyme, streptolydigin, antibiotic, transcription regulation; HET: STD; 2.40A {Thermus thermophilus} SCOP: e.29.1.2 PDB: 1smy_D* 1zyr_D* 1iw7_D* 2a69_D* 2a6e_D 2a68_D* 2be5_D* 2cw0_D 2o5i_D 2o5j_D* 2ppb_D* 3aoh_D* 3aoi_D* 3dxj_D* 3eql_D* 1ynj_D* 1l9z_D 1l9u_D* 1ynn_D* 2auj_D Length = 1524 Back     alignment and structure
>2i1j_A Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, ezrin, MER actin binding, masking, regulation, SELF-inhibition, cell A membrane protein; 2.10A {Spodoptera frugiperda} PDB: 2i1k_A 1e5w_A Length = 575 Back     alignment and structure
>3cb4_D GTP-binding protein LEPA; GTPase, OB-fold, membrane, nucleotide-binding, translation; 2.80A {Escherichia coli} PDB: 3deg_C* Length = 599 Back     alignment and structure
>1s0u_A EIF-2-gamma, translation initiation factor 2 gamma subunit; GTPase, EF-1A, tRNA; 2.40A {Methanocaldococcus jannaschii} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Length = 408 Back     alignment and structure
>1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Length = 592 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query923
1g7s_A 594 Translation initiation factor IF2/EIF5B; translati 99.77
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 99.75
1zo1_I 501 IF2, translation initiation factor 2; E. coli, rib 99.73
3izy_P 537 Translation initiation factor IF-2, mitochondrial; 99.69
4bas_A199 ADP-ribosylation factor, putative (small GTPase, p 99.68
1wb1_A 482 Translation elongation factor SELB; selenocysteine 99.67
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 99.67
3vqt_A 548 RF-3, peptide chain release factor 3; translation, 99.67
1wf3_A 301 GTP-binding protein; GTPase, riken structural geno 99.66
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 99.66
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 99.66
4fn5_A 709 EF-G 1, elongation factor G 1; translation, transl 99.65
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 99.65
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 99.65
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 99.65
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 99.65
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 99.65
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 99.65
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 99.65
3j2k_7 439 ERF3, eukaryotic polypeptide chain release factor 99.65
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 99.64
3t1o_A198 Gliding protein MGLA; G domain containing protein, 99.64
3j25_A 638 Tetracycline resistance protein TETM; antibiotic r 99.64
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 99.64
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 99.64
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 99.64
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 99.64
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 99.64
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 99.64
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 99.64
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 99.64
4dhe_A223 Probable GTP-binding protein ENGB; melioidosis, RA 99.63
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 99.63
2h57_A190 ADP-ribosylation factor-like protein 6; GTP, GTPas 99.63
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 99.63
3cph_A213 RAS-related protein SEC4; RAB GTPase, prenylation, 99.63
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 99.63
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 99.63
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 99.63
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 99.63
3iev_A 308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 99.63
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 99.63
2c78_A 405 Elongation factor TU-A; hydrolase, GTPase, transla 99.63
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 99.63
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 99.63
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 99.63
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 99.62
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 99.62
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 99.62
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 99.62
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 99.62
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 99.62
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 99.62
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 99.62
2wji_A165 Ferrous iron transport protein B homolog; membrane 99.62
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 99.62
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 99.62
1d2e_A 397 Elongation factor TU (EF-TU); G-protein, beta-barr 99.62
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 99.62
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 99.62
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 99.62
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 99.62
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 99.61
3llu_A196 RAS-related GTP-binding protein C; structural geno 99.61
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 99.61
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 99.61
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 99.61
2atx_A194 Small GTP binding protein TC10; GTPase, P-loop, al 99.61
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 99.61
1zun_B 434 Sulfate adenylate transferase, subunit 1/adenylyls 99.61
2q3h_A201 RAS homolog gene family, member U; GTPase, structu 99.61
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 99.61
4gzl_A204 RAS-related C3 botulinum toxin substrate 1; rossma 99.61
4dkx_A216 RAS-related protein RAB-6A; GTP binding fold, memb 99.61
3sjy_A 403 Translation initiation factor 2 subunit gamma; zin 99.6
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 99.6
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 99.6
3q3j_B214 RHO-related GTP-binding protein RHO6; RAS-binding 99.6
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 99.6
3izq_1 611 HBS1P, elongation factor 1 alpha-like protein; NO- 99.6
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 99.6
1s0u_A 408 EIF-2-gamma, translation initiation factor 2 gamma 99.6
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 99.6
2hup_A201 RAS-related protein RAB-43; G-protein, GDP, struct 99.6
2fu5_C183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 99.6
3i8s_A 274 Ferrous iron transport protein B; GTPase, GPCR, ir 99.6
1kk1_A 410 EIF2gamma; initiation of translation; HET: GNP; 1. 99.6
2gco_A201 H9, RHO-related GTP-binding protein RHOC; GTPase,s 99.6
2fv8_A207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 99.59
2qu8_A228 Putative nucleolar GTP-binding protein 1; GTPase, 99.59
3p26_A 483 Elongation factor 1 alpha-like protein; GTP/GDP bi 99.59
3k53_A 271 Ferrous iron transport protein B; GTPase fold, hel 99.59
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 99.59
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 99.59
2j0v_A212 RAC-like GTP-binding protein ARAC7; nucleotide-bin 99.59
3iby_A 256 Ferrous iron transport protein B; G protein, G dom 99.59
2fh5_B214 SR-beta, signal recognition particle receptor beta 99.59
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 99.59
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 99.59
2ywe_A 600 GTP-binding protein LEPA; G domain, beta-barrel, f 99.59
1r5b_A 467 Eukaryotic peptide chain release factor GTP-bindi 99.59
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 99.59
2f7s_A217 C25KG, RAS-related protein RAB-27B; G-protein, str 99.59
3tr5_A 528 RF-3, peptide chain release factor 3; protein synt 99.58
2yc2_C208 IFT27, small RAB-related GTPase; transport protein 99.58
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 99.58
1f60_A 458 Elongation factor EEF1A; protein-protein complex, 99.58
3cb4_D 599 GTP-binding protein LEPA; GTPase, OB-fold, membran 99.58
3gj0_A221 GTP-binding nuclear protein RAN; G protein, GDP, a 99.58
3cpj_B223 GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl 99.58
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 99.58
4djt_A218 GTP-binding nuclear protein GSP1; structural genom 99.58
2j1l_A214 RHO-related GTP-binding protein RHOD; GTPase, memb 99.58
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 99.57
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 99.57
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 99.57
3a1s_A 258 Iron(II) transport protein B; FEOB, iron transport 99.57
2h5e_A 529 Peptide chain release factor RF-3; beta barrel, tr 99.57
1gwn_A205 RHO-related GTP-binding protein RHOE; GTPase, inac 99.57
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 99.57
1ega_A 301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 99.57
2o52_A200 RAS-related protein RAB-4B; G-protein, GDP, struct 99.57
1nrj_B218 SR-beta, signal recognition particle receptor beta 99.56
2elf_A 370 Protein translation elongation factor 1A; tRNA, py 99.56
1jny_A 435 EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF- 99.56
2xtp_A 260 GTPase IMAP family member 2; immune system, G prot 99.56
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 99.56
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 99.56
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 99.56
2x77_A189 ADP-ribosylation factor; GTP-binding protein, smal 99.56
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 99.56
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 99.55
3mca_A 592 HBS1, elongation factor 1 alpha-like protein; prot 99.55
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 99.55
1jwy_B 315 Dynamin A GTPase domain; dynamin, GTPase, GDP, myo 99.55
2rdo_7 704 EF-G, elongation factor G; elongation factor G, EF 99.55
3lxw_A247 GTPase IMAP family member 1; immunity, structural 99.54
3l0i_B199 RAS-related protein RAB-1A; GEF-GDF-RAB complex, G 99.54
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 99.54
3b1v_A 272 Ferrous iron uptake transporter protein B; G prote 99.53
1dar_A 691 EF-G, elongation factor G; ribosomal translocase, 99.53
2hjg_A 436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 99.53
3lxx_A239 GTPase IMAP family member 4; structural genomics c 99.53
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 99.53
1mky_A 439 Probable GTP-binding protein ENGA; GTPase, DER, KH 99.53
2hjg_A 436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 99.53
2ged_A193 SR-beta, signal recognition particle receptor beta 99.52
4dcu_A 456 GTP-binding protein ENGA; GTPase, GDP, protein bin 99.52
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 99.5
3th5_A204 RAS-related C3 botulinum toxin substrate 1; rossma 99.25
2xex_A 693 Elongation factor G; GTPase, translation, biosynth 99.5
3avx_A 1289 Elongation factor TS, elongation factor TU, linke 99.5
3def_A262 T7I23.11 protein; chloroplast, TOC33, GTPase, hydr 99.49
1n0u_A 842 EF-2, elongation factor 2; G-protein, CIS-proline, 99.49
4dcu_A 456 GTP-binding protein ENGA; GTPase, GDP, protein bin 99.48
2aka_B299 Dynamin-1; fusion protein, GTPase domain, myosin, 99.48
3r7w_A 307 Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT 99.48
2wkq_A332 NPH1-1, RAS-related C3 botulinum toxin substrate 1 99.47
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 99.46
2dy1_A 665 Elongation factor G; translocation, GTP complex, s 99.46
3t5d_A 274 Septin-7; GTP-binding protein, cytoskeleton, signa 99.45
1h65_A 270 Chloroplast outer envelope protein OEP34; GTPase, 99.45
3o47_A329 ADP-ribosylation factor GTPase-activating protein 99.44
3qq5_A 423 Small GTP-binding protein; hydrogenase, H-cluster, 99.44
3gee_A 476 MNME, tRNA modification GTPase MNME; G protein, cy 99.44
2qpt_A 550 EH domain-containing protein-2; protein-nucleotide 99.43
3t34_A 360 Dynamin-related protein 1A, linker, dynamin-relat 99.41
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 99.41
3geh_A 462 MNME, tRNA modification GTPase MNME; G protein, U3 99.4
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.4
1xzp_A 482 Probable tRNA modification GTPase TRME; GTP-bindin 99.4
2g3y_A211 GTP-binding protein GEM; small GTPase, GDP, inacti 99.39
2j69_A 695 Bacterial dynamin-like protein; FZO, FZL, GTPase, 99.39
3r7w_B 331 Gtpase2, GTP-binding protein GTR2; RAG gtpases, GT 99.37
3dpu_A 535 RAB family protein; roccor, G-domain, COR, GTP-bin 99.37
1mky_A 439 Probable GTP-binding protein ENGA; GTPase, DER, KH 99.36
2cjw_A192 GTP-binding protein GEM; nucleotide-binding, small 99.35
3c5h_A255 Glucocorticoid receptor DNA-binding factor 1; RAS, 99.35
2e87_A357 Hypothetical protein PH1320; GTP-binding, GTPase, 99.34
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 99.32
2x2e_A 353 Dynamin-1; nitration, hydrolase, membrane fission, 99.31
1lnz_A342 SPO0B-associated GTP-binding protein; GTPase, OBG, 99.31
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 99.31
2qtf_A364 Protein HFLX, GTP-binding protein; beta-alpha-barr 99.28
2qag_A 361 Septin-2, protein NEDD5; cell cycle, cell division 99.24
1wxq_A 397 GTP-binding protein; structural genomics, riken st 99.21
3zvr_A 772 Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mito 99.16
2qag_C 418 Septin-7; cell cycle, cell division, GTP-binding, 99.1
4a9a_A 376 Ribosome-interacting GTPase 1; DRG-DFRP complex, r 99.05
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 99.05
1yrb_A262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 98.99
1jal_A 363 YCHF protein; nucleotide-binding fold, structural 98.98
3p32_A 355 Probable GTPase RV1496/MT1543; structural genomics 98.94
2www_A 349 Methylmalonic aciduria type A protein, mitochondri 98.92
1udx_A 416 The GTP-binding protein OBG; TGS domain, riken str 98.9
2p67_A 341 LAO/AO transport system kinase; ARGK, structural G 98.89
2dby_A 368 GTP-binding protein; GDP, structural genomics, NPP 98.86
2qnr_A 301 Septin-2, protein NEDD5; structural genomics conso 98.84
1cip_A353 Protein (guanine nucleotide-binding protein alpha- 98.77
3sop_A 270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 98.77
4fid_A340 G protein alpha subunit; RAS-like domain, all-heli 98.76
2j37_W 504 Signal recognition particle 54 kDa protein (SRP54) 98.73
2qag_B 427 Septin-6, protein NEDD5; cell cycle, cell division 98.72
3ec1_A369 YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase 98.72
2ohf_A 396 Protein OLA1, GTP-binding protein 9; ATPase, GTPas 98.65
3h2y_A368 GTPase family protein; GTP-binding protein YQEH, p 98.63
3ohm_A327 Guanine nucleotide-binding protein G(Q) subunit A; 98.61
2hf9_A226 Probable hydrogenase nickel incorporation protein 98.54
2qm8_A 337 GTPase/ATPase; G protein, G3E, metallochaperone, c 98.5
1ni3_A 392 YCHF GTPase, YCHF GTP-binding protein; structural 98.34
3dm5_A 443 SRP54, signal recognition 54 kDa protein; protein- 98.34
2v3c_C 432 SRP54, signal recognition 54 kDa protein; nucleoti 98.34
1tq4_A 413 IIGP1, interferon-inducible GTPase; interferon gam 98.32
3szr_A 608 Interferon-induced GTP-binding protein MX1; interf 98.24
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 98.2
1zcb_A362 G alpha I/13; GTP-binding, lipoprotein, membrane, 98.15
3kl4_A 433 SRP54, signal recognition 54 kDa protein; signal r 98.14
2xxa_A 433 Signal recognition particle protein; protein trans 98.08
1f5n_A 592 Interferon-induced guanylate-binding protein 1; GB 98.04
1azs_C 402 GS-alpha; complex (lyase/hydrolase), hydrolase, si 98.02
2xtz_A354 Guanine nucleotide-binding protein alpha-1 subuni; 97.97
1u0l_A 301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 97.88
1puj_A282 YLQF, conserved hypothetical protein YLQF; structu 97.84
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 97.84
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 97.78
1vma_A306 Cell division protein FTSY; TM0570, structural gen 97.71
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 97.7
4dzz_A206 Plasmid partitioning protein PARF; deviant walker 97.64
2ffh_A 425 Protein (FFH); SRP54, signal recognition particle, 97.63
3cnl_A262 YLQF, putative uncharacterized protein; circular p 97.62
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 97.57
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 97.52
2ph1_A262 Nucleotide-binding protein; alpha-beta protein, st 97.44
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 97.35
3l82_B227 F-box only protein 4; TRFH domain, helix, GTPase d 97.3
3q5d_A 447 Atlastin-1; G protein, GTPase, GDP/GTP binding, hy 97.3
3kjh_A254 CO dehydrogenase/acetyl-COA synthase complex, acce 97.1
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 97.06
2og2_A359 Putative signal recognition particle receptor; nuc 97.0
2yv5_A 302 YJEQ protein; hydrolase, GTPase, permutation, stru 96.97
3cwq_A209 Para family chromosome partitioning protein; alpha 96.96
3la6_A286 Tyrosine-protein kinase WZC; P-loop protein, nucle 96.95
3cio_A299 ETK, tyrosine-protein kinase ETK; WZC, escherichia 96.95
3end_A307 Light-independent protochlorophyllide reductase ir 96.94
3bfv_A271 CAPA1, CAPB2, membrane protein CAPA1, protein tyro 96.87
1nij_A 318 Hypothetical protein YJIA; structural genomics, P- 96.86
1puj_A 282 YLQF, conserved hypothetical protein YLQF; structu 96.84
3k9g_A267 PF-32 protein; ssgcid, SBRI, decode biostructures, 96.66
3q9l_A260 Septum site-determining protein MIND; ATPase, bact 96.66
2oze_A298 ORF delta'; para, walker type atpases, DNA segrega 96.59
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 96.58
1wcv_1257 SOJ, segregation protein; ATPase, bacterial, chrom 96.54
1hyq_A263 MIND, cell division inhibitor (MIND-1); MINC, FTSZ 96.45
3l2o_B312 F-box only protein 4; small G protein fold, UBL co 96.45
1g3q_A237 MIND ATPase, cell division inhibitor; alpha-beta-a 96.44
3ea0_A245 ATPase, para family; alpha-beta-alpha sandwich, st 96.39
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 96.32
3ec1_A 369 YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase 96.24
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 96.2
2cvh_A220 DNA repair and recombination protein RADB; filamen 96.15
3h2y_A 368 GTPase family protein; GTP-binding protein YQEH, p 96.12
3cnl_A 262 YLQF, putative uncharacterized protein; circular p 96.02
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 96.02
1bif_A 469 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; 96.01
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 95.92
4ido_A 457 Atlastin-1; GTPase, GTP/GDP binding, hydrolase; HE 95.89
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 95.85
4a74_A231 DNA repair and recombination protein RADA; hydrola 95.75
1t9h_A307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 95.72
2kjq_A149 DNAA-related protein; solution structure, NESG, st 95.68
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 95.62
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 95.61
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 95.56
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 95.53
1cp2_A269 CP2, nitrogenase iron protein; oxidoreductase; 1.9 95.46
4a1f_A 338 DNAB helicase, replicative DNA helicase; hydrolase 95.4
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 95.34
2chg_A226 Replication factor C small subunit; DNA-binding pr 95.31
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 95.3
2afh_E289 Nitrogenase iron protein 1; nitrogen fixation, iro 95.29
1xp8_A 366 RECA protein, recombinase A; recombination, radior 95.28
2zr9_A 349 Protein RECA, recombinase A; recombination, RECA m 95.23
3hr8_A 356 Protein RECA; alpha and beta proteins (A/B, A+B), 95.14
1sxj_E 354 Activator 1 40 kDa subunit; clamp loader, processi 95.1
3bh0_A 315 DNAB-like replicative helicase; ATPase, replicatio 95.09
3zvl_A416 Bifunctional polynucleotide phosphatase/kinase; hy 95.05
1cr0_A 296 DNA primase/helicase; RECA-type protein fold, tran 95.05
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 95.03
3bos_A242 Putative DNA replication factor; P-loop containing 94.99
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 94.94
3pfi_A 338 Holliday junction ATP-dependent DNA helicase RUVB; 94.91
1sxj_A 516 Activator 1 95 kDa subunit; clamp loader, processi 94.62
1u94_A 356 RECA protein, recombinase A; homologous recombinat 94.58
1fnn_A 389 CDC6P, cell division control protein 6; ORC1, AAA 94.56
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 94.54
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 94.5
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 94.46
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 94.44
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 94.39
1q57_A 503 DNA primase/helicase; dntpase, DNA replication, tr 94.3
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 94.25
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 94.23
3jvv_A 356 Twitching mobility protein; hexameric P-loop ATPas 94.18
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 94.14
3a4m_A 260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 94.14
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 94.09
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 94.07
3te6_A 318 Regulatory protein SIR3; heterochromatin, gene sil 94.0
2v1u_A 387 Cell division control protein 6 homolog; DNA repli 94.0
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 93.96
2z43_A324 DNA repair and recombination protein RADA; archaea 93.95
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 93.9
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 93.82
1jr3_A 373 DNA polymerase III subunit gamma; processivity, pr 93.77
3e2i_A219 Thymidine kinase; Zn-binding, ATP-binding, DNA syn 93.72
1hqc_A 324 RUVB; extended AAA-ATPase domain, complex with nuc 93.7
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 93.68
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 93.66
3bgw_A 444 DNAB-like replicative helicase; ATPase, replicatio 93.6
1c9k_A180 COBU, adenosylcobinamide kinase; alpha/beta struct 93.59
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 93.57
3io5_A 333 Recombination and repair protein; storage dimer, i 93.56
4fcw_A 311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 93.55
2q6t_A 444 DNAB replication FORK helicase; hydrolase; 2.90A { 93.53
2r6a_A 454 DNAB helicase, replicative helicase; replication, 93.52
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 93.46
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 93.36
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 93.34
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 93.29
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 93.29
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 93.27
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 93.22
1t9h_A 307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 93.17
2i1q_A322 DNA repair and recombination protein RADA; ATPase, 93.13
3pxg_A 468 Negative regulator of genetic competence CLPC/MEC; 93.13
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 93.12
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 93.07
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 93.01
1kag_A173 SKI, shikimate kinase I; transferase, structural g 93.0
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 92.96
3of5_A228 Dethiobiotin synthetase; structural genomics, cent 92.96
1w4r_A195 Thymidine kinase; type II, human, cytosolic, phosp 92.9
1b0u_A 262 Histidine permease; ABC transporter, transport pro 92.9
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 92.89
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 92.88
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 92.87
2j9r_A214 Thymidine kinase; TK1, DNK, lasso, transferase, AT 92.86
1g6h_A257 High-affinity branched-chain amino acid transport 92.82
3syl_A 309 Protein CBBX; photosynthesis, rubisco activase, AA 92.76
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 92.75
3ug7_A349 Arsenical pump-driving ATPase; tail-anchored, memb 92.72
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 92.72
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 92.72
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 92.72
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 92.66
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 92.66
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 92.64
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 92.63
1tf7_A 525 KAIC; homohexamer, hexamer, circadian clock protei 92.6
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 92.56
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 92.55
1ji0_A240 ABC transporter; ATP binding protein, structural g 92.54
3gfo_A 275 Cobalt import ATP-binding protein CBIO 1; structur 92.52
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 92.49
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 92.43
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 92.38
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 92.36
2eyu_A 261 Twitching motility protein PILT; pilus retraction 92.32
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 92.31
2ghi_A260 Transport protein; multidrug resistance protein, M 92.31
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 92.3
2qby_A 386 CDC6 homolog 1, cell division control protein 6 ho 92.27
1sgw_A214 Putative ABC transporter; structural genomics, P p 92.27
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 92.27
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 92.25
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 92.24
3fkq_A373 NTRC-like two-domain protein; RER070207001320, str 92.23
3zq6_A324 Putative arsenical pump-driving ATPase; tail-ancho 92.22
1sxj_D 353 Activator 1 41 kDa subunit; clamp loader, processi 92.21
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 92.19
2ihy_A 279 ABC transporter, ATP-binding protein; ATPase, ABC 92.19
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 92.16
3u61_B 324 DNA polymerase accessory protein 44; AAA+, ATP hyd 92.15
2vhj_A331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 92.09
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 92.07
3h4m_A 285 Proteasome-activating nucleotidase; ATPase, PAN, A 92.04
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 91.98
2yz2_A 266 Putative ABC transporter ATP-binding protein TM_0; 91.98
1iqp_A 327 RFCS; clamp loader, extended AAA-ATPase domain, co 91.92
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 91.9
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 91.88
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 91.82
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 91.81
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 91.78
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 91.76
3vfd_A 389 Spastin; ATPase, microtubule severing, hydrolase; 91.69
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 91.64
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 91.54
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 91.51
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 91.48
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 91.47
3pvs_A 447 Replication-associated recombination protein A; ma 91.45
2zts_A251 Putative uncharacterized protein PH0186; KAIC like 91.43
2bjv_A 265 PSP operon transcriptional activator; AAA, transcr 91.35
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 91.31
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 91.3
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 91.29
1tf7_A 525 KAIC; homohexamer, hexamer, circadian clock protei 91.28
2pjz_A 263 Hypothetical protein ST1066; ATP binding protein, 91.24
1sxj_C 340 Activator 1 40 kDa subunit; clamp loader, processi 91.23
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 91.23
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 91.22
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 91.17
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 91.17
3fvq_A 359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 91.16
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 91.13
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 91.1
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 91.1
3fwy_A314 Light-independent protochlorophyllide reductase I 91.05
1z47_A 355 CYSA, putative ABC-transporter ATP-binding protein 90.96
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 90.95
2it1_A 362 362AA long hypothetical maltose/maltodextrin trans 90.9
2yyz_A 359 Sugar ABC transporter, ATP-binding protein; sugar 90.89
1g29_1 372 MALK, maltose transport protein MALK; ATPase, acti 90.83
3vaa_A199 Shikimate kinase, SK; structural genomics, center 90.83
2qp9_X 355 Vacuolar protein sorting-associated protein 4; ATP 90.81
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 90.8
2vli_A183 Antibiotic resistance protein; transferase, tunica 90.79
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 90.79
3kta_A182 Chromosome segregation protein SMC; structural mai 90.74
1sxj_B 323 Activator 1 37 kDa subunit; clamp loader, processi 90.72
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 90.71
1v43_A 372 Sugar-binding transport ATP-binding protein; ATPas 90.7
3rlf_A 381 Maltose/maltodextrin import ATP-binding protein M; 90.67
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 90.66
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 90.61
2r8r_A228 Sensor protein; KDPD, PFAM02702, MCSG, structural 90.53
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 90.49
3tui_C 366 Methionine import ATP-binding protein METN; ABC-tr 90.47
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 90.43
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 90.43
3qxc_A242 Dethiobiotin synthetase; DTBS, structural genomics 90.4
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 90.4
1a5t_A 334 Delta prime, HOLB; zinc finger, DNA replication; 2 90.38
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 90.37
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 90.37
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 90.32
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 90.28
2chq_A 319 Replication factor C small subunit; DNA-binding pr 90.25
3upu_A 459 ATP-dependent DNA helicase DDA; RECA-like domain, 90.25
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 90.25
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 90.2
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 90.18
3d31_A 348 Sulfate/molybdate ABC transporter, ATP-binding pro 90.17
1ihu_A 589 Arsenical pump-driving ATPase; aluminum fluoride, 90.17
3e1s_A 574 Exodeoxyribonuclease V, subunit RECD; alpha and be 90.16
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 90.09
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 90.06
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 90.01
3pxi_A 758 Negative regulator of genetic competence CLPC/MEC; 90.01
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 90.0
3gd7_A 390 Fusion complex of cystic fibrosis transmembrane co 89.98
3co5_A143 Putative two-component system transcriptional RES 89.84
1ojl_A 304 Transcriptional regulatory protein ZRAR; response 89.81
2ewv_A 372 Twitching motility protein PILT; pilus retraction 89.77
1xjc_A169 MOBB protein homolog; structural genomics, midwest 89.7
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 89.69
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 89.66
1lw7_A365 Transcriptional regulator NADR; NMN, NMN adenylyl 89.64
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 89.63
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 89.61
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 89.59
3fgn_A251 Dethiobiotin synthetase; biotin biosynthesis, BIOD 89.59
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 89.57
1oxx_K 353 GLCV, glucose, ABC transporter, ATP binding protei 89.56
2zan_A 444 Vacuolar protein sorting-associating protein 4B; S 89.54
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 89.53
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 89.41
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 89.37
1p9r_A 418 General secretion pathway protein E; bacterial typ 89.35
1xwi_A 322 SKD1 protein; VPS4B, AAA ATPase, protein transport 89.32
1odf_A 290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 89.28
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 89.27
1byi_A224 Dethiobiotin synthase; biotin synthesis, cyclo-lig 89.26
2vp4_A230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 89.06
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 89.06
2x8a_A 274 Nuclear valosin-containing protein-like; nuclear p 89.04
2oap_1 511 GSPE-2, type II secretion system protein; hexameri 89.01
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 88.96
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 88.9
1via_A175 Shikimate kinase; structural genomics, transferase 88.8
2xj4_A 286 MIPZ; replication, cell division, ATPase, WACA; 1. 88.74
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 88.74
1r6b_X 758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 88.46
2npi_A 460 Protein CLP1; CLP1-PCF11 complex, ATP binding, ter 88.45
3tlx_A243 Adenylate kinase 2; structural genomics, structura 88.41
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 88.4
2woo_A329 ATPase GET3; tail-anchored, membrane protein, targ 88.32
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 88.29
1gvn_B 287 Zeta; postsegregational killing system, plasmid; 1 88.26
>1g7s_A Translation initiation factor IF2/EIF5B; translational GTPase; HET: GDP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: b.43.3.1 b.43.3.1 c.20.1.1 c.37.1.8 PDB: 1g7r_A* 1g7t_A* Back     alignment and structure
Probab=99.77  E-value=4.4e-19  Score=207.15  Aligned_cols=132  Identities=53%  Similarity=0.841  Sum_probs=106.4

Q ss_pred             cCCCCEEEEEcCCCCCHHHHHHHHHcCccccCCCCcceeecceeeecccccccceeeecc--ccccCCCCEEEEeCCCCc
Q 002428          791 NLRSPICCIMGHVDTGKTKLLDCIRGTNVQEGEAGGITQQIGATYFPAENIRERTRELKA--NATLKVPGLLVIDTPGHE  868 (923)
Q Consensus       791 nlRnp~I~VLG~~GSGKSTLLN~LlgtnVq~geagGIT~qIgat~~p~e~i~ekt~~I~~--~~~~k~~~L~IIDTPGhE  868 (923)
                      ++|.++|+||||+++|||||+++|++..+.....+++|++++..+++..........+..  ...+..+.|+|||||||.
T Consensus         2 ~~r~~~V~IvGh~d~GKTTLl~~L~~~~v~~~e~ggiT~~ig~~~~~~~~~~~~~~~~~~~~~v~~~~~~i~liDTPGhe   81 (594)
T 1g7s_A            2 KIRSPIVSVLGHVDHGKTTLLDHIRGSAVASREAGGITQHIGATEIPMDVIEGICGDFLKKFSIRETLPGLFFIDTPGHE   81 (594)
T ss_dssp             EECCCEEEEECSTTSSHHHHHHHHHHHHHSCC----CCCBTTEEEEEHHHHHHHSCGGGGGCGGGGTCCEEEEECCCTTS
T ss_pred             CCCCcEEEEECCCCCcHHHHHHHHhcccCccccCCceecccCeEEEeechhhhhccccccccccccccCCEEEEECCCcH
Confidence            468899999999999999999999988877777778999999888765432111111100  122344579999999999


Q ss_pred             chhhHHHhhccCCCEEEEEEeCCCCCCHhHHHHHHHHHhcCCcEEEEEeCCCcC
Q 002428          869 SFTNLRSRGSGLCDIAILVVDIMHGLEPQTIESLNLLKMRNTEFIVALNKVRFS  922 (923)
Q Consensus       869 sf~nlrs~~ls~aDiVILVVDas~gle~qtiEsL~lLkk~~iP~IVVLNKIDLL  922 (923)
                      .|..++.++++.||++|||||+++++.++++++|.++...++|+|||+||||+.
T Consensus        82 ~F~~~~~r~~~~aD~aILVvDa~~Gv~~qT~e~l~~l~~~~vPiIVViNKiDl~  135 (594)
T 1g7s_A           82 AFTTLRKRGGALADLAILIVDINEGFKPQTQEALNILRMYRTPFVVAANKIDRI  135 (594)
T ss_dssp             CCTTSBCSSSBSCSEEEEEEETTTCCCHHHHHHHHHHHHTTCCEEEEEECGGGS
T ss_pred             HHHHHHHHHHhhCCEEEEEEECCCCccHhHHHHHHHHHHcCCeEEEEecccccc
Confidence            999999999999999999999999999999999999999999999999999985
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>1zo1_I IF2, translation initiation factor 2; E. coli, ribosome, initiation of protein synthesis, cryo-eletron microscopy, translation/RNA complex; 13.80A {Escherichia coli} Back     alignment and structure
>3izy_P Translation initiation factor IF-2, mitochondrial; E coli, RNA, ribosomal; 10.80A {Bos taurus} Back     alignment and structure
>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} Back     alignment and structure
>1wb1_A Translation elongation factor SELB; selenocysteine, protein synthesis, selenium, ribosome; HET: GDP DXC; 3.0A {Methanococcus maripaludis} SCOP: b.43.3.1 b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1wb2_A* 1wb3_A* Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>3vqt_A RF-3, peptide chain release factor 3; translation, GTPase; HET: GDP; 1.80A {Desulfovibrio vulgaris} PDB: 3vr1_A* Back     alignment and structure
>1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>4fn5_A EF-G 1, elongation factor G 1; translation, translation-antibiotic compl; HET: 0UO; 2.90A {Pseudomonas aeruginosa} Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>3j2k_7 ERF3, eukaryotic polypeptide chain release factor 3; rabbit 80S ribosome, ribosome-translation complex; 17.00A {Oryctolagus cuniculus} Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>3j25_A Tetracycline resistance protein TETM; antibiotic resistance, translation; HET: GCP; 7.20A {Enterococcus faecalis} Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Back     alignment and structure
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>2c78_A Elongation factor TU-A; hydrolase, GTPase, translation elongation factor, protein synthesis, antibiotic, GTP-binding, nucleotide-binding; HET: GNP PUL; 1.4A {Thermus thermophilus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 2y0u_Z* 2y0w_Z* 2y0y_Z* 2y10_Z* 2y12_Z* 2y14_Z* 2y16_Z* 2y18_Z* 2wrn_Z* 2wrq_Z* 2c77_A* 1aip_A 1exm_A* 1ha3_A* 2xqd_Z* 3fic_Z* 4abr_Z* 1b23_P* 1ob5_A* 1ttt_A* ... Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>1d2e_A Elongation factor TU (EF-TU); G-protein, beta-barrel, RNA binding protein; HET: GDP; 1.94A {Bos taurus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1xb2_A* 2hcj_A* 2hdn_A* Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1zun_B Sulfate adenylate transferase, subunit 1/adenylylsulfate kinase; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae PV} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* Back     alignment and structure
>4dkx_A RAS-related protein RAB-6A; GTP binding fold, membrane trafficking, GTP, cytosol, protei transport; HET: GDP; 1.90A {Homo sapiens} PDB: 3bbp_A* Back     alignment and structure
>3sjy_A Translation initiation factor 2 subunit gamma; zinc finger, initiate translation, tRNA binding, mRNA bindin binding; HET: GCP GDP; 2.00A {Sulfolobus solfataricus P2} PDB: 3pen_A* 3sjz_A* 2qn6_A* 2aho_A 2qmu_A* 2plf_A* 3v11_A* 3i1f_A* 3cw2_A 2pmd_A* 3p3m_A* 3qsy_A* Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>1s0u_A EIF-2-gamma, translation initiation factor 2 gamma subunit; GTPase, EF-1A, tRNA; 2.40A {Methanocaldococcus jannaschii} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Back     alignment and structure
>3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* Back     alignment and structure
>1kk1_A EIF2gamma; initiation of translation; HET: GNP; 1.80A {Pyrococcus abyssi} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1kjz_A* 1kk2_A* 1kk3_A* 1kk0_A* 2d74_A 2dcu_A* Back     alignment and structure
>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Back     alignment and structure
>3p26_A Elongation factor 1 alpha-like protein; GTP/GDP binding domain, beta-barrel, translational GTPase, D structural genomics; 2.50A {Saccharomyces cerevisiae} PDB: 3p27_A* Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Back     alignment and structure
>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>2ywe_A GTP-binding protein LEPA; G domain, beta-barrel, ferredoxin-like domain, structural GE NPPSFA; 2.05A {Aquifex aeolicus} PDB: 2ywf_A* 2ywg_A* 2ywh_A* Back     alignment and structure
>1r5b_A Eukaryotic peptide chain release factor GTP-bindi subunit; translation termination, peptide release, GTPase, translatio; 2.35A {Schizosaccharomyces pombe} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1r5n_A* 1r5o_A* 3e20_A Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Back     alignment and structure
>3tr5_A RF-3, peptide chain release factor 3; protein synthesis, translation; HET: GDP; 2.11A {Coxiella burnetii} Back     alignment and structure
>2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>1f60_A Elongation factor EEF1A; protein-protein complex, translation; 1.67A {Saccharomyces cerevisiae} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1g7c_A* 1ije_A* 1ijf_A* 2b7b_A* 2b7c_A Back     alignment and structure
>3cb4_D GTP-binding protein LEPA; GTPase, OB-fold, membrane, nucleotide-binding, translation; 2.80A {Escherichia coli} PDB: 3deg_C* Back     alignment and structure
>3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} SCOP: c.37.1.8 PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 4gmx_A* 4gpt_A* 4hat_A* 4hau_A* 4hav_A* 4haw_A* ... Back     alignment and structure
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A Back     alignment and structure
>2h5e_A Peptide chain release factor RF-3; beta barrel, translation; HET: GDP; 2.80A {Escherichia coli} PDB: 2o0f_A 3sfs_W* 3zvo_Y* 3uoq_W* Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2elf_A Protein translation elongation factor 1A; tRNA, pyrrolysine, structural genomics, NPPSFA; HET: CIT; 1.70A {Methanosarcina mazei} Back     alignment and structure
>1jny_A EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF-1; GTPase, alpha/beta structure, protein biosynthesis, translation; HET: GDP; 1.80A {Sulfolobus solfataricus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1skq_A* 3agj_A* Back     alignment and structure
>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3mca_A HBS1, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe} Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B* Back     alignment and structure
>2rdo_7 EF-G, elongation factor G; elongation factor G, EF-G, RRF, GDPNP, 50S subunit, cryo-EM, REAL-space refinement, ribonucleoprotein; 9.10A {Escherichia coli} PDB: 3j0e_H Back     alignment and structure
>3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Back     alignment and structure
>3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* Back     alignment and structure
>1dar_A EF-G, elongation factor G; ribosomal translocase, translational GTPase; HET: GDP; 2.40A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 PDB: 1elo_A 1ktv_A 2om7_L* 2wri_Y* 2wrk_Y* 2xsy_Y* 2xuy_Y* 2j7k_A* 2efg_A* 1jqm_B 1efg_A* 1fnm_A* 1pn6_A 2bm1_A* 2bm0_A* 2bv3_A* 3izp_E 1zn0_B 1jqs_C 2bcw_C ... Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Back     alignment and structure
>3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>2xex_A Elongation factor G; GTPase, translation, biosynthetic protein; 1.90A {Staphylococcus aureus} Back     alignment and structure
>3avx_A Elongation factor TS, elongation factor TU, linke replicase; RNA polymerase, translation, transferase-RNA complex; HET: GH3; 2.41A {Escherichia coli O157} PDB: 3agq_A 3agp_A* 3avu_A 3avv_A 3avt_A* 3avw_A* 3avy_A* 3mmp_A* 3mmp_G* 1efu_B Back     alignment and structure
>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* Back     alignment and structure
>1n0u_A EF-2, elongation factor 2; G-protein, CIS-proline, translation; HET: SO1; 2.12A {Saccharomyces cerevisiae} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1n0v_C 1s1h_T 2e1r_A* 2npf_A* 2p8w_T* 3dny_T 3b82_A* 1zm2_A* 1zm3_A* 1zm4_A* 1zm9_A* 2p8x_T* 2p8y_T* 2p8z_T* 2zit_A* 1u2r_A* 3b78_A* 3b8h_A* Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* Back     alignment and structure
>3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_A* Back     alignment and structure
>2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* Back     alignment and structure
>3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A* Back     alignment and structure
>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* Back     alignment and structure
>3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} Back     alignment and structure
>3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana} Back     alignment and structure
>3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Back     alignment and structure
>3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} Back     alignment and structure
>1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B* Back     alignment and structure
>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A 2w6d_A* Back     alignment and structure
>3r7w_B Gtpase2, GTP-binding protein GTR2; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_B* Back     alignment and structure
>3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Back     alignment and structure
>3c5h_A Glucocorticoid receptor DNA-binding factor 1; RAS, GTPase, glucorticoid receptor, structural genomics consortium, SGC, alternative splicing; HET: GNP; 1.80A {Homo sapiens} Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>2x2e_A Dynamin-1; nitration, hydrolase, membrane fission, nucleotide-binding, endocytosis, motor protein; HET: GDP; 2.00A {Homo sapiens} PDB: 2x2f_A* 3zyc_A* 3zys_A Back     alignment and structure
>1lnz_A SPO0B-associated GTP-binding protein; GTPase, OBG, stringent factor, stress response, sporulation, large G-protein, structural genomics, PSI; HET: G4P; 2.60A {Bacillus subtilis} SCOP: b.117.1.1 c.37.1.8 Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Back     alignment and structure
>2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>1wxq_A GTP-binding protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.60A {Pyrococcus horikoshii} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>3zvr_A Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mitochondrial fission, GT stalk, PH, BSE, membrane fission; HET: 1PE; 3.10A {Rattus norvegicus} PDB: 3snh_A Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>4a9a_A Ribosome-interacting GTPase 1; DRG-DFRP complex, ribosome binding GTPase; 2.67A {Saccharomyces cerevisiae} Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>1jal_A YCHF protein; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; 2.40A {Haemophilus influenzae} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>2dby_A GTP-binding protein; GDP, structural genomics, NPPSFA, natio project on protein structural and functional analyses; HET: GDP; 1.76A {Thermus thermophilus} PDB: 2dwq_A Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>1cip_A Protein (guanine nucleotide-binding protein alpha-1 subunit); GTPase, hydrolase; HET: GNP; 1.50A {Rattus norvegicus} SCOP: a.66.1.1 c.37.1.8 PDB: 1agr_A* 1bof_A* 1gdd_A* 1gfi_A* 1gia_A* 1gp2_A* 3ffa_A* 3ffb_A* 1gg2_A* 1git_A* 1svs_A* 1svk_A* 2zjz_A* 2zjy_A* 3ums_A* 2pz2_A* 2pz3_A* 1as0_A* 1as2_A* 1as3_A* ... Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>4fid_A G protein alpha subunit; RAS-like domain, all-helical domain, GTP binding, nucleotide signaling protein, transducer, lipoprotein; HET: MLY MSE GDP; 2.62A {Entamoeba histolytica} Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} Back     alignment and structure
>2ohf_A Protein OLA1, GTP-binding protein 9; ATPase, GTPase, P-loop, OBG-like, hydrolase; HET: ACP; 2.70A {Homo sapiens} Back     alignment and structure
>3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} Back     alignment and structure
>3ohm_A Guanine nucleotide-binding protein G(Q) subunit A; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Mus musculus} PDB: 2bcj_Q* 2rgn_A* 3ah8_A* Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>1zcb_A G alpha I/13; GTP-binding, lipoprotein, membrane, transducer, signaling PR; HET: GDP; 2.00A {Mus musculus} SCOP: a.66.1.1 c.37.1.8 PDB: 3ab3_A* 3cx8_A* 3cx7_A* 3cx6_A* 1zca_A* Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Back     alignment and structure
>1azs_C GS-alpha; complex (lyase/hydrolase), hydrolase, signal transducing protein, cyclase, effector enzyme; HET: GSP FKP; 2.30A {Bos taurus} SCOP: a.66.1.1 c.37.1.8 PDB: 1azt_A* 3c14_C* 3c15_C* 3c16_C* 1cjt_C* 1cjk_C* 1cju_C* 1cjv_C* 1tl7_C* 1cs4_C* 1u0h_C* 2gvd_C* 2gvz_C* 3e8a_C* 3g82_C* 3maa_C* 1cul_C* 3sn6_A* Back     alignment and structure
>2xtz_A Guanine nucleotide-binding protein alpha-1 subuni; hydrolase, G-protein signaling, SELF-activation, RAS-like DO; HET: GSP; 2.34A {Arabidopsis thaliana} Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>4dzz_A Plasmid partitioning protein PARF; deviant walker BOX, DNA segregation, unknown function; HET: ADP; 1.80A {Escherichia coli} PDB: 4e03_A* 4e07_A* 4e09_A* Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>2ph1_A Nucleotide-binding protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.70A {Archaeoglobus fulgidus dsm 4304} PDB: 3kb1_A* Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>3l82_B F-box only protein 4; TRFH domain, helix, GTPase domain, acetylation, ADP- ribosylation, alternative splicing, cell cycle, cell division; 2.40A {Homo sapiens} Back     alignment and structure
>3q5d_A Atlastin-1; G protein, GTPase, GDP/GTP binding, hydrolase; HET: GDP; 2.70A {Homo sapiens} PDB: 3q5e_A* 3qnu_A* 3qof_A* Back     alignment and structure
>3kjh_A CO dehydrogenase/acetyl-COA synthase complex, accessory protein COOC; Zn-bound dimer, nickel binding protein, ATPase; 1.90A {Carboxydothermus hydrogenoformans} PDB: 3kjg_A* 3kje_A 3kji_A* Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>3cwq_A Para family chromosome partitioning protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: ADP; 2.47A {Synechocystis SP} Back     alignment and structure
>3la6_A Tyrosine-protein kinase WZC; P-loop protein, nucleotide binding domain, walker A motif, B protein kinase, oligomerization; HET: ADP; 3.20A {Escherichia coli} Back     alignment and structure
>3cio_A ETK, tyrosine-protein kinase ETK; WZC, escherichia coli tyrosine kinase domain, signaling protein, transferase, inner membrane, membrane; 2.50A {Escherichia coli} Back     alignment and structure
>3bfv_A CAPA1, CAPB2, membrane protein CAPA1, protein tyrosine kinase; chimerical protein, P-loop protein, capsule biogenesis/degradation; HET: ADP; 1.80A {Staphylococcus aureus} PDB: 2ved_A* Back     alignment and structure
>1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 Back     alignment and structure
>1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 Back     alignment and structure
>3k9g_A PF-32 protein; ssgcid, SBRI, decode biostructures, UW, NIH, niaid, borellia burgdorferi, plasmid partition protein, iodide; 2.25A {Borrelia burgdorferi} PDB: 3k9h_A Back     alignment and structure
>3q9l_A Septum site-determining protein MIND; ATPase, bacterial cell division inhibitor, MINC, MINE, cell hydrolase; HET: ATP; 2.34A {Escherichia coli} PDB: 3r9i_A* 3r9j_A* Back     alignment and structure
>2oze_A ORF delta'; para, walker type atpases, DNA segregation, PSM19035, plasmid, DNA binding protein; HET: AGS EPE; 1.83A {Streptococcus pyogenes} Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>1wcv_1 SOJ, segregation protein; ATPase, bacterial, chromosome segregation; 1.6A {Thermus thermophilus} PDB: 2bej_A* 2bek_A* Back     alignment and structure
>1hyq_A MIND, cell division inhibitor (MIND-1); MINC, FTSZ, bacterial cell division, cell cycle; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.10 Back     alignment and structure
>3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} Back     alignment and structure
>1g3q_A MIND ATPase, cell division inhibitor; alpha-beta-alpha layered, protein-ADP complex, cell cycle, hydrolase; HET: ADP; 2.00A {Pyrococcus furiosus} SCOP: c.37.1.10 PDB: 1g3r_A* 1ion_A* Back     alignment and structure
>3ea0_A ATPase, para family; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: ATP; 2.20A {Chlorobium tepidum} Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} Back     alignment and structure
>3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* Back     alignment and structure
>1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>4ido_A Atlastin-1; GTPase, GTP/GDP binding, hydrolase; HET: GDP; 2.09A {Homo sapiens} PDB: 4idn_A* 3q5d_A* 3q5e_A* 4idq_A* 4idp_A* 3qnu_A* 3qof_A* Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>1cp2_A CP2, nitrogenase iron protein; oxidoreductase; 1.93A {Clostridium pasteurianum} SCOP: c.37.1.10 Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>2afh_E Nitrogenase iron protein 1; nitrogen fixation, iron-sulfur, metal-binding, molybdenum, oxidoreductase; HET: HCA CFN CLF PGE PG4 P6G 1PE; 2.10A {Azotobacter vinelandii} SCOP: c.37.1.10 PDB: 1g1m_A 1g5p_A 1m1y_E* 1m34_E* 1n2c_E* 1nip_A* 1fp6_A* 2afi_E* 2afk_E* 2nip_A 1de0_A 1xcp_A* 1xdb_A 1xd8_A 1xd9_A* 1g20_E* 1g21_E* 2c8v_A* 1rw4_A Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>1c9k_A COBU, adenosylcobinamide kinase; alpha/beta structure rossmann fold P-loop, transferase; HET: 5GP; 2.20A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1cbu_A Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>3of5_A Dethiobiotin synthetase; structural genomics, center for structural genomics of infec diseases, csgid, ligase; 1.52A {Francisella tularensis subsp} Back     alignment and structure
>1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>3ug7_A Arsenical pump-driving ATPase; tail-anchored, membrane protein, targeting factor, ATP-bindi TRC40, ARSA, nucleotide-binding; HET: ADP; 2.90A {Methanocaldococcus jannaschii} PDB: 3ug6_A* Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>3fkq_A NTRC-like two-domain protein; RER070207001320, structural GE joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: ATP 2PE; 2.10A {Eubacterium rectale} Back     alignment and structure
>3zq6_A Putative arsenical pump-driving ATPase; tail-anchored, membrane protein; HET: ADP; 2.11A {Methanothermobacter thermautotrophicusorganism_taxid} Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>3fwy_A Light-independent protochlorophyllide reductase I ATP-binding protein; BCHL, electron donor, DPOR, Fe protein, nitrogenase; HET: ADP; 1.63A {Rhodobacter sphaeroides 2} Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3qxc_A Dethiobiotin synthetase; DTBS, structural genomics, ATP BIND biology, protein structure initiative, midwest center for S genomics, MCSG; HET: ATP; 1.34A {Helicobacter pylori} PDB: 3mle_A* 3qxh_A* 3qxj_A* 3qxs_A* 3qxx_A* 3qy0_A* 2qmo_A Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>1ihu_A Arsenical pump-driving ATPase; aluminum fluoride, ADP, ARSA ATPase, ATP binding site, hydro; HET: ADP; 2.15A {Escherichia coli} SCOP: c.37.1.10 c.37.1.10 PDB: 1f48_A* 1ii0_A* 1ii9_A* Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>3fgn_A Dethiobiotin synthetase; biotin biosynthesis, BIOD, ATP-BIND ligase, magnesium, nucleotide-binding; 1.85A {Mycobacterium tuberculosis} PDB: 3fmf_A* 3fmi_A* 3fpa_A* Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>1byi_A Dethiobiotin synthase; biotin synthesis, cyclo-ligase, ligase; 0.97A {Escherichia coli} SCOP: c.37.1.10 PDB: 1bs1_A* 1a82_A 1dad_A* 1dae_A* 1daf_A* 1dag_A* 1dah_A* 1dai_A* 1dak_A* 1dam_A* 1dbs_A 1dts_A Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>2xj4_A MIPZ; replication, cell division, ATPase, WACA; 1.60A {Caulobacter vibrioides} PDB: 2xj9_A* 2xit_A Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>2woo_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; 3.01A {Schizosaccharomyces pombe} Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 923
d2c78a3204 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N 1e-19
d2bv3a2 276 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-t 2e-18
d1g7sa4227 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N- 3e-17
d1n0ua2 341 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N- 4e-16
d1d2ea3196 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), 1e-15
d1yrba1244 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB09 2e-14
d1jnya3224 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N 5e-14
d1zunb3222 c.37.1.8 (B:16-237) Sulfate adenylate transferase 4e-12
d1f60a3239 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N 3e-11
d2dy1a2 267 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-t 2e-09
d2qn6a3205 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma su 9e-08
d1kk1a3195 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma su 7e-07
d1r5ba3245 c.37.1.8 (A:215-459) Eukaryotic peptide chain rele 2e-05
d2es4d1280 a.137.15.1 (D:53-332) Lipase chaperone LifO (LipB) 1e-04
d2es4d1280 a.137.15.1 (D:53-332) Lipase chaperone LifO (LipB) 5e-04
d2es4d1280 a.137.15.1 (D:53-332) Lipase chaperone LifO (LipB) 0.004
d1wf3a1178 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain { 4e-04
d2fu5c1173 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [Ta 4e-04
d1g16a_166 c.37.1.8 (A:) Rab-related protein Sec4 {Baker's ye 9e-04
d1x3sa1177 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [Ta 9e-04
d2bmea1174 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [Ta 0.001
d3raba_169 c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxI 0.002
d1wb1a4179 c.37.1.8 (A:1-179) Elongation factor SelB, N-termi 0.002
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Length = 204 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Elongation factor Tu (EF-Tu), N-terminal (G) domain
species: Thermus thermophilus [TaxId: 274]

 Score = 86.2 bits (213), Expect = 1e-19
 Identities = 35/141 (24%), Positives = 45/141 (31%), Gaps = 34/141 (24%)

Query: 798 CIMGHVDTGKTKLLDCI-----------------RGTNVQEGEAGGITQQIGATYFPAEN 840
             +GHVD GKT L   +                       E  A GIT       +    
Sbjct: 7   GTIGHVDHGKTTLTAALTYVAAAENPNVEVKDYGDIDKAPEERARGITINTAHVEYETAK 66

Query: 841 IRERTRELKANATLKVPGLLVIDTPGHESFTNLRSRGSGLCDIAILVVDIMHGLEPQTIE 900
                                +D PGH  +      G+   D AILVV    G  PQT E
Sbjct: 67  RH----------------YSHVDCPGHADYIKNMITGAAQMDGAILVVSAADGPMPQTRE 110

Query: 901 SLNLLKMRNTEFIV-ALNKVR 920
            + L +     +IV  +NKV 
Sbjct: 111 HILLARQVGVPYIVVFMNKVD 131
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Length = 276 Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 227 Back     information, alignment and structure
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 341 Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Length = 196 Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Length = 244 Back     information, alignment and structure
>d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 224 Back     information, alignment and structure
>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Length = 222 Back     information, alignment and structure
>d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 239 Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Length = 267 Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Length = 205 Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Length = 195 Back     information, alignment and structure
>d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 245 Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Length = 178 Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Length = 173 Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 166 Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Length = 177 Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Length = 174 Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 169 Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Length = 179 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query923
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 99.86
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 99.79
d1d2ea3196 Elongation factor Tu (EF-Tu), N-terminal (G) domai 99.75
d2bv3a2 276 Elongation factor G (EF-G), N-terminal (G) domain 99.72
d1n0ua2 341 Elongation factor 2 (eEF-2), N-terminal (G) domain 99.72
d1kk1a3195 Initiation factor eIF2 gamma subunit, N-terminal ( 99.7
d2dy1a2 267 Elongation factor G (EF-G), N-terminal (G) domain 99.7
d1zunb3222 Sulfate adenylate transferase subunit cysN/C, EF-T 99.69
d2qn6a3205 Initiation factor eIF2 gamma subunit, N-terminal ( 99.69
d1f60a3239 Elongation factor eEF-1alpha, N-terminal (G) domai 99.69
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 99.68
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 99.68
d1jnya3224 Elongation factor eEF-1alpha, N-terminal (G) domai 99.66
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 99.63
d1r5ba3245 Eukaryotic peptide chain release factor ERF2, G do 99.59
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 99.59
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 99.58
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 99.58
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 99.57
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 99.56
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 99.56
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 99.56
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 99.56
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 99.56
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 99.56
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 99.55
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 99.55
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 99.55
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 99.54
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 99.54
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 99.54
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 99.54
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 99.54
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 99.53
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 99.53
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 99.53
d1nrjb_209 Signal recognition particle receptor beta-subunit 99.53
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 99.53
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 99.53
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 99.52
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 99.52
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 99.52
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 99.51
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 99.51
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 99.51
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 99.51
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 99.5
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 99.5
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 99.49
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 99.48
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 99.48
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 99.48
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 99.48
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 99.47
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 99.47
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 99.47
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 99.46
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 99.46
d2fh5b1207 Signal recognition particle receptor beta-subunit 99.46
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 99.46
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 99.46
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 99.45
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 99.44
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 99.44
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 99.44
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 99.41
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 99.41
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 99.35
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 99.35
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 99.33
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 99.33
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 99.29
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 99.29
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 99.28
d1tq4a_ 400 Interferon-inducible GTPase {Mouse (Mus musculus) 99.26
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 99.26
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 99.26
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 99.22
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 99.21
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 99.2
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 99.16
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 99.14
d2akab1299 Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 99.07
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 99.07
d1jwyb_306 Dynamin G domain {Dictyostelium discoideum [TaxId: 99.06
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 98.97
d1wxqa1 319 GTP-binding protein PH0525 {Pyrococcus horikoshii 98.71
d1jala1 278 YchF GTP-binding protein N-terminal domain {Haemop 98.58
d1ni3a1 296 YchF GTP-binding protein N-terminal domain {Fissio 98.52
d2p67a1 327 LAO/AO transport system kinase ArgK {Escherichia c 98.18
d2qm8a1 323 Metallochaperone MeaB {Methylobacterium extorquens 98.05
d1puja_273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 97.98
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 97.94
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 97.8
d2qy9a2211 GTPase domain of the signal recognition particle r 97.79
d1okkd2207 GTPase domain of the signal recognition particle r 97.74
d1j8yf2211 GTPase domain of the signal sequence recognition p 97.68
d1vmaa2213 GTPase domain of the signal recognition particle r 97.67
d1ls1a2207 GTPase domain of the signal sequence recognition p 97.63
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 97.5
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 97.34
d1g3qa_237 Cell division regulator MinD {Archaeon Pyrococcus 97.33
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 96.92
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 96.88
d1f5na2 277 Interferon-induced guanylate-binding protein 1 (GB 96.78
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 96.34
d1hyqa_232 Cell division regulator MinD {Archaeon Archaeoglob 96.34
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 96.26
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 96.08
d2awna2232 Maltose transport protein MalK, N-terminal domain 95.99
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 95.78
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 95.74
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 95.65
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 95.4
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 95.37
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 95.26
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 95.05
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 95.01
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 94.99
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 94.97
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 94.92
d1cp2a_269 Nitrogenase iron protein {Clostridium pasteurianum 94.64
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 94.63
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 94.55
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 94.5
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 94.48
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 94.39
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 94.37
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 94.33
d1fnna2 276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 94.26
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 94.06
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 94.03
d2b8ta1139 Thymidine kinase, TK1, N-terminal domain {Ureaplas 93.97
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 93.93
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 93.85
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 93.74
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 93.73
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 93.7
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 93.64
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 93.62
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 93.56
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 93.5
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 93.44
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 93.38
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 93.37
d1byia_224 Dethiobiotin synthetase {Escherichia coli [TaxId: 93.33
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 93.29
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 93.26
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 93.21
d1g2912240 Maltose transport protein MalK, N-terminal domain 93.17
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 93.17
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 93.15
d1cr2a_ 277 Gene 4 protein (g4p, DNA primase), helicase domain 93.12
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 93.12
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 93.01
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 93.0
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 92.87
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 92.83
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 92.81
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 92.71
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 92.65
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 92.6
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 92.59
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 92.39
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 92.35
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 92.35
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 92.35
d2afhe1289 Nitrogenase iron protein {Azotobacter vinelandii [ 92.31
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 92.29
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 92.26
d1ihua1296 Arsenite-translocating ATPase ArsA {Escherichia co 92.22
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 92.2
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 92.17
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 92.17
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 92.16
d1qvra2 387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 92.16
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 92.12
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 92.08
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 92.06
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 92.03
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 92.02
d1ihua2 279 Arsenite-translocating ATPase ArsA {Escherichia co 91.85
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 91.84
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 91.76
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 91.74
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 91.71
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 91.43
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 91.31
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 91.08
d1b0ua_ 258 ATP-binding subunit of the histidine permease {Sal 91.0
d1gvnb_ 273 Plasmid maintenance system epsilon/zeta, toxin zet 90.98
d2hyda1255 Putative multidrug export ATP-binding/permease pro 90.9
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 90.81
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 90.48
d1g8pa_ 333 ATPase subunit of magnesium chelatase, BchI {Rhodo 90.45
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 90.23
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 89.81
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 89.71
d1w5sa2 287 CDC6-like protein APE0152, N-terminal domain {Aero 89.43
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 89.39
d2fnaa2 283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 89.36
d1nlfa_ 274 Hexameric replicative helicase repA {Escherichia c 89.16
g1f2t.1 292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 88.48
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 88.23
d1xx6a1141 Thymidine kinase, TK1, N-terminal domain {Clostrid 87.87
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 87.86
d1r6bx3 315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 87.61
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 87.47
d1p9ra_ 401 Extracellular secretion NTPase EpsE {Vibrio choler 87.47
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 87.31
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 86.72
d1ofha_ 309 HslU {Haemophilus influenzae [TaxId: 727]} 86.56
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 86.4
d1c9ka_180 Adenosylcobinamide kinase/adenosylcobinamide phosp 86.02
d1qvra3 315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 85.18
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 85.11
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 85.1
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 84.64
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 84.42
g1ii8.1 369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 84.39
d1a7ja_ 288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 84.28
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 83.68
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 83.6
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 83.46
d1p5zb_ 241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 83.34
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 83.31
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 83.29
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 82.67
g1xew.1 329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 82.56
d2a5yb3 277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 82.47
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 82.02
d1g41a_ 443 HslU {Haemophilus influenzae [TaxId: 727]} 81.98
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 81.68
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 81.66
d1um8a_ 364 ClpX {Helicobacter pylori [TaxId: 210]} 81.65
d1odfa_ 286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 80.83
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Initiation factor IF2/eIF5b, N-terminal (G) domain
species: Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]

Probab=99.86  E-value=2e-22  Score=204.80  Aligned_cols=132  Identities=53%  Similarity=0.836  Sum_probs=105.5

Q ss_pred             cCCCCEEEEEcCCCCCHHHHHHHHHcCccccCCCCcceeecceeeecccccccceeeec--cccccCCCCEEEEeCCCCc
Q 002428          791 NLRSPICCIMGHVDTGKTKLLDCIRGTNVQEGEAGGITQQIGATYFPAENIRERTRELK--ANATLKVPGLLVIDTPGHE  868 (923)
Q Consensus       791 nlRnp~I~VLG~~GSGKSTLLN~LlgtnVq~geagGIT~qIgat~~p~e~i~ekt~~I~--~~~~~k~~~L~IIDTPGhE  868 (923)
                      .+|+|+|+||||+++|||||+|+|++..+.....++++..++...++.......+....  ....+...+|+|||||||.
T Consensus         2 ~~r~p~IaIiGh~d~GKSTL~~~L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~iDtPGh~   81 (227)
T d1g7sa4           2 KIRSPIVSVLGHVDHGKTTLLDHIRGSAVASREAGGITQHIGATEIPMDVIEGICGDFLKKFSIRETLPGLFFIDTPGHE   81 (227)
T ss_dssp             EECCCEEEEECSTTSSHHHHHHHHHHHHHSCC----CCCBTTEEEEEHHHHHHHSCGGGGGCGGGGTCCEEEEECCCTTS
T ss_pred             CCCCCEEEEEeCCCccHHHHHHHHHhhcchheecCceeeeccccccccccccccccccccceeeccccccccccccccee
Confidence            37899999999999999999999998776666666777776666655443322221111  1233455679999999999


Q ss_pred             chhhHHHhhccCCCEEEEEEeCCCCCCHhHHHHHHHHHhcCCcEEEEEeCCCcC
Q 002428          869 SFTNLRSRGSGLCDIAILVVDIMHGLEPQTIESLNLLKMRNTEFIVALNKVRFS  922 (923)
Q Consensus       869 sf~nlrs~~ls~aDiVILVVDas~gle~qtiEsL~lLkk~~iP~IVVLNKIDLL  922 (923)
                      .|...+..++..||++|||||+.+|+..++..++.++...++|+|||+||||++
T Consensus        82 ~f~~~~~~~~~~~D~~ilVvda~~g~~~~~~~~~~~~~~~~~p~iivlNK~D~~  135 (227)
T d1g7sa4          82 AFTTLRKRGGALADLAILIVDINEGFKPQTQEALNILRMYRTPFVVAANKIDRI  135 (227)
T ss_dssp             CCTTSBCSSSBSCSEEEEEEETTTCCCHHHHHHHHHHHHTTCCEEEEEECGGGS
T ss_pred             cccccchhcccccceEEEEEecccCcccchhHHHHHhhcCCCeEEEEEECccCC
Confidence            999999999999999999999999999999999999999999999999999986
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xx6a1 c.37.1.24 (A:2-142) Thymidine kinase, TK1, N-terminal domain {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1c9ka_ c.37.1.11 (A:) Adenosylcobinamide kinase/adenosylcobinamide phosphate guanylyltransferase CobU {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure