Citrus Sinensis ID: 002435


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920--
MQFVFSLIFFNFTISNFTSSMLSPLCHSYERSALLQFKESLTIIRKTSSYYIWDPCHPKTASWKPEEANIDCCLWDGVECNENTGHVIKLDLSNSCLQGFINSSSGLFKLVHLEWLDLAFNYFICSEIPPEIINLSRLSYLNLSSAGFFGQIPSEILELSNLVSLDLSHNSYYNLIELKEPNLGNLVKKLTNLKELALGGVTISSPIPHSLANLSSLTLLSLSGCELRGRIPSLLGNLTKLMYLDLSFNNLLGELPTSIGNLDCLKRLDISWNELSGELPASIGNLASLEQLELSLNRFRGKTPHSMGNFTRLYWLSLASNDFSGELPASFGNLRSLEGLDISECKFSSQIPSSLRNLAQLKFLEFSHNNFSGPIDLDMFLVNFKHLEHLSLSSNRLSLFTKAIFNTSQKFNFVGLRSCNLNEFPNFLKNQHYLEVLDLSCNKIHGKVPKWLIEPSMQNFSYLNLSHNFLIGFYQHPMFFPRNYDGFTLDLSYNYLQGPLPVPPPQTKHYLVSNNSLTGKIPFWICNSSNSLEILDLSYNNLSGLLPQCLDNFSDHLSILDLQHNKFCGSIPQTFLSGRSLMMIDLSDNLLQGRIPRSLVNCSSLKFLDLGNNQISGTFPSWLGTLRELNVLILKSNKLHGMIREPNTGCGFPELRIIDLSNNRFTGKLPSKYFQCWNAMQVVNTSELRYMEGMIYPFALVSYAALGIYDYSLTMSNKGQMMSYDKVPNFLTGVILSSNRFDGEIPTSIANLKGLQVLSLANNSLHGHILSCLGNLTGLESLDLSNNKFSGQIPQQLVDLTFLEFFNVSNNNLTGPIPQGNQFPTFDKTSFNGNLGLCGKPLPKECENDEAPTNEDQVEGSEESLLSGTSDWKIILIGYAGGLIVGVVLGLNFSIGILEWFSKKFGMQPKRRRRIRRARNRM
ccHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccEEEccccccEEEEEcccccccEEEcccccccccccccEEEccccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccccccccccccHHHHHcccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccEEEccccccccccccEEEcccccccccccccccccccccEEEccccccEEEEcccccccccccccEEEccccEEEEEccccccccccccEEEccccccccccHHccccccccEEEcccccccccccccccccccccccEEEcccccccccccccccccccccccEEEccccccccccccccccccEEEcccccccccccHHHHHccccccEEEcccccccccccHHHHHccccccEEEccccccEEEccccccccccccEEEcccccccccccHHHHHcccccEEEcccccccccccHHHHccccccEEEccccccEEEccccccccccccccEEEcccccccccccHHHHHcHHHHHHccccccccccccccccccccccccEEEEEEEEEEEcccEEEEcccccccEEEEcccccccccccHHHHccccccccccccccccccccccHHccccccEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEEEEEEHHHHHHHHHHHccccccHHHHcccHHHHHHHHHHHccc
cHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccEEEEcccccEEEEEEcccccccccccccccHHccHHccEEEccccccccccccHHHccccccEEEEcccccccccccHHHHcccccEEEEcccccccccccccccccHHHHHcccccEEEEcccccccccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccHHHHccccccEEEcccccccEEccccccccccccEEEccccccccccHHHHcccccccEEEcccccccccccHHHHccccccEEEEcccccccccccHHHHcccccccEEEcccccccccccccccccccccEEEccccccccccHHHHccccccEEEEccccccccccHHHHHcccccccEEEcccccccccccccccccccccEEEEEcccccccccccccccccEEEEEccccccccccHHHHccccccEEEEcccccccccccHHHHccccccEEEEccccccccccccHHccccccEEEEcccccccccccHHHHHccccEEEEcccccccccccHHHHcccccEEEEEEcccccccccccccccccccEEEEEEccccccccccHHHHHHHHHHHHHHcccccccccccccccccccccccccccEEEEEEccccHHHHHcccEEEEEEcccccccccccHHHHHHHHHHEEEccccccccccHHHccccccccEEEccccccEEcccHHHHHcccccEEEccccEEEEEccccccHHHccHHHcccccEEEcccccccccccccccccccccccccccccccccHEEEEEEHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHcccc
MQFVFSLIFFNFTisnftssmlsplchSYERSALLQFKESLTIIrktssyyiwdpchpktaswkpeeanidcclwdgvecnentghvikldlsnsclqgfinsssglfklVHLEWLDLAFNyficseippeiiNLSRlsylnlssagffgqiPSEILELSNlvsldlshnsyynlielkepnlgNLVKKLTNLkelalggvtisspiphslanlssltllslsgcelrgripSLLGNLTKLMYLDLSFNNllgelptsignldclkrLDISWnelsgelpasignLASLEQLELSLNrfrgktphsmgnftRLYWLSLAsndfsgelpasfgnlrslegldiseckfssqipssLRNLAQLKFLEfshnnfsgpidldMFLVNFKHLEHLSLSSNRLSLFTKAIFNTSqkfnfvglrscnlnefpnflknQHYLEVLDLScnkihgkvpkwliepsmqnfsylnLSHNFLigfyqhpmffprnydgftlDLSYnylqgplpvpppqtkhylvsnnsltgkipfwicnssnslEILDLSynnlsgllpqcldnfsDHLSILDLqhnkfcgsipqtflSGRSLMMIDLsdnllqgriprslvncsslkfldlgnnqisgtfpswlgTLRELNVLILKSnklhgmirepntgcgfpelriidlsnnrftgklpskyFQCWNAMQVVNTSELRYMEGMIYPFALVSYAALGIydysltmsnkgqmmsydkvpnFLTGVIlssnrfdgeiptsianlkgLQVLSLANNSLHGHILSClgnltglesldlsnnkfsgqipqqlvDLTFLEFFNvsnnnltgpipqgnqfptfdktsfngnlglcgkplpkecendeaptnedqvegseesllsgtsdwKIILIGYAGGLIVGVVLGLNFSIGILEWFSkkfgmqpkrRRRIRRARNRM
MQFVFSLIFFNFTISNFTSSMLSPLCHSYERSALLQFKESLTIIRKTSSYYIWDPCHPKTASWKPEEANIDCCLWDGVECNENTGHVIKLDLSNSCLQGFINSSSGLFKLVHLEWLDLAFNYFICSEIPPEIINLSRLSYLNLSSAGFFGQIPSEILELSNLVSLDLSHNSYYNLIELKEPNLGNLVKKLTNLKELALGGVTISSPIPHSLANLSSLTLLSLSGCELRGRIPSLLGNLTKLMYLDLSFNNLLGELPTSIGNLDCLKRLDISWNELSGELPASIGNLASLEQLELSLNRFRGKTPHSMGNFTRLYWLSLASNDFSGELPASFGNLRSLEGLDISECKFSSQIPSSLRNLAQLKFLEFSHNNFSGPIDLDMFLVNFKHLEHLSLSSNRLSLFTKAIFNTSQKFNFVGLRSCNLNEFPNFLKNQHYLEVLDLSCNKIHGKVPKWLIEPSMQNFSYLNLSHNFLIGFYQHPMFFPRNYDGFTLDLSYNYLQGPLPVPPPQTKHYLVSNNSLTGKIPFWICNSSNSLEILDLSYNNLSGLLPQCLDNFSDHLSILDLQHNKFCGSIPQTFLSGRSLMMIDLSDNLLQGRIPRSLVNCSSLKFLDLGNNQISGTFPSWLGTLRELNVLILKSNKLHGMIREPNTGCGFPELRIIDLSNNRFTGKLPSKYFQCWNAMQVVNTSELRYMEGMIYPFALVSYAALGIYDYSLTMSNKGQMMSYDKVPNFLTGVILSSNRFDGEIPTSIANLKGLQVLSLANNSLHGHILSCLGNLTGLESLDLSNNKFSGQIPQQLVDLTFLEFFNVSNNNLTGPIPQGNQFPTFDKTSFNGNLGLCGKPLPKECENDeaptnedqvegsEESLLSGTSDWKIILIGYAGGLIVGVVLGLNFSIGILEwfskkfgmqpkrrrrirrarnrm
MQFVfsliffnftisnftssMLSPLCHSYERSALLQFKESLTIIRKTSSYYIWDPCHPKTASWKPEEANIDCCLWDGVECNENTGHVIKLDLSNSCLQGFINSSSGLFKLVHLEWLDLAFNYFICSEIPPEIInlsrlsylnlssAGFFGQIPSEILELSNLVSLDLSHNSYYNLIELKEPNLGNLVKKLTNLKELALGGVTISSPIPHslanlssltllslsGCELRGRIPSLLGNLTKLMYLDLSFNNLLGELPTSIGNLDCLKRLDISWNELSGELPASIGNLASLEQLELSLNRFRGKTPHSMGNFTRLYWLSLASNDFSGELPASFGNLRSLEGLDISECKFSSQIPSSLRNLAQLKFLEFSHNNFSGPIDLDMFLVNFKHLEHLSLSSNRLSLFTKAIFNTSQKFNFVGLRSCNLNEFPNFLKNQHYLEVLDLSCNKIHGKVPKWLIEPSMQNFSYLNLSHNFLIGFYQHPMFFPRNYDGFTLDLSYNYLQGPLPVPPPQTKHYLVSNNSLTGKIPFWICNSSNSLEILDLSYNNLSGLLPQCLDNFSDHLSILDLQHNKFCGSIPQTFLSGRSLMMIDLSDNLLQGRIPRSLVNCSSLKFLDLGNNQISGTFPSWLGTLRELNVLILKSNKLHGMIREPNTGCGFPELRIIDLSNNRFTGKLPSKYFQCWNAMQVVNTSELRYMEGMIYPFALVSYAALGIYDYSLTMSNKGQMMSYDKVPNFLTGVILSSNRFDGEIPTSIANLKGLQVLSLANNSLHGHILSCLGNLTGLESLDLSNNKFSGQIPQQLVDLTFLEFFNVSNNNLTGPIPQGNQFPTFDKTSFNGNLGLCGKPLPKECENDEAPTNEDQVegseesllsgTSDWKiiligyagglivgvvlglNFSIGILEWFSKKFGMQPKrrrrirrarnrM
**FVFSLIFFNFTISNFTSSMLSPLCHSYERSALLQFKESLTIIRKTSSYYIWDPCHPKTASWKPEEANIDCCLWDGVECNENTGHVIKLDLSNSCLQGFINSSSGLFKLVHLEWLDLAFNYFICSEIPPEIINLSRLSYLNLSSAGFFGQIPSEILELSNLVSLDLSHNSYYNLIELKEPNLGNLVKKLTNLKELALGGVTISSPIPHSLANLSSLTLLSLSGCELRGRIPSLLGNLTKLMYLDLSFNNLLGELPTSIGNLDCLKRLDISWNELSGELPASIGNLASLEQLELSLNRFRGKTPHSMGNFTRLYWLSLASNDFSGELPASFGNLRSLEGLDISECKFSSQIPSSLRNLAQLKFLEFSHNNFSGPIDLDMFLVNFKHLEHLSLSSNRLSLFTKAIFNTSQKFNFVGLRSCNLNEFPNFLKNQHYLEVLDLSCNKIHGKVPKWLIEPSMQNFSYLNLSHNFLIGFYQHPMFFPRNYDGFTLDLSYNYLQGPLPVPPPQTKHYLVSNNSLTGKIPFWICNSSNSLEILDLSYNNLSGLLPQCLDNFSDHLSILDLQHNKFCGSIPQTFLSGRSLMMIDLSDNLLQGRIPRSLVNCSSLKFLDLGNNQISGTFPSWLGTLRELNVLILKSNKLHGMIREPNTGCGFPELRIIDLSNNRFTGKLPSKYFQCWNAMQVVNTSELRYMEGMIYPFALVSYAALGIYDYSLTMSNKGQMMSYDKVPNFLTGVILSSNRFDGEIPTSIANLKGLQVLSLANNSLHGHILSCLGNLTGLESLDLSNNKFSGQIPQQLVDLTFLEFFNVSNNNLTGPIPQGNQFPTFDKTSFNGNLGLC******************************TSDWKIILIGYAGGLIVGVVLGLNFSIGILEWFSKKF*****************
MQFVFSLIFFNFTISNFTSSML***CHSYERSALLQFKESLTIIRKTSSYYIWDPCHPKTASWKPEEANIDCCLWDGVECNENTGHVIKLDLSNSCLQGFINSSSGLFKLVHLEWLDLAFNYFICSEIPPEIINLSRLSYLNLSSAGFFGQIPSEILELSNLVSLDLSHNSYYNLIELKEPNLGNLVKKLTNLKELALGGVTISSPIPHSLANLSSLTLLSLSGCELRGRIPSLLGNLTKLMYLDLSFNNLLGELPTSIGNLDCLKRLDISWNELSGELPASIGNLASLEQLELSLNRFRGKTPHSMGNFTRLYWLSLASNDFSGELPASFGNLRSLEGLDISECKFSSQIPSSLRNLAQLKFLEFSHNNFSGPIDLDMFLVNFKHLEHLSLSSNRLSLFTKAIFNTSQKFNFVGLRSCNLNEFPNFLKNQHYLEVLDLSCNKIHGKVPKWLIEPSMQNFSYLNLSHNFLIGFYQHPMFFPRNYDGFTLDLSYNYLQGPLPVPPPQTKHYLVSNNSLTGKIPFWICNSSNSLEILDLSYNNLSGLLPQCLDNFSDHLSILDLQHNKFCGSIPQTFLSGRSLMMIDLSDNLLQGRIPRSLVNCSSLKFLDLGNNQISGTFPSWLGTLRELNVLILKSNKLHGMIREPNTGCGFPELRIIDLSNNRFTGKLPSKYFQCWNAMQV*******YMEGMIYPFALVSYAALGIYDYSLTMSNKGQMMSYDKVPNFLTGVILSSNRFDGEIPTSIANLKGLQVLSLANNSLHGHILSCLGNLTGLESLDLSNNKFSGQIPQQLVDLTFLEFFNVSNNNLTGPIPQGNQFPTFDKTSFNGNLGLCGKPL**************************TSDWKIILIGYAGGLIVGVVLGLNFSIGILEWFSKKFGMQPKRRRRIRR*****
MQFVFSLIFFNFTISNFTSSMLSPLCHSYERSALLQFKESLTIIRKTSSYYIWDPCHPKTASWKPEEANIDCCLWDGVECNENTGHVIKLDLSNSCLQGFINSSSGLFKLVHLEWLDLAFNYFICSEIPPEIINLSRLSYLNLSSAGFFGQIPSEILELSNLVSLDLSHNSYYNLIELKEPNLGNLVKKLTNLKELALGGVTISSPIPHSLANLSSLTLLSLSGCELRGRIPSLLGNLTKLMYLDLSFNNLLGELPTSIGNLDCLKRLDISWNELSGELPASIGNLASLEQLELSLNRFRGKTPHSMGNFTRLYWLSLASNDFSGELPASFGNLRSLEGLDISECKFSSQIPSSLRNLAQLKFLEFSHNNFSGPIDLDMFLVNFKHLEHLSLSSNRLSLFTKAIFNTSQKFNFVGLRSCNLNEFPNFLKNQHYLEVLDLSCNKIHGKVPKWLIEPSMQNFSYLNLSHNFLIGFYQHPMFFPRNYDGFTLDLSYNYLQGPLPVPPPQTKHYLVSNNSLTGKIPFWICNSSNSLEILDLSYNNLSGLLPQCLDNFSDHLSILDLQHNKFCGSIPQTFLSGRSLMMIDLSDNLLQGRIPRSLVNCSSLKFLDLGNNQISGTFPSWLGTLRELNVLILKSNKLHGMIREPNTGCGFPELRIIDLSNNRFTGKLPSKYFQCWNAMQVVNTSELRYMEGMIYPFALVSYAALGIYDYSLTMSNKGQMMSYDKVPNFLTGVILSSNRFDGEIPTSIANLKGLQVLSLANNSLHGHILSCLGNLTGLESLDLSNNKFSGQIPQQLVDLTFLEFFNVSNNNLTGPIPQGNQFPTFDKTSFNGNLGLCGKPLPKECE*******************SGTSDWKIILIGYAGGLIVGVVLGLNFSIGILEWFSKKFGMQPKRRRRIRRARNRM
MQFVFSLIFFNFTISNFTSSMLSPLCHSYERSALLQFKESLTIIRKTSSYYIWDPCHPKTASWKPEEANIDCCLWDGVECNENTGHVIKLDLSNSCLQGFINSSSGLFKLVHLEWLDLAFNYFICSEIPPEIINLSRLSYLNLSSAGFFGQIPSEILELSNLVSLDLSHNSYYNLIELKEPNLGNLVKKLTNLKELALGGVTISSPIPHSLANLSSLTLLSLSGCELRGRIPSLLGNLTKLMYLDLSFNNLLGELPTSIGNLDCLKRLDISWNELSGELPASIGNLASLEQLELSLNRFRGKTPHSMGNFTRLYWLSLASNDFSGELPASFGNLRSLEGLDISECKFSSQIPSSLRNLAQLKFLEFSHNNFSGPIDLDMFLVNFKHLEHLSLSSNRLSLFTKAIFNTSQKFNFVGLRSCNLNEFPNFLKNQHYLEVLDLSCNKIHGKVPKWLIEPSMQNFSYLNLSHNFLIGFYQHPMFFPRNYDGFTLDLSYNYLQGPLPVPPPQTKHYLVSNNSLTGKIPFWICNSSNSLEILDLSYNNLSGLLPQCLDNFSDHLSILDLQHNKFCGSIPQTFLSGRSLMMIDLSDNLLQGRIPRSLVNCSSLKFLDLGNNQISGTFPSWLGTLRELNVLILKSNKLHGMIREPNTGCGFPELRIIDLSNNRFTGKLPSKYFQCWNAMQVVNTSELRYMEGMIYPFALVSYAALGIYDYSLTMSNKGQMMSYDKVPNFLTGVILSSNRFDGEIPTSIANLKGLQVLSLANNSLHGHILSCLGNLTGLESLDLSNNKFSGQIPQQLVDLTFLEFFNVSNNNLTGPIPQGNQFPTFDKTSFNGNLGLCGKPLPK*C*********************GTSDWKIILIGYAGGLIVGVVLGLNFSIGILEWFSKKFGMQPKRRRR********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQFVFSLIFFNFTISNFTSSMLSPLCHSYERSALLQFKESLTIIRKTSSYYIWDPCHPKTASWKPEEANIDCCLWDGVECNENTGHVIKLDLSNSCLQGFINSSSGLFKLVHLEWLDLAFNYFICSEIPPEIINLSRLSYLNLSSAGFFGQIPSEILELSNLVSLDLSHNSYYNLIELKEPNLGNLVKKLTNLKELALGGVTISSPIPHSLANLSSLTLLSLSGCELRGRIPSLLGNLTKLMYLDLSFNNLLGELPTSIGNLDCLKRLDISWNELSGELPASIGNLASLEQLELSLNRFRGKTPHSMGNFTRLYWLSLASNDFSGELPASFGNLRSLEGLDISECKFSSQIPSSLRNLAQLKFLEFSHNNFSGPIDLDMFLVNFKHLEHLSLSSNRLSLFTKAIFNTSQKFNFVGLRSCNLNEFPNFLKNQHYLEVLDLSCNKIHGKVPKWLIEPSMQNFSYLNLSHNFLIGFYQHPMFFPRNYDGFTLDLSYNYLQGPLPVPPPQTKHYLVSNNSLTGKIPFWICNSSNSLEILDLSYNNLSGLLPQCLDNFSDHLSILDLQHNKFCGSIPQTFLSGRSLMMIDLSDNLLQGRIPRSLVNCSSLKFLDLGNNQISGTFPSWLGTLRELNVLILKSNKLHGMIREPNTGCGFPELRIIDLSNNRFTGKLPSKYFQCWNAMQVVNTSELRYMEGMIYPFALVSYAALGIYDYSLTMSNKGQMMSYDKVPNFLTGVILSSNRFDGEIPTSIANLKGLQVLSLANNSLHGHILSCLGNLTGLESLDLSNNKFSGQIPQQLVDLTFLEFFNVSNNNLTGPIPQGNQFPTFDKTSFNGNLGLCGKPLPKECENDEAPTNEDQVEGSEESLLSGTSDWKIILIGYAGGLIVGVVLGLNFSIGILEWFSKKFGMQPKRRRRIRRARNRM
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query922 2.2.26 [Sep-21-2011]
Q9C9H7847 Receptor-like protein 12 no no 0.878 0.956 0.349 1e-122
Q9FL28 1173 LRR receptor-like serine/ no no 0.761 0.598 0.322 1e-80
C0LGQ5 1249 LRR receptor-like serine/ no no 0.796 0.587 0.316 9e-74
Q9LVP0 1102 Probable leucine-rich rep no no 0.708 0.592 0.339 2e-66
Q9FIZ3 1252 LRR receptor-like serine/ no no 0.801 0.590 0.307 2e-65
Q9LYN8 1192 Leucine-rich repeat recep no no 0.800 0.619 0.296 4e-65
Q9LP24 1120 Probable leucine-rich rep no no 0.764 0.629 0.310 8e-63
Q8VZG8 1045 Probable LRR receptor-lik no no 0.636 0.561 0.323 2e-62
O82318960 Probably inactive leucine no no 0.611 0.587 0.339 3e-62
Q9FZ59 1088 Leucine-rich repeat recep no no 0.652 0.553 0.324 1e-60
>sp|Q9C9H7|RLP12_ARATH Receptor-like protein 12 OS=Arabidopsis thaliana GN=RLP12 PE=2 SV=2 Back     alignment and function desciption
 Score =  441 bits (1135), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 325/931 (34%), Positives = 467/931 (50%), Gaps = 121/931 (12%)

Query: 2   QFVFS---LIFFNFTISNFTSSMLSP-LCHSYERSALLQFKESLTIIRKTSSYYIWDPCH 57
            +VFS   +IF +  + +  SS  SP  C   +R ALL+F+    I    +S++I +   
Sbjct: 8   HWVFSSRIIIFLSLLVHSLASS--SPHFCRDDQRDALLEFRGEFPI---NASWHIMN--- 59

Query: 58  PKTASWK-PEEANIDCCLWDGVECNENTGHVIKLDLSNSCLQGFINSSSGLFKLVHLEWL 116
                W+ P   + DCCLW+GV CN+ +G VI LD+ N+ L  ++ ++S LFKL +L  L
Sbjct: 60  ----QWRGPWNKSTDCCLWNGVTCNDKSGQVISLDIPNTFLNNYLKTNSSLFKLQYLRHL 115

Query: 117 DLAFNYFICSEIPPEIINLSRLSYLNLSSAGFFGQIPSEILELSNLVSLDLSHNSYYNLI 176
           DL  N  +  EIP  + NLS L+ +NL    F G+IP+ I                    
Sbjct: 116 DLT-NCNLYGEIPSSLGNLSHLTLVNLYFNKFVGEIPASI-------------------- 154

Query: 177 ELKEPNLGNLVKKLTNLKELALGGVTISSPIPHSLANLSSLTLLSLSGCELRGRIPSLLG 236
                  GN    L  L+ L L    ++  IP SL NLS L  L L    L G+IP  +G
Sbjct: 155 -------GN----LNQLRHLILANNVLTGEIPSSLGNLSRLVNLELFSNRLVGKIPDSIG 203

Query: 237 NLTKLMYLDLSFNNLLGELPTSIGNLDCLKRLDISWNELSGELPASIGNLASLEQLELSL 296
           +L +L  L L+ NNL+GE+P+S+GNL  L  L ++ N+L GE+PASIGNL  L  +    
Sbjct: 204 DLKQLRNLSLASNNLIGEIPSSLGNLSNLVHLVLTHNQLVGEVPASIGNLIELRVMSFEN 263

Query: 297 NRFRGKTPHSMGNFTRLYWLSLASNDFSGELPASFGNLRSLEGLDISECKFSSQIPSSLR 356
           N   G  P S  N T+L    L+SN+F+   P       +LE  D+S   FS   P SL 
Sbjct: 264 NSLSGNIPISFANLTKLSIFVLSSNNFTSTFPFDMSIFHNLEYFDVSYNSFSGPFPKSLL 323

Query: 357 NLAQLKFLEFSHNNFSGPIDLDMFLVNFKHLEHLSLSSNRL---------SLFTKAIFNT 407
            +  L+ +    N F+GPI+      + K L+ L L  NRL          L      + 
Sbjct: 324 LIPSLESIYLQENQFTGPIEFANTSSSTK-LQDLILGRNRLHGPIPESISRLLNLEELDI 382

Query: 408 SQKFNFVGLRSCNLNEFPNFLKNQHYLEVLDLSCNKIHGKVPKWLIEPSMQNFSYLNLSH 467
           S   NF G     +++  N L        LDLS N + G+VP  L        + + LSH
Sbjct: 383 SHN-NFTGAIPPTISKLVNLLH-------LDLSKNNLEGEVPACLWR-----LNTMVLSH 429

Query: 468 NFLIGFY---QHPMFFPRNYDGFTLDLSYNYLQGPLPVPPPQTKHYLVSNNSLTGKIPFW 524
           N    F    Q             LDL+ N  QGP                     IP+ 
Sbjct: 430 NSFSSFENTSQEEALIEE------LDLNSNSFQGP---------------------IPYM 462

Query: 525 ICNSSNSLEILDLSYNNLSGLLPQCLDNFSDHLSILDLQHNKFCGSIPQTFLSGRSLMMI 584
           IC  S SL  LDLS N  SG +P C+ NFS  +  L+L  N F G++P  F     L+ +
Sbjct: 463 ICKLS-SLGFLDLSNNLFSGSIPSCIRNFSGSIKELNLGDNNFSGTLPDIFSKATELVSL 521

Query: 585 DLSDNLLQGRIPRSLVNCSSLKFLDLGNNQISGTFPSWLGTLRELNVLILKSNKLHGMIR 644
           D+S N L+G+ P+SL+NC +L+ +++ +N+I   FPSWL +L  L+VL L+SNK +G + 
Sbjct: 522 DVSHNQLEGKFPKSLINCKALELVNVESNKIKDIFPSWLESLPSLHVLNLRSNKFYGPLY 581

Query: 645 EPNTGCGFPELRIIDLSNNRFTGKLPSKYFQCWNAMQVVNTSELRYMEGMIYPFALVSYA 704
             +   GF  LRIID+S+N F+G LP  YF  W  M  +     +YM           YA
Sbjct: 582 HRHASIGFQSLRIIDISHNNFSGTLPPYYFSNWKDMTTLTEEMDQYMT------EFWRYA 635

Query: 705 ALGIYDYSLTMSNKGQMMSYDKVPNFLTGVILSSNRFDGEIPTSIANLKGLQVLSLANNS 764
               Y + + M NKG  MS++++      +  S N+ +G IP S+  LK L+VL+L+ N+
Sbjct: 636 --DSYYHEMEMVNKGVDMSFERIRRDFRAIDFSGNKINGNIPESLGYLKELRVLNLSGNA 693

Query: 765 LHGHILSCLGNLTGLESLDLSNNKFSGQIPQQLVDLTFLEFFNVSNNNLTGPIPQGNQFP 824
               I   L NLT LE+LD+S NK SGQIPQ L  L+FL + N S+N L GP+P+G QF 
Sbjct: 694 FTSVIPRFLANLTKLETLDISRNKLSGQIPQDLAALSFLSYMNFSHNLLQGPVPRGTQFQ 753

Query: 825 TFDKTSFNGNLGLCGKPLPKECENDEA--PTNE--DQVEGSEESLLSGTSDWKIILIGYA 880
               +SF  N GL G  L   C +  A  PT++  + +  +EE++     +W    I Y 
Sbjct: 754 RQKCSSFLDNPGLYG--LEDICRDTGALNPTSQLPEDLSEAEENMF----NWVAAAIAYG 807

Query: 881 GGLIVGVVLGLNFSIGILEWFSKKFGMQPKR 911
            G++ G+V+G  ++    EWF++KFG +  +
Sbjct: 808 PGVLCGLVIGHFYTSHNHEWFTEKFGRKQHK 838




Involved in the perception of CLV3 and CLV3-like peptides, that act as extracellular signals regulating meristems maintenance.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function description
>sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 Back     alignment and function description
>sp|Q9LVP0|Y5639_ARATH Probable leucine-rich repeat receptor-like protein kinase At5g63930 OS=Arabidopsis thaliana GN=At5g63930 PE=1 SV=1 Back     alignment and function description
>sp|Q9FIZ3|GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2 Back     alignment and function description
>sp|Q9LYN8|EXS_ARATH Leucine-rich repeat receptor protein kinase EXS OS=Arabidopsis thaliana GN=EXS PE=1 SV=1 Back     alignment and function description
>sp|Q9LP24|Y1571_ARATH Probable leucine-rich repeat receptor-like protein kinase At1g35710 OS=Arabidopsis thaliana GN=At1g35710 PE=2 SV=1 Back     alignment and function description
>sp|Q8VZG8|Y4885_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g08850 OS=Arabidopsis thaliana GN=At4g08850 PE=1 SV=3 Back     alignment and function description
>sp|O82318|Y2579_ARATH Probably inactive leucine-rich repeat receptor-like protein kinase At2g25790 OS=Arabidopsis thaliana GN=At2g25790 PE=1 SV=1 Back     alignment and function description
>sp|Q9FZ59|PEPR2_ARATH Leucine-rich repeat receptor-like protein kinase PEPR2 OS=Arabidopsis thaliana GN=PEPR2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query922
359485824973 PREDICTED: receptor-like protein 12-like 0.977 0.926 0.487 0.0
359490156886 PREDICTED: receptor-like protein 12-like 0.945 0.984 0.484 0.0
359485822993 PREDICTED: receptor-like protein 12-like 0.981 0.911 0.454 0.0
1478046701004 hypothetical protein VITISV_022039 [Viti 0.966 0.887 0.455 0.0
147782974 1719 hypothetical protein VITISV_036826 [Viti 0.954 0.511 0.453 0.0
224140513947 predicted protein [Populus trichocarpa] 0.979 0.953 0.452 0.0
224140517979 predicted protein [Populus trichocarpa] 0.969 0.913 0.446 0.0
224140509961 predicted protein [Populus trichocarpa] 0.958 0.919 0.435 0.0
225447578 1946 PREDICTED: uncharacterized protein LOC10 0.919 0.435 0.459 0.0
255548694984 serine/threonine-protein kinase bri1, pu 0.950 0.890 0.438 0.0
>gi|359485824|ref|XP_003633343.1| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  764 bits (1972), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 477/979 (48%), Positives = 596/979 (60%), Gaps = 78/979 (7%)

Query: 1   MQFVFSLIFFNFTISNFTSSMLSPLCHSYERSALLQFKESLTIIRKTSSYYIWDP-CHPK 59
           ++F+  L  F   ++N +SSM  PLCH  E SALLQFK+S  I    S     +P  +PK
Sbjct: 11  VRFLLFLSSFYLMVTNSSSSMHRPLCHDSEGSALLQFKQSFLIDEHASG----NPSAYPK 66

Query: 60  TASWKP----EEANIDCCLWDGVECNENTGHVIKLDLSNSCLQGFINSSSGLFKLVHLEW 115
            A WK     E    DCC WDGVEC+  TGHVI L L++SCL G INSSS LF LVHL+ 
Sbjct: 67  VAMWKSHGEGEREGSDCCSWDGVECDRETGHVIGLHLASSCLYGSINSSSTLFSLVHLQR 126

Query: 116 LDLAFNYFICSEIPPEIINLSRLSYLNLSSAGFFGQIPSEILELSNLVSLDLSHNSYYNL 175
           LDL+ N F  SEIP  +  LSRL  L+LS +GF GQIPSE+L LS LV LDLS N     
Sbjct: 127 LDLSDNDFNYSEIPFGVGQLSRLRSLDLSFSGFSGQIPSELLALSKLVFLDLSANPK--- 183

Query: 176 IELKEPNLGNLVKKLTNLKELALGGVTISSPIPHSLANLSSLTLLSLSGCELRGRIPSLL 235
           ++L++P L NLV+ LT+LK+L L  V ISS IP+ LA+LSSLT L L  C L G  P  +
Sbjct: 184 LQLQKPGLRNLVQNLTHLKKLHLSQVNISSTIPYELASLSSLTSLFLGECGLHGEFPMKI 243

Query: 236 GNLTKLMYL------------------------DLSFNNLLGELPTSIGNLDCLKRLDIS 271
             L  L YL                        DL+  +  GELPTSIG L  L  LDIS
Sbjct: 244 FQLPSLQYLTVRDNLDLISYLPEFQETSPLKMLDLAGTSFSGELPTSIGRLGSLTELDIS 303

Query: 272 WNELSGELPASIGNLASLEQLELSLNRFRGKTPHSMGNFTRLYWLSLASNDFS------- 324
               +G +P+S+G+L  L  L+LS N F G+ P SM N T+L +LSL+ NDF+       
Sbjct: 304 SCNFTGSVPSSLGHLTQLYYLDLSNNHFSGQIPSSMANLTQLIYLSLSWNDFNVGTLSWL 363

Query: 325 -----------------GELPASFGNLRSLEGLDISECKFSSQIPSSLRNLAQLKFLEFS 367
                            GE+P S  N+  L  L +S+ + S QIPSSL  L  L+ L   
Sbjct: 364 GQQTKLTYLYLNQINLIGEIPFSLVNMSQLNILSLSDNQLSGQIPSSLFELVNLQGLYLL 423

Query: 368 HNNFSGPIDLDMFLVNFKHLEHLSLSSNRLSLFTKAIFN-TSQKFNFVGLRSCNLNEFPN 426
            N  +G ++L + L   K+L +L LS NRLS  +    N T  KF  +GL SCNL EFP+
Sbjct: 424 SNYLNGTVELQL-LSKLKNLIYLQLSDNRLSFLSYTRTNATLPKFKHLGLGSCNLTEFPD 482

Query: 427 FLKNQHYLEVLDLSCNKIHGKVPKWLIEPSMQNFSYLNLSHNFLIGFYQHPMFFPRNYDG 486
           FL+NQH LE++ LS NKIHG +PKW+   S +    L LS NFL GF Q P   P +   
Sbjct: 483 FLQNQHELEIITLSENKIHGPIPKWVWNISKETLVTLELSENFLTGFDQRPFVLPWS-KL 541

Query: 487 FTLDLSYNYLQGPLPVPPPQTKHYLVSNNSLTGKIPFWICNSSNSLEILDLSYNNLSGLL 546
            TL L  N LQGPLPVPPP T  YLVS N LTG+I   ICN + SLE+LDLS NNLSG +
Sbjct: 542 HTLRLDSNMLQGPLPVPPPSTVEYLVSGNKLTGEISPLICNMT-SLELLDLSSNNLSGRI 600

Query: 547 PQCLDNFSDHLSILDLQHNKFCGSIPQTFLSGRSLMMIDLSDNLLQGRIPRSLVNCSSLK 606
           PQCL NFS  L +LDL  N   G IP+      +L +IDL DN  QG+IPRSLVNC+ L+
Sbjct: 601 PQCLANFSRSLFVLDLGSNSLDGPIPEICTVSHNLNVIDLGDNQFQGQIPRSLVNCTMLE 660

Query: 607 FLDLGNNQISGTFPSWLGTLRELNVLILKSNKLHGMIREPNTGCGFPELRIIDLSNNRFT 666
            L LGNN+I+  FP WLG L +L VLIL+SN+ HG I   +T   FP+LRIIDLS+N F 
Sbjct: 661 HLVLGNNKINDIFPFWLGALPQLQVLILRSNRFHGAIGSWHTNFRFPKLRIIDLSDNEFI 720

Query: 667 GKLPSKYFQCWNAMQVVN-TSELRYMEGMIYPFA-LVSYAALGIYDYSLTMSNKGQMMSY 724
           G LPS+YFQ W+AM++ +  S LRYM+  I P   L +   +  Y YS+TM+NKG    Y
Sbjct: 721 GDLPSEYFQNWDAMKLTDIASGLRYMQ--ISPMIDLKNNVMITGYMYSMTMTNKGMQRFY 778

Query: 725 DKVPNFLTGVILSSNRFDGEIPTSIANLKGLQVLSLANNSLHGHILSCLGNLTGLESLDL 784
           +++ +    +  S N F G+IPTSI +LKG+ +L+L  N L GHI S LGNLT LESLDL
Sbjct: 779 ERILDTFMAIDFSGNNFKGQIPTSIGSLKGIHLLNLGGNDLTGHIPSSLGNLTQLESLDL 838

Query: 785 SNNKFSGQIPQQLVDLTFLEFFNVSNNNLTGPIPQGNQFPTFDKTSFNGNLGLCGKPLPK 844
           S NK SG+IP QL  LTFLEFFNVS+N+LTG IPQG QF TF+  SF+GNLGLCG PL +
Sbjct: 839 SQNKLSGEIPWQLTRLTFLEFFNVSHNHLTGHIPQGKQFATFENASFDGNLGLCGSPLSR 898

Query: 845 ECENDEA--PTNEDQVEGSEESLLSGTSDWKIILIGYAGGLIVGVVLGLNFSIGILEWFS 902
           EC + EA  PT+    +GS         DWKI+L+GY  GL++GV +G   +    EWF 
Sbjct: 899 ECGSSEALPPTSSSSKQGSTTKF-----DWKIVLMGYGSGLLIGVSIGYCLTSWKHEWFV 953

Query: 903 KKFGMQPKRRRRIRRARNR 921
           K  G   KR+R+  R   R
Sbjct: 954 KTIG---KRQRKWTRKEGR 969




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359490156|ref|XP_003634044.1| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359485822|ref|XP_003633342.1| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147804670|emb|CAN66864.1| hypothetical protein VITISV_022039 [Vitis vinifera] Back     alignment and taxonomy information
>gi|147782974|emb|CAN66148.1| hypothetical protein VITISV_036826 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224140513|ref|XP_002323627.1| predicted protein [Populus trichocarpa] gi|222868257|gb|EEF05388.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224140517|ref|XP_002323629.1| predicted protein [Populus trichocarpa] gi|222868259|gb|EEF05390.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224140509|ref|XP_002323625.1| predicted protein [Populus trichocarpa] gi|222868255|gb|EEF05386.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225447578|ref|XP_002270154.1| PREDICTED: uncharacterized protein LOC100264911 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255548694|ref|XP_002515403.1| serine/threonine-protein kinase bri1, putative [Ricinus communis] gi|223545347|gb|EEF46852.1| serine/threonine-protein kinase bri1, putative [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query922
TAIR|locus:22050051019 RLP7 "AT1G47890" [Arabidopsis 0.783 0.708 0.381 3.3e-118
TAIR|locus:2087253884 RLP39 "AT3G24900" [Arabidopsis 0.818 0.854 0.372 3.5e-114
TAIR|locus:2046357890 RLP23 "receptor like protein 2 0.793 0.822 0.379 4.5e-114
TAIR|locus:2086974881 RLP41 "AT3G25010" [Arabidopsis 0.818 0.856 0.366 8.4e-113
TAIR|locus:2074633943 RLP35 "AT3G11080" [Arabidopsis 0.869 0.850 0.353 4.6e-112
TAIR|locus:2825762994 RLP6 "AT1G45616" [Arabidopsis 0.708 0.656 0.388 3.8e-110
TAIR|locus:2119430741 RLP47 "receptor like protein 4 0.665 0.828 0.391 1.6e-109
TAIR|locus:2829370915 RLP40 "receptor like protein 4 0.822 0.828 0.362 1.5e-108
TAIR|locus:2046585808 RLP27 "receptor like protein 2 0.663 0.757 0.411 2.4e-108
TAIR|locus:2129246891 RLP50 "receptor like protein 5 0.855 0.885 0.348 4.4e-107
TAIR|locus:2205005 RLP7 "AT1G47890" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1164 (414.8 bits), Expect = 3.3e-118, P = 3.3e-118
 Identities = 290/760 (38%), Positives = 418/760 (55%)

Query:   110 LVHLEWLDLAFNYFICSEIPPEIIXXXXXXXXXXXXAGFFGQIPSEILELSNLVSLDLSH 169
             L +L  LD+++   I SEIP E                 FG+ PS IL + NL S+DL +
Sbjct:   226 LRNLRELDMSY-VKISSEIPEEFSNIRSLRSLNLNGCNLFGEFPSSILLIPNLQSIDLGN 284

Query:   170 NSYYNLIELKEPNL-GNL--VKKLTNLKELALGGVTISSPIPHXXXXXXXXXXXXXXGCE 226
             N          PNL GNL    +  +L +L +   + S  IP                  
Sbjct:   285 N----------PNLRGNLPVFHENNSLLKLTILYTSFSGAIPDSISSLKNLTSLTLSVSY 334

Query:   227 LRGRIPSLLGNLTKLMYLDLSFNNLLGELPTSIGNLDCLKRLDISWNELSGELPASIGNL 286
               G+IP  LGNL+ L +L LS NNL+GE+P+SIGNL+ L    +  N+LSG LPA++ NL
Sbjct:   335 FSGKIPFSLGNLSHLSHLSLSSNNLIGEIPSSIGNLNQLTNFYVGGNKLSGNLPATLSNL 394

Query:   287 ASLEQLELSLNRFRGKTPHSMGNFTRLYWLSLASNDFSGELPASFGNLRSLEGLDISECK 346
               L  + LS N+F G  P S+   ++L +     N F G + +    + SL  + +S  +
Sbjct:   395 TKLNTISLSSNQFTGSLPPSISQLSKLKFFFADDNPFIGAILSPLLKIPSLTRIHLSYNQ 454

Query:   347 FSSQIPSSLRNLAQLKFLE---FSHNNFSG--PIDLDMFLVNFKHLEHLSLSSNRLSLFT 401
              +  +   + N+  L  LE     H N++   P+DL++F  + K L  L +S   +S  T
Sbjct:   455 LNDLV--GIENIFMLPNLETFYIYHYNYTKVRPLDLNVFS-SLKQLGTLYISRIPIST-T 510

Query:   402 KAIFNTSQKFNFVGLRSCNLNEFPNFLKNQHYLEVLDLSCNKIHGKVPKWLIEPSMQNFS 461
                 +      ++ LRSCN+ +FP F++    L++LDLS NKI G+VP WL    M   +
Sbjct:   511 NITSDFPSNLEYLSLRSCNITDFPEFIRKGRNLQILDLSNNKIKGQVPDWLWR--MPTLN 568

Query:   462 YLNLSHNFLIGFYQHPMFFPRNYDGFTLDLSYNYLQGPLPVPPPQTKHYLVSNNSLTGKI 521
              ++LS+N L GF+      P +    ++DLS N  QGPL +P    +++  SNN+ TGKI
Sbjct:   569 SVDLSNNSLSGFHVSVKASPES-QLTSVDLSSNAFQGPLFLPSKSLRYFSGSNNNFTGKI 627

Query:   522 PFWICNSSNSLEILDLSYNNLSGLLPQCLDNFSDHLSILDLQHNKFCGSIPQTFLSGRSL 581
             P  IC  S SLEILDLS NNL+G LP CL+     LS LDL++N   GS+P+ F++   L
Sbjct:   628 PRSICGLS-SLEILDLSNNNLNGSLPWCLETLMSSLSDLDLRNNSLSGSLPEIFMNATKL 686

Query:   582 MMIDLSDNLLQGRIPRSLVNCSSLKFLDLGNNQISGTFPSWLGTLRELNVLILKSNKLHG 641
               +D+S N ++G++P SL  CSSL+ L++G+N+I+  FP  L +L++L VL+L SNK HG
Sbjct:   687 RSLDVSHNRMEGKLPGSLTGCSSLEVLNVGSNRINDMFPFELNSLQKLQVLVLHSNKFHG 746

Query:   642 MIREPN-TGCGFPELRIIDLSNNRFTGKLPSKYFQCWNAMQVV--NTSELRYMEGMIYPF 698
              +   +    GFP+L+IID+S+N F G LPS YF  W AM     N  E  Y++    P 
Sbjct:   747 TLHNVDGVWFGFPQLQIIDVSHNDFFGILPSDYFMNWTAMSSKKDNNIEPEYIQN---PS 803

Query:   699 ALVSYAALGIYDYSLTMSNKGQMMSYDKVPNFLTGVILSSNRFDGEIPTSIANLKGLQVL 758
                S  +LG Y  SL + +KG  M  ++V    T + LS N+  G+IP SI  LK L++L
Sbjct:   804 VYGS--SLGYYT-SLVLMSKGVSMEMERVLTIYTAIDLSGNQLHGKIPDSIGLLKELRIL 860

Query:   759 SLANNSLHGHILSCLGNLTGLESLDLSNNKFSGQIPQQLVDLTFLEFFNVSNNNLTGPIP 818
             ++++N   GHI S L NL  LESLD+S N  SG+IP +L  L+ L + NVS+N L G IP
Sbjct:   861 NMSSNGFTGHIPSSLANLKNLESLDISQNNISGEIPPELGTLSSLAWINVSHNQLVGSIP 920

Query:   819 QGNQFPTFDKTSFNGNLGLCGKPLPKECEN--DEAPTNED 856
             QG QF     +S+ GN GL G  L   C +  +  PT  +
Sbjct:   921 QGTQFQRQKCSSYEGNPGLNGPSLENVCGHIKESTPTQTE 960


GO:0006952 "defense response" evidence=ISS
GO:0016301 "kinase activity" evidence=ISS
GO:0007165 "signal transduction" evidence=IC;RCA
GO:0002237 "response to molecule of bacterial origin" evidence=RCA
GO:0010103 "stomatal complex morphogenesis" evidence=RCA
GO:0048443 "stamen development" evidence=RCA
TAIR|locus:2087253 RLP39 "AT3G24900" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046357 RLP23 "receptor like protein 23" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2086974 RLP41 "AT3G25010" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2074633 RLP35 "AT3G11080" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2825762 RLP6 "AT1G45616" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2119430 RLP47 "receptor like protein 47" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2829370 RLP40 "receptor like protein 40" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046585 RLP27 "receptor like protein 27" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2129246 RLP50 "receptor like protein 50" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00029123001
SubName- Full=Chromosome chr12 scaffold_47, whole genome shotgun sequence; (983 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query922
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-77
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-62
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 8e-23
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-19
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 5e-15
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-14
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-13
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 1e-10
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-10
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-07
PLN032101153 PLN03210, PLN03210, Resistant to P 2e-07
PLN032101153 PLN03210, PLN03210, Resistant to P 2e-07
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 6e-07
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 4e-06
pfam0826342 pfam08263, LRRNT_2, Leucine rich repeat N-terminal 1e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 6e-05
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 6e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 8e-05
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 1e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-04
PLN032101153 PLN03210, PLN03210, Resistant to P 2e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 3e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 4e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 7e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.002
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 0.003
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score =  272 bits (696), Expect = 2e-77
 Identities = 218/675 (32%), Positives = 328/675 (48%), Gaps = 101/675 (14%)

Query: 1   MQFVFSLIFFNFTISNFTSSMLSPLCHSYERSALLQFKESLTIIRKTSSYYIWDPCHPKT 60
           + F+   +F NF++            H+ E   LL FK S+            DP     
Sbjct: 12  LIFMLFFLFLNFSML-----------HAEELELLLSFKSSIN-----------DPLK-YL 48

Query: 61  ASWKPEEANIDCCLWDGVECNENTGHVIKLDLSNSCLQGFINSSSGLFKLVHLEWLDLAF 120
           ++W     + D CLW G+ CN N+  V+ +DLS   + G I  SS +F+L +++ ++L+ 
Sbjct: 49  SNWNS---SADVCLWQGITCN-NSSRVVSIDLSGKNISGKI--SSAIFRLPYIQTINLSN 102

Query: 121 NYFICSEIPPEIINLS-RLSYLNLSSAGFFGQIPSEILELSNLVSLDLSHNSYYNLIELK 179
           N  +   IP +I   S  L YLNLS+  F G IP     + NL +LDLS+N     I   
Sbjct: 103 NQ-LSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPRG--SIPNLETLDLSNNMLSGEIP-- 157

Query: 180 EPNLGNLVKKLTNLKELALGGVTISSPIPHSLANLSSLTLLSLSGCELRGRIPSLLGNLT 239
                N +   ++LK L LGG  +   IP+SL NL+SL  L+L+  +L G+IP  LG + 
Sbjct: 158 -----NDIGSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMK 212

Query: 240 KLMYLDLSFNNLLGELPTSIGNLDCLKRLDISWNELSGELPASIGNLASLEQLELSLNRF 299
            L ++ L +NNL GE+P  IG L  L  LD+ +N L+G +P+S+GNL +L+ L L  N+ 
Sbjct: 213 SLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQNKL 272

Query: 300 RGKTPHSMGNFTRLYWLSLASNDFSGELPASFGNLRSLEGLDISECKFSSQIPSSLRNLA 359
            G  P S+ +  +L  L L+ N  SGE+P     L++LE L +    F+ +IP +L +L 
Sbjct: 273 SGPIPPSIFSLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFTGKIPVALTSLP 332

Query: 360 QLKFLEFSHNNFSGPIDLDMFLVNFKHLEHLSLSSNRLSLFTKAIFNTSQKFNFVGLRSC 419
           +L+ L+   N FSG I  ++   N  +L  L LS+N L+                     
Sbjct: 333 RLQVLQLWSNKFSGEIPKNLGKHN--NLTVLDLSTNNLT--------------------- 369

Query: 420 NLNEFPNFLKNQHYLEVLDLSCNKIHGKVPKWLIEPSMQNFSYLNLSHNFLIGFYQHPMF 479
              E P  L +   L  L L  N + G++PK L   + ++   + L  N           
Sbjct: 370 --GEIPEGLCSSGNLFKLILFSNSLEGEIPKSL--GACRSLRRVRLQDN----------- 414

Query: 480 FPRNYDGFTLDLSYNYLQGPLPVPPPQTKHYL-VSNNSLTGKI--PFWICNSSNSLEILD 536
                  F+ +L   + + PL        ++L +SNN+L G+I    W      SL++L 
Sbjct: 415 ------SFSGELPSEFTKLPL-------VYFLDISNNNLQGRINSRKW---DMPSLQMLS 458

Query: 537 LSYNNLSGLLPQCLDNFSDHLSILDLQHNKFCGSIPQTFLSGRSLMMIDLSDNLLQGRIP 596
           L+ N   G LP      S  L  LDL  N+F G++P+   S   LM + LS+N L G IP
Sbjct: 459 LARNKFFGGLPDSFG--SKRLENLDLSRNQFSGAVPRKLGSLSELMQLKLSENKLSGEIP 516

Query: 597 RSLVNCSSLKFLDLGNNQISGTFPSWLGTLRELNVLILKSNKLHGMIREPNTGCGFPELR 656
             L +C  L  LDL +NQ+SG  P+    +  L+ L L  N+L G I   N G     L 
Sbjct: 517 DELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEI-PKNLG-NVESLV 574

Query: 657 IIDLSNNRFTGKLPS 671
            +++S+N   G LPS
Sbjct: 575 QVNISHNHLHGSLPS 589


Length = 968

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|219766 pfam08263, LRRNT_2, Leucine rich repeat N-terminal domain Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 922
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 100.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 100.0
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.97
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.96
KOG4237498 consensus Extracellular matrix protein slit, conta 99.92
PLN032101153 Resistant to P. syringae 6; Provisional 99.89
PLN032101153 Resistant to P. syringae 6; Provisional 99.88
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.87
KOG4237498 consensus Extracellular matrix protein slit, conta 99.87
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.86
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.8
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.77
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.74
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.72
PLN03150623 hypothetical protein; Provisional 99.64
KOG0617264 consensus Ras suppressor protein (contains leucine 99.57
KOG0617264 consensus Ras suppressor protein (contains leucine 99.55
PLN03150623 hypothetical protein; Provisional 99.44
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.1
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.09
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.08
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.07
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.06
KOG0532722 consensus Leucine-rich repeat (LRR) protein, conta 99.04
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.01
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.01
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.93
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.92
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.88
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.85
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.84
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.83
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.78
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.75
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.67
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.63
PF0826343 LRRNT_2: Leucine rich repeat N-terminal domain; In 98.58
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.52
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.43
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.41
KOG4341483 consensus F-box protein containing LRR [General fu 98.38
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.28
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.27
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.25
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.23
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.15
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.14
KOG4341483 consensus F-box protein containing LRR [General fu 98.03
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.78
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.78
PRK15386426 type III secretion protein GogB; Provisional 97.76
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.68
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.67
PRK15386426 type III secretion protein GogB; Provisional 97.57
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.52
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.49
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.18
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.68
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.68
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.63
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.57
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.47
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.43
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.05
KOG2123388 consensus Uncharacterized conserved protein [Funct 95.9
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.6
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.57
KOG4308478 consensus LRR-containing protein [Function unknown 93.87
KOG4308478 consensus LRR-containing protein [Function unknown 93.41
smart0037026 LRR Leucine-rich repeats, outliers. 88.96
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 88.96
KOG0473326 consensus Leucine-rich repeat protein [Function un 87.58
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 87.12
smart0037026 LRR Leucine-rich repeats, outliers. 87.12
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 85.68
KOG3864221 consensus Uncharacterized conserved protein [Funct 84.15
KOG3864221 consensus Uncharacterized conserved protein [Funct 83.49
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 83.09
KOG0473326 consensus Leucine-rich repeat protein [Function un 82.19
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 81.92
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=100.00  E-value=6.1e-73  Score=710.78  Aligned_cols=584  Identities=38%  Similarity=0.615  Sum_probs=420.4

Q ss_pred             CHHHHHHHHHHhhcCCcCCCCCcccccCCCCCCCCCCCCCCCCCCCccccceEecCCCCcEEEEECCCCCCCCcccCccc
Q 002435           27 HSYERSALLQFKESLTIIRKTSSYYIWDPCHPKTASWKPEEANIDCCLWDGVECNENTGHVIKLDLSNSCLQGFINSSSG  106 (922)
Q Consensus        27 ~~~~~~all~~k~~~~~~~~~~~~~~~~~~~~~~~~w~~~~~~~~~c~w~gv~c~~~~~~v~~L~L~~~~l~g~~~~~~~  106 (922)
                      +++|++||++||+++.++.+            .+.+|+.   ..+||.|+||+|++ .++|+.|+|+++.++|.++.  .
T Consensus        27 ~~~~~~~l~~~~~~~~~~~~------------~~~~w~~---~~~~c~w~gv~c~~-~~~v~~L~L~~~~i~~~~~~--~   88 (968)
T PLN00113         27 HAEELELLLSFKSSINDPLK------------YLSNWNS---SADVCLWQGITCNN-SSRVVSIDLSGKNISGKISS--A   88 (968)
T ss_pred             CHHHHHHHHHHHHhCCCCcc------------cCCCCCC---CCCCCcCcceecCC-CCcEEEEEecCCCccccCCh--H
Confidence            55899999999999975543            5789976   67899999999986 46999999999999987654  7


Q ss_pred             cccCCCCCeeeCCCCCCCCCCCCcccc-CCCCCCEEECCCCCCCCcCchhhcCCCCCCEEEcCCCCCCCcccccCCChhH
Q 002435          107 LFKLVHLEWLDLAFNYFICSEIPPEII-NLSRLSYLNLSSAGFFGQIPSEILELSNLVSLDLSHNSYYNLIELKEPNLGN  185 (922)
Q Consensus       107 l~~l~~L~~L~Ls~n~~~~~~~p~~l~-~l~~L~~L~Ls~n~l~~~~p~~l~~l~~L~~L~Ls~n~~~~~~~~~~~~l~~  185 (922)
                      +..+++|++|+|++|.+.+. +|..+. .+++|++|+|++|.+.+.+|.  +.+++|++|++++|.              
T Consensus        89 ~~~l~~L~~L~Ls~n~~~~~-ip~~~~~~l~~L~~L~Ls~n~l~~~~p~--~~l~~L~~L~Ls~n~--------------  151 (968)
T PLN00113         89 IFRLPYIQTINLSNNQLSGP-IPDDIFTTSSSLRYLNLSNNNFTGSIPR--GSIPNLETLDLSNNM--------------  151 (968)
T ss_pred             HhCCCCCCEEECCCCccCCc-CChHHhccCCCCCEEECcCCccccccCc--cccCCCCEEECcCCc--------------
Confidence            77788888888888877654 666544 777777777777777776664  345566666666554              


Q ss_pred             HHhcCCCCCEEEcCCCcCCCCCchhccCCCCCCEEeccCccCCccCccccCCCCCCCEEeCcCCCCCCCcccccCCCCCC
Q 002435          186 LVKKLTNLKELALGGVTISSPIPHSLANLSSLTLLSLSGCELRGRIPSLLGNLTKLMYLDLSFNNLLGELPTSIGNLDCL  265 (922)
Q Consensus       186 ~~~~l~~L~~L~L~~n~~~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~l~~l~~L  265 (922)
                                       +.+.+|..++++++|++|++++|.+.+.+|..++++++|++|++++|.+++.+|..++++++|
T Consensus       152 -----------------~~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L  214 (968)
T PLN00113        152 -----------------LSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSL  214 (968)
T ss_pred             -----------------ccccCChHHhcCCCCCEEECccCcccccCChhhhhCcCCCeeeccCCCCcCcCChHHcCcCCc
Confidence                             344445555555555555555555555555555555555555555555555555555555556


Q ss_pred             cEEEcccCCCCCCchhhhhCCCCCCEEEccCCCCCCCCcccccCCCCCcEEEeeccCCCCcccccccCCCCCceEecCCC
Q 002435          266 KRLDISWNELSGELPASIGNLASLEQLELSLNRFRGKTPHSMGNFTRLYWLSLASNDFSGELPASFGNLRSLEGLDISEC  345 (922)
Q Consensus       266 ~~L~L~~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n  345 (922)
                      ++|++++|.+++.+|..+.++++|++|++++|.+.+..|..++.+++|+.|++++|.+.+.+|..+.++++|++|++++|
T Consensus       215 ~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n  294 (968)
T PLN00113        215 KWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDN  294 (968)
T ss_pred             cEEECcCCccCCcCChhHhcCCCCCEEECcCceeccccChhHhCCCCCCEEECcCCeeeccCchhHhhccCcCEEECcCC
Confidence            66666655555555555555556666666555555555555555555555555555555555555555556666666666


Q ss_pred             ccCccCchhhcCCCCccEEEccCCCCcCccchhhhhhccCCcceEeCcCccccccccccccCCCCccEEEecCCCCCCCc
Q 002435          346 KFSSQIPSSLRNLAQLKFLEFSHNNFSGPIDLDMFLVNFKHLEHLSLSSNRLSLFTKAIFNTSQKFNFVGLRSCNLNEFP  425 (922)
Q Consensus       346 ~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~~~~L~~L~L~~~~l~~lp  425 (922)
                      .+.+.+|..+..+++|+.|++++|.+.+.++                                                 
T Consensus       295 ~l~~~~p~~~~~l~~L~~L~l~~n~~~~~~~-------------------------------------------------  325 (968)
T PLN00113        295 SLSGEIPELVIQLQNLEILHLFSNNFTGKIP-------------------------------------------------  325 (968)
T ss_pred             eeccCCChhHcCCCCCcEEECCCCccCCcCC-------------------------------------------------
Confidence            5555555555555555555555554443322                                                 


Q ss_pred             ccccCCCCccEEECcCCCCCCCCCccccccCCCCccEEEccCCccccccCCCCCCCCCCCCceEeccCccccCCCCCCCC
Q 002435          426 NFLKNQHYLEVLDLSCNKIHGKVPKWLIEPSMQNFSYLNLSHNFLIGFYQHPMFFPRNYDGFTLDLSYNYLQGPLPVPPP  505 (922)
Q Consensus       426 ~~l~~~~~L~~L~Ls~n~l~~~~p~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~~~~~~l~~L~ls~n~l~~~~~~~~~  505 (922)
                      ..+..+++|+.|++++|.+.+.+|..+.                                                    
T Consensus       326 ~~~~~l~~L~~L~L~~n~l~~~~p~~l~----------------------------------------------------  353 (968)
T PLN00113        326 VALTSLPRLQVLQLWSNKFSGEIPKNLG----------------------------------------------------  353 (968)
T ss_pred             hhHhcCCCCCEEECcCCCCcCcCChHHh----------------------------------------------------
Confidence            1122333444444444444443333322                                                    


Q ss_pred             CCceeeccCCcccCcCChhhhhcCCccceEEccCccCCCCCCchhhhccCcccEEEcCCCcccCCCcccccCCCCccEEe
Q 002435          506 QTKHYLVSNNSLTGKIPFWICNSSNSLEILDLSYNNLSGLLPQCLDNFSDHLSILDLQHNKFCGSIPQTFLSGRSLMMID  585 (922)
Q Consensus       506 ~l~~L~ls~n~l~~~ip~~~~~~~~~L~~L~Ls~N~l~~~~p~~l~~l~~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~  585 (922)
                                           . +++|+.|++++|++++.+|..+..+. +|+.|++++|++.+.+|..+..+++|+.|+
T Consensus       354 ---------------------~-~~~L~~L~Ls~n~l~~~~p~~~~~~~-~L~~L~l~~n~l~~~~p~~~~~~~~L~~L~  410 (968)
T PLN00113        354 ---------------------K-HNNLTVLDLSTNNLTGEIPEGLCSSG-NLFKLILFSNSLEGEIPKSLGACRSLRRVR  410 (968)
T ss_pred             ---------------------C-CCCCcEEECCCCeeEeeCChhHhCcC-CCCEEECcCCEecccCCHHHhCCCCCCEEE
Confidence                                 2 44566666666666666666666655 577777777777777777777777788888


Q ss_pred             cCCCcccccCCccccCCCCCcEEECCCCcCccCcchhhcCCCCCCEEEcCCCcccccCCCCCCCCCCCCccEEEccCCcC
Q 002435          586 LSDNLLQGRIPRSLVNCSSLKFLDLGNNQISGTFPSWLGTLRELNVLILKSNKLHGMIREPNTGCGFPELRIIDLSNNRF  665 (922)
Q Consensus       586 Ls~N~l~~~~~~~l~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~~~~~~~~~l~~L~~LdLs~N~l  665 (922)
                      +++|++++..|..+..++.|+.|++++|++++.+|..+..+++|+.|++++|++.+.+|...   ..++|+.||+++|++
T Consensus       411 L~~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~n~~~~~~p~~~---~~~~L~~L~ls~n~l  487 (968)
T PLN00113        411 LQDNSFSGELPSEFTKLPLVYFLDISNNNLQGRINSRKWDMPSLQMLSLARNKFFGGLPDSF---GSKRLENLDLSRNQF  487 (968)
T ss_pred             CcCCEeeeECChhHhcCCCCCEEECcCCcccCccChhhccCCCCcEEECcCceeeeecCccc---ccccceEEECcCCcc
Confidence            88888877777778888888888888888888888777788888888888888887777653   357899999999999


Q ss_pred             CCCCChhhhhccccceecccccccccccccccchhccccccceeeeeeeeeecccccccccccccceEEEeccccccccC
Q 002435          666 TGKLPSKYFQCWNAMQVVNTSELRYMEGMIYPFALVSYAALGIYDYSLTMSNKGQMMSYDKVPNFLTGVILSSNRFDGEI  745 (922)
Q Consensus       666 ~g~ip~~~~~~~~~l~~l~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~l~~L~Ls~N~l~g~i  745 (922)
                      ++.+|..+ ..                                                   .+.|+.|+|++|+++|.+
T Consensus       488 ~~~~~~~~-~~---------------------------------------------------l~~L~~L~Ls~N~l~~~~  515 (968)
T PLN00113        488 SGAVPRKL-GS---------------------------------------------------LSELMQLKLSENKLSGEI  515 (968)
T ss_pred             CCccChhh-hh---------------------------------------------------hhccCEEECcCCcceeeC
Confidence            98887541 11                                                   245788999999999999


Q ss_pred             cccccccCCCCEEeCCCccccccCCccccCCCCCCEEeCCCCcCcccCcccccCCCCCCeEeccCCccccCCCCCCCCCC
Q 002435          746 PTSIANLKGLQVLSLANNSLHGHILSCLGNLTGLESLDLSNNKFSGQIPQQLVDLTFLEFFNVSNNNLTGPIPQGNQFPT  825 (922)
Q Consensus       746 p~~~~~l~~L~~L~Ls~N~l~~~ip~~l~~L~~L~~L~Ls~N~l~g~ip~~l~~L~~L~~L~ls~N~lsg~iP~~~~~~~  825 (922)
                      |..++++++|++|+|++|.++|.+|..++++++|++|||++|+++|.+|..+.++++|++|++++|+++|.+|..++|.+
T Consensus       516 p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~l~ls~N~l~~~~p~~~~~~~  595 (968)
T PLN00113        516 PDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHLHGSLPSTGAFLA  595 (968)
T ss_pred             ChHHcCccCCCEEECCCCcccccCChhHhCcccCCEEECCCCcccccCChhHhcCcccCEEeccCCcceeeCCCcchhcc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCccccCCCcCCCCCC
Q 002435          826 FDKTSFNGNLGLCGKP  841 (922)
Q Consensus       826 ~~~~s~~gn~~lcg~~  841 (922)
                      +...+|.||+++||.+
T Consensus       596 ~~~~~~~~n~~lc~~~  611 (968)
T PLN00113        596 INASAVAGNIDLCGGD  611 (968)
T ss_pred             cChhhhcCCccccCCc
Confidence            9999999999999864



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query922
3rgx_A768 Structural Insight Into Brassinosteroid Perception 1e-44
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 1e-44
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 3e-19
3fxi_A605 Crystal Structure Of The Human Tlr4-Human Md-2-E.Co 3e-07
2z66_A306 Crystal Structure Of The Vt3 Hybrid Of Human Tlr4 A 5e-07
2z66_A306 Crystal Structure Of The Vt3 Hybrid Of Human Tlr4 A 8e-04
4g8a_A635 Crystal Structure Of Human Tlr4 Polymorphic Variant 9e-07
4g8a_A635 Crystal Structure Of Human Tlr4 Polymorphic Variant 6e-04
3t6q_A606 Crystal Structure Of Mouse Rp105MD-1 Complex Length 1e-05
3rg1_A612 Crystal Structure Of The Rp105MD-1 Complex Length = 2e-05
1xku_A330 Crystal Structure Of The Dimeric Protein Core Of De 4e-05
3b2d_A603 Crystal Structure Of Human Rp105MD-1 Complex Length 4e-05
3b2d_A 603 Crystal Structure Of Human Rp105MD-1 Complex Length 1e-04
1xcd_A329 Dimeric Bovine Tissue-Extracted Decorin, Crystal Fo 5e-05
2z63_A570 Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 A 1e-04
4eco_A636 Crystal Structure Of A Hypothetical Protein (Bacegg 2e-04
3j0a_A 844 Homology Model Of Human Toll-Like Receptor 5 Fitted 2e-04
3ul7_A278 Crystal Structure Of The Tv3 Mutant F63w Length = 2 3e-04
3ula_A279 Crystal Structure Of The Tv3 Mutant F63w-Md-2-Erito 4e-04
1sq0_B288 Crystal Structure Of The Complex Of The Wild-Type V 4e-04
2omv_A461 Crystal Structure Of Inla S192n Y369s/hec1 Complex 6e-04
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure

Iteration: 1

Score = 178 bits (452), Expect = 1e-44, Method: Compositional matrix adjust. Identities = 198/695 (28%), Positives = 295/695 (42%), Gaps = 117/695 (16%) Query: 227 LRGRIPSL--LGNLTKLMYLDLSFNNLLGELPTSIGN---LDCLKRLDISWNELSGELPA 281 L G + +L LG+ + L +L++S N L + P + L+ L+ LD+S N +SG Sbjct: 112 LSGPVTTLTSLGSCSGLKFLNVSSNTL--DFPGKVSGGLKLNSLEVLDLSANSISGA--N 167 Query: 282 SIG-----NLASLEQLELSLNRFRGKTPHSMGNFTRLYWLSLASNDFSGELPASFGNLRS 336 +G L+ L +S N+ G + L +L ++SN+FS +P G+ + Sbjct: 168 VVGWVLSDGCGELKHLAISGNKISGDV--DVSRCVNLEFLDVSSNNFSTGIPF-LGDCSA 224 Query: 337 LEGLDISECKFSSQIPSSLRNLAQLKFLEFSHNNFSGPIDLDMFLVNFKHLEHLSLSSNR 396 L+ LDIS K S ++ +LK L S N F GPI + K L++LSL+ N+ Sbjct: 225 LQHLDISGNKLSGDFSRAISTCTELKLLNISSNQFVGPIPP----LPLKSLQYLSLAENK 280 Query: 397 LSLFTKAIFNTSQKFNFVGLRSCNLNEFPNFLKNQ-HYLEVLDLSCNKIHGKVPKWLIEP 455 F G E P+FL L LDLS N +G VP + Sbjct: 281 ----------------FTG-------EIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSC 317 Query: 456 -----------------------SMQNFSYLNLSHNFLIGFYQHPMFFPRNYDG--FTLD 490 M+ L+LS N G + N TLD Sbjct: 318 SLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESL---TNLSASLLTLD 374 Query: 491 LSYNYLQGPL-----PVPPPQTKHYLVSNNSLTGKIPFWICNSSNSLEILDLSYNNLSGL 545 LS N GP+ P + + NN TGKIP + N S L L LS+N LSG Sbjct: 375 LSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCS-ELVSLHLSFNYLSGT 433 Query: 546 LPQCLDNFSDHLSILDLQHNKFCGSIPQTFLSGRSLMMIDLSDNLLQGRIPRSLVNCSSL 605 +P L + S L L L N G IPQ + ++L + L N L G IP L NC++L Sbjct: 434 IPSSLGSLS-KLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNL 492 Query: 606 KFLDLGNNQISGTFPSWLGTLRELNVLILKSNKLHGMIREPNTGCGFPELRIIDLSNNRF 665 ++ L NN+++G P W+G L L +L L +N G I C L +DL+ N F Sbjct: 493 NWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDC--RSLIWLDLNTNLF 550 Query: 666 TGKLPSKYFQCWNAMQVVNTSELRYMEGMIYPFALVSYAALGIYDYSLTMSNKGQMMSYD 725 G +P+ F+ + + RY+ + A + ++ S + +S Sbjct: 551 NGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTR 610 Query: 726 KVPNFLTGVILSSNRFDGEIPTSIANLKGLQVLSLANNSLHGHILSCLGNLTGLESLDLS 785 N ++S + G + N + L ++ N L G+I +G++ L L+L Sbjct: 611 NPCN------ITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLG 664 Query: 786 NNKFSGQIPQQLVDLTFLEFFNVSNNNLT------------------------GPIPQGN 821 +N SG IP ++ DL L ++S+N L GPIP+ Sbjct: 665 HNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEMG 724 Query: 822 QFPTFDKTSFNGNLGLCGKPLPKECENDEAPTNED 856 QF TF F N GLCG PLP+ C+ P+N D Sbjct: 725 QFETFPPAKFLNNPGLCGYPLPR-CD----PSNAD 754
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|3FXI|A Chain A, Crystal Structure Of The Human Tlr4-Human Md-2-E.Coli Lps Ra Complex Length = 605 Back     alignment and structure
>pdb|2Z66|A Chain A, Crystal Structure Of The Vt3 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 306 Back     alignment and structure
>pdb|2Z66|A Chain A, Crystal Structure Of The Vt3 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 306 Back     alignment and structure
>pdb|4G8A|A Chain A, Crystal Structure Of Human Tlr4 Polymorphic Variant D299g And T399i In Complex With Md-2 And Lps Length = 635 Back     alignment and structure
>pdb|4G8A|A Chain A, Crystal Structure Of Human Tlr4 Polymorphic Variant D299g And T399i In Complex With Md-2 And Lps Length = 635 Back     alignment and structure
>pdb|3T6Q|A Chain A, Crystal Structure Of Mouse Rp105MD-1 Complex Length = 606 Back     alignment and structure
>pdb|3RG1|A Chain A, Crystal Structure Of The Rp105MD-1 Complex Length = 612 Back     alignment and structure
>pdb|1XKU|A Chain A, Crystal Structure Of The Dimeric Protein Core Of Decorin, The Archetypal Small Leucine-Rich Repeat Proteoglycan Length = 330 Back     alignment and structure
>pdb|3B2D|A Chain A, Crystal Structure Of Human Rp105MD-1 Complex Length = 603 Back     alignment and structure
>pdb|3B2D|A Chain A, Crystal Structure Of Human Rp105MD-1 Complex Length = 603 Back     alignment and structure
>pdb|1XCD|A Chain A, Dimeric Bovine Tissue-Extracted Decorin, Crystal Form 1 Length = 329 Back     alignment and structure
>pdb|2Z63|A Chain A, Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 570 Back     alignment and structure
>pdb|4ECO|A Chain A, Crystal Structure Of A Hypothetical Protein (Bacegg_03329) From Bacteroides Eggerthii Dsm 20697 At 2.70 A Resolution Length = 636 Back     alignment and structure
>pdb|3J0A|A Chain A, Homology Model Of Human Toll-Like Receptor 5 Fitted Into An Electron Microscopy Single Particle Reconstruction Length = 844 Back     alignment and structure
>pdb|3UL7|A Chain A, Crystal Structure Of The Tv3 Mutant F63w Length = 278 Back     alignment and structure
>pdb|3ULA|A Chain A, Crystal Structure Of The Tv3 Mutant F63w-Md-2-Eritoran Complex Length = 279 Back     alignment and structure
>pdb|1SQ0|B Chain B, Crystal Structure Of The Complex Of The Wild-Type Von Willebrand Factor A1 Domain And Glycoprotein Ib Alpha At 2.6 Angstrom Resolution Length = 288 Back     alignment and structure
>pdb|2OMV|A Chain A, Crystal Structure Of Inla S192n Y369s/hec1 Complex Length = 461 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query922
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 0.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-100
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-83
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-55
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-28
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-79
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-77
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-69
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-66
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-56
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-53
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-41
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-34
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-31
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 7e-78
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 8e-75
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-58
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-52
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-51
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-38
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 4e-30
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-29
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-23
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-08
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-75
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 7e-63
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-43
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 6e-31
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-24
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-19
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 9e-69
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-61
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 8e-56
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-49
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-46
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-21
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-67
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 9e-67
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-62
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-62
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-60
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 6e-41
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-24
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-24
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-10
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-10
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-67
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-60
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-35
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-31
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-21
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-11
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-10
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-06
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-55
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-46
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-32
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-30
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-30
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-20
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-20
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-04
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-51
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-47
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-45
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-21
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-45
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-42
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 8e-42
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-37
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-27
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-22
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-15
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-14
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-14
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-07
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-41
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-41
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-31
1o6v_A466 Internalin A; bacterial infection, extracellular r 9e-30
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-27
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-21
1o6v_A 466 Internalin A; bacterial infection, extracellular r 7e-07
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 8e-41
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-38
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-35
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-30
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 8e-23
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-21
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-20
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-19
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-17
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-14
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-08
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-08
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-04
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-39
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-34
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-32
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-18
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 8e-13
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-11
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 3e-10
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-36
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-32
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-32
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-25
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-17
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-16
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-15
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-10
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-07
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-36
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-36
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-34
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-31
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-22
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-22
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-21
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-20
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-10
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-35
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-31
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-28
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-28
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-24
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 9e-24
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-17
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-17
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-34
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-33
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-32
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-31
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-26
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-17
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-16
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-15
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-12
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-11
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-11
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-10
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-10
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-07
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 5e-33
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 8e-29
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-27
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 5e-07
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-33
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-32
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-30
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-29
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 8e-29
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-27
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-22
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 6e-18
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 8e-12
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-10
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-31
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-30
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-29
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-29
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 8e-19
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-18
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-15
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-11
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-31
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-29
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-29
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-29
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-28
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-24
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-23
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-21
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 8e-20
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-07
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-06
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-28
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-27
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-24
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-20
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 9e-20
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-19
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-19
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-17
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-05
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-26
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-25
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-21
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 7e-19
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-18
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 9e-12
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-10
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 1e-06
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-25
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-24
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-20
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-19
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-16
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-14
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-24
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-20
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-18
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-16
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-12
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 6e-04
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-24
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-21
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-20
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-15
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-15
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-14
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-12
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-11
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 8e-24
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-23
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-18
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-16
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 5e-16
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-12
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 5e-12
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 2e-04
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 8e-24
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-22
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 7e-22
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-19
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-18
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-17
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 9e-17
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-15
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-12
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 4e-04
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 1e-23
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-21
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 1e-20
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 9e-19
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-18
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 7e-16
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 7e-23
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-20
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-12
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-22
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-21
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-19
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-18
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-18
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-18
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-16
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-16
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-14
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-09
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-05
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 7e-21
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-18
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-17
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-15
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-12
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-11
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-08
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 9e-21
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-15
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 7e-14
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-13
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-11
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-09
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-04
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 7e-04
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-20
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 5e-14
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 6e-14
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-12
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-07
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-06
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-19
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-17
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-16
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-16
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-14
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-09
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-09
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-07
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 7e-07
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-19
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-19
4ezg_A197 Putative uncharacterized protein; internalin-A, le 7e-17
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-14
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-14
4ezg_A197 Putative uncharacterized protein; internalin-A, le 8e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 9e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-04
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 1e-18
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 5e-18
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 1e-16
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 1e-15
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 5e-12
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 5e-11
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 3e-09
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-08
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-07
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 5e-17
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-16
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-16
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-16
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-16
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 8e-14
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-09
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 5e-05
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-15
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-15
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 7e-12
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-06
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 6e-06
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 5e-05
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-15
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-15
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-11
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 6e-10
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-09
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-08
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-08
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 6e-08
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-06
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-14
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-12
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 7e-12
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 8e-11
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-06
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-04
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-13
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-10
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 6e-10
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 8e-10
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 8e-08
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 5e-07
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-04
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-04
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 7e-13
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-12
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 6e-12
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 7e-12
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-06
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-05
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 9e-13
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 5e-12
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 8e-12
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-08
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-05
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-05
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-04
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 5e-04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-12
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-11
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-09
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-09
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-12
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-11
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-10
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-06
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-05
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 4e-12
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 4e-11
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-09
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-09
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 4e-08
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-06
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 9e-12
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 8e-10
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 4e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-06
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 7e-11
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 8e-08
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 9e-10
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 4e-09
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-08
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-06
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-05
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 1e-09
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 3e-09
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-08
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-08
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-07
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-04
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 4e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 4e-09
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 5e-09
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 2e-08
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 3e-06
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 2e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 7e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-08
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 7e-08
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 7e-08
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 6e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 6e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 7e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-05
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 3e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 7e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 5e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 5e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 4e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 9e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 4e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 5e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-04
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 4e-06
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-05
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-04
3m19_A251 Variable lymphocyte receptor A diversity region; a 5e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-04
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 3e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  612 bits (1581), Expect = 0.0
 Identities = 236/866 (27%), Positives = 353/866 (40%), Gaps = 132/866 (15%)

Query: 18  TSSMLSPLCHSYERSALLQFKESLTIIRKTSSYYIWDPCHPKTASWKPEEANIDCCLWDG 77
           +           E   L+ FK+ L                     W     N + C +DG
Sbjct: 1   SFQASPSQSLYREIHQLISFKDVLPD-------------KNLLPDWSS---NKNPCTFDG 44

Query: 78  VECNENTGHVIKLDLSNSCLQGFINS-SSGLFKLVHLEWLDLAFNYFICSEIPPEIINLS 136
           V C      V  +DLS+  L    ++ SS L  L  LE L L+ ++   +         +
Sbjct: 45  VTCR--DDKVTSIDLSSKPLNVGFSAVSSSLLSLTGLESLFLSNSHI--NGSVSGFKCSA 100

Query: 137 RLSYLNLSSAGFFGQIPS--EILELSNLVSLDLSHNSYYNLIELKEPNLGNLVKKLTNLK 194
            L+ L+LS     G + +   +   S L  L++S N+     ++      +   KL +L+
Sbjct: 101 SLTSLDLSRNSLSGPVTTLTSLGSCSGLKFLNVSSNTLDFPGKV------SGGLKLNSLE 154

Query: 195 ELALGGVTISSPIPHSLA---NLSSLTLLSLSGCELRGRIPSLLGNLTKLMYLDLSFNNL 251
            L L   +IS               L  L++SG ++ G +   +     L +LD+S NN 
Sbjct: 155 VLDLSANSISGANVVGWVLSDGCGELKHLAISGNKISGDVD--VSRCVNLEFLDVSSNNF 212

Query: 252 LGELPTSIGNLDCLKRLDISWNELSGELPASIGNLASLEQLELSLNRFRGKTPHSMGNFT 311
              +P  +G+   L+ LDIS N+LSG+   +I     L+ L +S N+F G  P       
Sbjct: 213 STGIP-FLGDCSALQHLDISGNKLSGDFSRAISTCTELKLLNISSNQFVGPIPPL--PLK 269

Query: 312 RLYWLSLASNDFSGELPAS-FGNLRSLEGLDISECKFSSQIPSSLRNLAQLKFLEFSHNN 370
            L +LSLA N F+GE+P    G   +L GLD+S   F   +P    + + L+ L  S NN
Sbjct: 270 SLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNN 329

Query: 371 FSGPIDLDMFLVNFKHLEHLSLSSNRLS-LFTKAIFNTSQKFNFVGLRSCNLNEFPNFLK 429
           FSG + +D  L+  + L+ L LS N  S    +++ N S                     
Sbjct: 330 FSGELPMD-TLLKMRGLKVLDLSFNEFSGELPESLTNLSAS------------------- 369

Query: 430 NQHYLEVLDLSCNKIHGKVPKWLIEPSMQNFSYLNLSHNFLIGFYQHPMFFPRNYDGFTL 489
               L  LDLS N   G +   L +        L L                        
Sbjct: 370 ----LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQ----------------------- 402

Query: 490 DLSYNYLQGPLPVPPPQTKHYLVSNNSLTGKIPFWICNSSNSLEILDLSYNNLSGLLPQC 549
                                   NN  TGKIP  + N S  L  L LS+N LSG +P  
Sbjct: 403 ------------------------NNGFTGKIPPTLSNCSE-LVSLHLSFNYLSGTIPSS 437

Query: 550 LDNFSDHLSILDLQHNKFCGSIPQTFLSGRSLMMIDLSDNLLQGRIPRSLVNCSSLKFLD 609
           L + S  L  L L  N   G IPQ  +  ++L  + L  N L G IP  L NC++L ++ 
Sbjct: 438 LGSLS-KLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWIS 496

Query: 610 LGNNQISGTFPSWLGTLRELNVLILKSNKLHGMIREPNTGCGFPELRIIDLSNNRFTGKL 669
           L NN+++G  P W+G L  L +L L +N   G I  P        L  +DL+ N F G +
Sbjct: 497 LSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNI--PAELGDCRSLIWLDLNTNLFNGTI 554

Query: 670 PSKYFQCWNAMQVVNTSELRYMEGMIYPFALVSYAALGIYDYS----LTMSNKGQMMSYD 725
           P+  F+    +     +  RY+           + A  + ++       ++        +
Sbjct: 555 PAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCN 614

Query: 726 KVPNFLTGVI--------------LSSNRFDGEIPTSIANLKGLQVLSLANNSLHGHILS 771
                  G                +S N   G IP  I ++  L +L+L +N + G I  
Sbjct: 615 ITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPD 674

Query: 772 CLGNLTGLESLDLSNNKFSGQIPQQLVDLTFLEFFNVSNNNLTGPIPQGNQFPTFDKTSF 831
            +G+L GL  LDLS+NK  G+IPQ +  LT L   ++SNNNL+GPIP+  QF TF    F
Sbjct: 675 EVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEMGQFETFPPAKF 734

Query: 832 NGNLGLCGKPLPKECENDEAPTNEDQ 857
             N GLCG PLP+   ++       Q
Sbjct: 735 LNNPGLCGYPLPRCDPSNADGYAHHQ 760


>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query922
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.98
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.98
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.97
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.97
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.97
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.96
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.96
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.96
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.96
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.96
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.96
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.95
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.95
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.95
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.95
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.95
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.95
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.95
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.95
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.94
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.94
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.94
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.94
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.94
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.93
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.93
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.93
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.93
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.93
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.92
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.92
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.92
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.91
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.91
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.91
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.91
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.9
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.89
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.89
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.88
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.88
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.88
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.88
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.87
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.87
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.87
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.86
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.86
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.86
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.86
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.85
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.85
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.85
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.84
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.84
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.83
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.82
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.82
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.82
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.79
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.78
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.78
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.78
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.76
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.75
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.74
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.74
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.73
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.73
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.73
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.71
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.71
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.71
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.71
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.7
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.7
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.69
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.69
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.67
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.67
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.67
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.66
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.66
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.66
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.62
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.58
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.57
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.55
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.55
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.54
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.54
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.53
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.51
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.5
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.46
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.44
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.43
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.42
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.41
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.4
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.4
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.39
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.39
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.38
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.35
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.34
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.2
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.17
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.17
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.16
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.14
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.08
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.77
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.73
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.72
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.7
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.54
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.36
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.34
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.34
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.79
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.76
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.98
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.94
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.84
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.64
2ks1_B44 Epidermal growth factor receptor; ERBB1, ERBB2, tr 81.93
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=3e-91  Score=853.37  Aligned_cols=710  Identities=31%  Similarity=0.430  Sum_probs=550.5

Q ss_pred             CCCCHHHHHHHHHHhhcCCcCCCCCcccccCCCCCCCCCCCCCCCCCCCccccceEecCCCCcEEEEECCCCCCCCc---
Q 002435           24 PLCHSYERSALLQFKESLTIIRKTSSYYIWDPCHPKTASWKPEEANIDCCLWDGVECNENTGHVIKLDLSNSCLQGF---  100 (922)
Q Consensus        24 ~~~~~~~~~all~~k~~~~~~~~~~~~~~~~~~~~~~~~w~~~~~~~~~c~w~gv~c~~~~~~v~~L~L~~~~l~g~---  100 (922)
                      +.+.++|++||++||+++.++.             .+++|+.   +++||.|+||+|+  .++|++|+|+++.+.|.   
T Consensus         7 ~~~~~~~~~all~~k~~~~~~~-------------~l~~W~~---~~~~C~w~gv~C~--~~~v~~L~L~~~~l~g~~~~   68 (768)
T 3rgz_A            7 SQSLYREIHQLISFKDVLPDKN-------------LLPDWSS---NKNPCTFDGVTCR--DDKVTSIDLSSKPLNVGFSA   68 (768)
T ss_dssp             -CCHHHHHHHHHHHHTTCSCTT-------------SSTTCCT---TSCGGGSTTEEEE--TTEEEEEECTTSCCCEEHHH
T ss_pred             ccCCHHHHHHHHHHHhhCCCcc-------------cccCCCC---CCCCcCCcceEEC--CCcEEEEECCCCCcCCccCc
Confidence            3467899999999999998542             5789986   6899999999998  58999999999999997   


Q ss_pred             ccCccccccCCCCCeeeCCCCCCCCCCCCccccCCCCCCEEECCCCCCCCcCch--hhcCCCCCCEEEcCCCCCCCcccc
Q 002435          101 INSSSGLFKLVHLEWLDLAFNYFICSEIPPEIINLSRLSYLNLSSAGFFGQIPS--EILELSNLVSLDLSHNSYYNLIEL  178 (922)
Q Consensus       101 ~~~~~~l~~l~~L~~L~Ls~n~~~~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~--~l~~l~~L~~L~Ls~n~~~~~~~~  178 (922)
                      +++  .+.++++|+.++++.+.+.  .+|+.++++++|++|||++|.+.|.+|.  .++++++|++|++++|.+.     
T Consensus        69 l~~--~l~~L~~L~~l~~~~~~~~--~l~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~l~~l~~L~~L~Ls~n~l~-----  139 (768)
T 3rgz_A           69 VSS--SLLSLTGLESLFLSNSHIN--GSVSGFKCSASLTSLDLSRNSLSGPVTTLTSLGSCSGLKFLNVSSNTLD-----  139 (768)
T ss_dssp             HHH--HTTTCTTCCEEECTTSCEE--ECCCCCCCCTTCCEEECCSSEEEEEGGGGGGGGGCTTCCEEECCSSEEE-----
T ss_pred             cCh--hHhccCcccccCCcCCCcC--CCchhhccCCCCCEEECCCCcCCCcCCChHHHhCCCCCCEEECcCCccC-----
Confidence            665  8899999999999999873  3678899999999999999999999998  9999999999999999743     


Q ss_pred             cCCChhHH-HhcCCCCCEEEcCCCcCCCCCchh---ccCCCCCCEEeccCccCCccCccccCCCCCCCEEeCcCCCCCCC
Q 002435          179 KEPNLGNL-VKKLTNLKELALGGVTISSPIPHS---LANLSSLTLLSLSGCELRGRIPSLLGNLTKLMYLDLSFNNLLGE  254 (922)
Q Consensus       179 ~~~~l~~~-~~~l~~L~~L~L~~n~~~~~~~~~---l~~l~~L~~L~Ls~n~l~~~~~~~l~~l~~L~~L~Ls~n~l~~~  254 (922)
                        +.+|.. +.++++|++|++++|.+++..+..   +.++++|++|++++|.+.+..+.  ..+++|++|++++|.+++.
T Consensus       140 --~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~--~~l~~L~~L~Ls~n~l~~~  215 (768)
T 3rgz_A          140 --FPGKVSGGLKLNSLEVLDLSANSISGANVVGWVLSDGCGELKHLAISGNKISGDVDV--SRCVNLEFLDVSSNNFSTG  215 (768)
T ss_dssp             --CCSSCCSCCCCTTCSEEECCSSCCEEETHHHHHHTTCCTTCCEEECCSSEEESCCBC--TTCTTCCEEECCSSCCCSC
T ss_pred             --CcCCHHHhccCCCCCEEECCCCccCCcCChhhhhhccCCCCCEEECCCCcccccCCc--ccCCcCCEEECcCCcCCCC
Confidence              223332 378999999999999999988877   88999999999999999877654  8899999999999999988


Q ss_pred             cccccCCCCCCcEEEcccCCCCCCchhhhhCCCCCCEEEccCCCCCCCCcccccCCCCCcEEEeeccCCCCcccccccCC
Q 002435          255 LPTSIGNLDCLKRLDISWNELSGELPASIGNLASLEQLELSLNRFRGKTPHSMGNFTRLYWLSLASNDFSGELPASFGNL  334 (922)
Q Consensus       255 ~~~~l~~l~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l  334 (922)
                      +|. ++++++|++|++++|.+++.+|..+.++++|++|++++|.+.+..|..  .+++|++|++++|.+++.+|..+...
T Consensus       216 ~~~-l~~l~~L~~L~Ls~n~l~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~--~l~~L~~L~L~~n~l~~~ip~~~~~~  292 (768)
T 3rgz_A          216 IPF-LGDCSALQHLDISGNKLSGDFSRAISTCTELKLLNISSNQFVGPIPPL--PLKSLQYLSLAENKFTGEIPDFLSGA  292 (768)
T ss_dssp             CCB-CTTCCSCCEEECCSSCCCSCHHHHTTTCSSCCEEECCSSCCEESCCCC--CCTTCCEEECCSSEEEESCCCCSCTT
T ss_pred             Ccc-cccCCCCCEEECcCCcCCCcccHHHhcCCCCCEEECCCCcccCccCcc--ccCCCCEEECcCCccCCccCHHHHhh
Confidence            877 999999999999999999999999999999999999999999877765  88999999999999998999888775


Q ss_pred             -CCCceEecCCCccCccCchhhcCCCCccEEEccCCCCcCccchhhhhhccCCcceEeCcCccccccccccccCCC-Ccc
Q 002435          335 -RSLEGLDISECKFSSQIPSSLRNLAQLKFLEFSHNNFSGPIDLDMFLVNFKHLEHLSLSSNRLSLFTKAIFNTSQ-KFN  412 (922)
Q Consensus       335 -~~L~~L~Ls~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~~~-~L~  412 (922)
                       ++|++|++++|++++.+|..++.+++|++|++++|.+.+.++...+ ..+++|++|++++|.+++..+..+..++ +|+
T Consensus       293 ~~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~ip~~~l-~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~~L~  371 (768)
T 3rgz_A          293 CDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGELPMDTL-LKMRGLKVLDLSFNEFSGELPESLTNLSASLL  371 (768)
T ss_dssp             CTTCSEEECCSSEEEECCCGGGGGCTTCCEEECCSSEEEEECCHHHH-TTCTTCCEEECCSSEEEECCCTTHHHHTTTCS
T ss_pred             cCcCCEEECcCCcCCCccchHHhcCCCccEEECCCCcccCcCCHHHH-hcCCCCCEEeCcCCccCccccHHHHhhhcCCc
Confidence             9999999999999999999999999999999999999988887655 7888899999998888765544444443 555


Q ss_pred             EEEecCCCCC-CCcccccC--CCCccEEECcCCCCCCCCCccccccCCCCccEEEccCCccccccCCCCCCCCCCCCceE
Q 002435          413 FVGLRSCNLN-EFPNFLKN--QHYLEVLDLSCNKIHGKVPKWLIEPSMQNFSYLNLSHNFLIGFYQHPMFFPRNYDGFTL  489 (922)
Q Consensus       413 ~L~L~~~~l~-~lp~~l~~--~~~L~~L~Ls~n~l~~~~p~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~~~~~~l~~L  489 (922)
                      .|++++|.++ .+|..+..  +++|++|++++|++++.+|..+.  .+++|++|++                        
T Consensus       372 ~L~Ls~N~l~~~~~~~~~~~~~~~L~~L~L~~n~l~~~~p~~l~--~l~~L~~L~L------------------------  425 (768)
T 3rgz_A          372 TLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLS--NCSELVSLHL------------------------  425 (768)
T ss_dssp             EEECCSSEEEEECCTTTTCSTTCCCCEEECCSSEEEEECCGGGG--GCTTCCEEEC------------------------
T ss_pred             EEEccCCCcCCCcChhhhhcccCCccEEECCCCccccccCHHHh--cCCCCCEEEC------------------------
Confidence            5555555554 34444333  44555555555555555555544  4444444444                        


Q ss_pred             eccCccccCCCCCCCCCCceeeccCCcccCcCChhhhhcCCccceEEccCccCCCCCCchhhhccCcccEEEcCCCcccC
Q 002435          490 DLSYNYLQGPLPVPPPQTKHYLVSNNSLTGKIPFWICNSSNSLEILDLSYNNLSGLLPQCLDNFSDHLSILDLQHNKFCG  569 (922)
Q Consensus       490 ~ls~n~l~~~~~~~~~~l~~L~ls~n~l~~~ip~~~~~~~~~L~~L~Ls~N~l~~~~p~~l~~l~~~L~~L~Ls~N~l~~  569 (922)
                                             ++|.+++.+|..+.. +++|+.|++++|.+++.+|..+..++ +|++|++++|++++
T Consensus       426 -----------------------s~N~l~~~~p~~l~~-l~~L~~L~L~~n~l~~~~p~~~~~l~-~L~~L~L~~N~l~~  480 (768)
T 3rgz_A          426 -----------------------SFNYLSGTIPSSLGS-LSKLRDLKLWLNMLEGEIPQELMYVK-TLETLILDFNDLTG  480 (768)
T ss_dssp             -----------------------CSSEEESCCCGGGGG-CTTCCEEECCSSCCCSCCCGGGGGCT-TCCEEECCSSCCCS
T ss_pred             -----------------------cCCcccCcccHHHhc-CCCCCEEECCCCcccCcCCHHHcCCC-CceEEEecCCcccC
Confidence                                   444444455555555 66677777777777666666666665 57777777777766


Q ss_pred             CCcccccCCCCccEEecCCCcccccCCccccCCCCCcEEECCCCcCccCcchhhcCCCCCCEEEcCCCcccccCCCCCCC
Q 002435          570 SIPQTFLSGRSLMMIDLSDNLLQGRIPRSLVNCSSLKFLDLGNNQISGTFPSWLGTLRELNVLILKSNKLHGMIREPNTG  649 (922)
Q Consensus       570 ~~p~~~~~l~~L~~L~Ls~N~l~~~~~~~l~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~~~~~~~  649 (922)
                      .+|..+..+++|++|++++|++++.+|.++..+++|++|+|++|++++.+|..++.+++|++|++++|++.|.+|...  
T Consensus       481 ~~p~~l~~l~~L~~L~L~~N~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~g~ip~~~--  558 (768)
T 3rgz_A          481 EIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAM--  558 (768)
T ss_dssp             CCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEEECCGGGGGCTTCCEEECCSSEEESBCCGGG--
T ss_pred             cCCHHHhcCCCCCEEEccCCccCCcCChHHhcCCCCCEEECCCCcccCcCCHHHcCCCCCCEEECCCCccCCcCChHH--
Confidence            666666667777777777777766666666667777777777777766667667777777777777777766666543  


Q ss_pred             CCCCCccE---------EEccCCc-------------CCCCCChhhhhccccceecccccccccccccccchhccccccc
Q 002435          650 CGFPELRI---------IDLSNNR-------------FTGKLPSKYFQCWNAMQVVNTSELRYMEGMIYPFALVSYAALG  707 (922)
Q Consensus       650 ~~l~~L~~---------LdLs~N~-------------l~g~ip~~~~~~~~~l~~l~~~~~~~~~~~~~~~~~~~~~~l~  707 (922)
                      .....+..         ..+.++.             +.|..|.. +..+..+..+++....+.                
T Consensus       559 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~l~~~~~~~l~~~~~~----------------  621 (768)
T 3rgz_A          559 FKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQ-LNRLSTRNPCNITSRVYG----------------  621 (768)
T ss_dssp             GTTTTCBCCSTTCSCEEEEEECCSCCTTCCSSEEEEECTTCCGGG-GGGGGGTCCSCTTSCEEE----------------
T ss_pred             hcccchhhhhccccccccccccccccccccccccccccccccchh-hhccccccccccccceec----------------
Confidence            12222222         2222221             12222211 111111111111111000                


Q ss_pred             eeeeeeeeeecccccccccccccceEEEeccccccccCcccccccCCCCEEeCCCccccccCCccccCCCCCCEEeCCCC
Q 002435          708 IYDYSLTMSNKGQMMSYDKVPNFLTGVILSSNRFDGEIPTSIANLKGLQVLSLANNSLHGHILSCLGNLTGLESLDLSNN  787 (922)
Q Consensus       708 ~~~~~~~~~~~~~~~~~~~~~~~l~~L~Ls~N~l~g~ip~~~~~l~~L~~L~Ls~N~l~~~ip~~l~~L~~L~~L~Ls~N  787 (922)
                                 +.........+.++.|||++|+++|.+|.+|+++++|+.|||++|+++|.||+.|+++++|++||||+|
T Consensus       622 -----------g~~~~~~~~l~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~Ls~N~l~g~ip~~l~~L~~L~~LdLs~N  690 (768)
T 3rgz_A          622 -----------GHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSN  690 (768)
T ss_dssp             -----------EECCCSCSSSBCCCEEECCSSCCBSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSS
T ss_pred             -----------ccCchhhhccccccEEECcCCcccccCCHHHhccccCCEEeCcCCccCCCCChHHhCCCCCCEEECCCC
Confidence                       011111122467999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCcccCcccccCCCCCCeEeccCCccccCCCCCCCCCCCCccccCCCcCCCCCCCCCCCCCCC
Q 002435          788 KFSGQIPQQLVDLTFLEFFNVSNNNLTGPIPQGNQFPTFDKTSFNGNLGLCGKPLPKECENDE  850 (922)
Q Consensus       788 ~l~g~ip~~l~~L~~L~~L~ls~N~lsg~iP~~~~~~~~~~~s~~gn~~lcg~~~~~~c~~~~  850 (922)
                      +++|.||..++++++|++||+|+|+|+|+||.++||.+|...+|.|||++||.|++ .|....
T Consensus       691 ~l~g~ip~~l~~l~~L~~L~ls~N~l~g~iP~~~~~~~~~~~~~~gN~~Lcg~~l~-~C~~~~  752 (768)
T 3rgz_A          691 KLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEMGQFETFPPAKFLNNPGLCGYPLP-RCDPSN  752 (768)
T ss_dssp             CCEECCCGGGGGCCCCSEEECCSSEEEEECCSSSSGGGSCGGGGCSCTEEESTTSC-CCCSCC
T ss_pred             cccCcCChHHhCCCCCCEEECcCCcccccCCCchhhccCCHHHhcCCchhcCCCCc-CCCCCc
Confidence            99999999999999999999999999999999999999999999999999999987 786543



>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>2ks1_B Epidermal growth factor receptor; ERBB1, ERBB2, transmembrane, heterodimer, complex, tyrosine receptor, bicelles, transferase; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 922
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-23
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-18
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-12
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-08
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-07
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-18
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 5e-16
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-14
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 5e-12
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 7e-11
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-10
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-17
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-16
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-14
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-14
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-13
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-10
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-08
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 6e-05
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-04
d2omza2 384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 0.002
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 9e-13
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 5e-12
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 3e-11
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 9e-10
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 3e-08
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-12
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-10
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-09
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-09
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.004
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-08
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 4e-07
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 9e-07
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 0.003
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 0.004
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 3e-08
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 4e-07
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 1e-06
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.004
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 4e-07
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 4e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 9e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 7e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 6e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.003
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 2e-06
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 3e-06
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 2e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 6e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.002
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 3e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 3e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 6e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 9e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 3e-05
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 1e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 1e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 9e-04
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 4e-04
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 0.001
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 5e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.001
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 6e-04
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 0.003
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 0.002
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 0.004
d1m9la_198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 0.004
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
 Score =  100 bits (249), Expect = 1e-23
 Identities = 84/351 (23%), Positives = 135/351 (38%), Gaps = 53/351 (15%)

Query: 25  LCHSYERSALLQFKESLTIIRKTSSYYIWDPCHPKTASWKPEEANIDCC--LWDGVECNE 82
           LC+  ++ ALLQ K+ L            +P     +SW P     DCC   W GV C+ 
Sbjct: 2   LCNPQDKQALLQIKKDLG-----------NP--TTLSSWLP---TTDCCNRTWLGVLCDT 45

Query: 83  NTG--HVIKLDLSNSCLQGFINSSSGLFKLVHLEWLDLAFNYFICSEIPPEIINLSRLSY 140
           +T    V  LDLS   L       S L  L +L +L +     +   IPP I  L++L Y
Sbjct: 46  DTQTYRVNNLDLSGLNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHY 105

Query: 141 LNLSSAGFFGQIPSEILELSNLVSLDLSHNSYYNLIELKEPNLGNLVKKLTNLKELALGG 200
           L ++     G IP  + ++  LV+LD S+N+                             
Sbjct: 106 LYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSG-------------------------- 139

Query: 201 VTISSPIPHSLANLSSLTLLSLSGCELRGRIPSLLGNLTKLMYLDLSFNNLLGELPTSIG 260
                 +P S+++L +L  ++  G  + G IP   G+ +KL        N L        
Sbjct: 140 -----TLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTF 194

Query: 261 NLDCLKRLDISWNELSGELPASIGNLASLEQLELSLNRFRGKTPHSMGNFTRLYWLSLAS 320
               L  +D+S N L G+     G+  + +++ L+ N           +        L +
Sbjct: 195 ANLNLAFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFDLGKVGLSKNLNGLD-LRN 253

Query: 321 NDFSGELPASFGNLRSLEGLDISECKFSSQIPSSLRNLAQLKFLEFSHNNF 371
           N   G LP     L+ L  L++S      +IP    NL +     +++N  
Sbjct: 254 NRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIP-QGGNLQRFDVSAYANNKC 303


>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query922
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.98
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.95
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.95
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.91
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.9
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.9
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.89
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.86
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.86
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.78
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.77
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.74
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.73
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.73
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.72
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.71
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.71
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.69
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.68
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.66
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.65
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.63
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.61
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.56
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.49
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.46
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.44
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.37
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.37
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.35
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.34
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.22
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.16
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.12
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.11
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.2
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.15
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.71
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.58
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.96
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.9
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=100.00  E-value=1.2e-38  Score=343.93  Aligned_cols=295  Identities=32%  Similarity=0.496  Sum_probs=178.9

Q ss_pred             CCCHHHHHHHHHHhhcCCcCCCCCcccccCCCCCCCCCCCCCCCCCCCcc--ccceEecCCC--CcEEEEECCCCCCCCc
Q 002435           25 LCHSYERSALLQFKESLTIIRKTSSYYIWDPCHPKTASWKPEEANIDCCL--WDGVECNENT--GHVIKLDLSNSCLQGF  100 (922)
Q Consensus        25 ~~~~~~~~all~~k~~~~~~~~~~~~~~~~~~~~~~~~w~~~~~~~~~c~--w~gv~c~~~~--~~v~~L~L~~~~l~g~  100 (922)
                      .|.++||+||++||+++.++.             .+++|..   ++|||.  |+||+|+..+  +||++|+|+++++.|.
T Consensus         2 ~c~~~e~~aLl~~k~~~~~~~-------------~l~sW~~---~~d~C~~~w~gv~C~~~~~~~~v~~L~L~~~~l~g~   65 (313)
T d1ogqa_           2 LCNPQDKQALLQIKKDLGNPT-------------TLSSWLP---TTDCCNRTWLGVLCDTDTQTYRVNNLDLSGLNLPKP   65 (313)
T ss_dssp             CSCHHHHHHHHHHHHHTTCCG-------------GGTTCCT---TSCTTTTCSTTEEECCSSSCCCEEEEEEECCCCSSC
T ss_pred             CCCHHHHHHHHHHHHHCCCCC-------------cCCCCCC---CCCCCCCcCCCeEEeCCCCcEEEEEEECCCCCCCCC
Confidence            599999999999999998753             5789987   789994  9999998643  4899999999999986


Q ss_pred             ccCccccccCCCCCeeeCCC-CCCCCCCCCccccCCCCCCEEECCCCCCCCcCchhhcCCCCCCEEEcCCCCCCCccccc
Q 002435          101 INSSSGLFKLVHLEWLDLAF-NYFICSEIPPEIINLSRLSYLNLSSAGFFGQIPSEILELSNLVSLDLSHNSYYNLIELK  179 (922)
Q Consensus       101 ~~~~~~l~~l~~L~~L~Ls~-n~~~~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~L~~L~Ls~n~~~~~~~~~  179 (922)
                      .+.+..++++++|++|+|++ |++.+. +|+.|+++++|++|+|++|++.+..+..+..+.+|+++++++|.+    .  
T Consensus        66 ~~lp~~l~~L~~L~~L~Ls~~N~l~g~-iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l~l~~N~~----~--  138 (313)
T d1ogqa_          66 YPIPSSLANLPYLNFLYIGGINNLVGP-IPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNAL----S--  138 (313)
T ss_dssp             EECCGGGGGCTTCSEEEEEEETTEESC-CCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSEE----E--
T ss_pred             CCCChHHhcCccccccccccccccccc-cccccccccccchhhhccccccccccccccchhhhcccccccccc----c--
Confidence            43334677777777777765 566554 677777777777777777777666666666677777777766652    1  


Q ss_pred             CCChhHHHhcCCCCCEEEcCCCcCCCCCchhccCCCCC-CEEeccCccCCccCccccCCCCCCCEEeCcCCCCCCCcccc
Q 002435          180 EPNLGNLVKKLTNLKELALGGVTISSPIPHSLANLSSL-TLLSLSGCELRGRIPSLLGNLTKLMYLDLSFNNLLGELPTS  258 (922)
Q Consensus       180 ~~~l~~~~~~l~~L~~L~L~~n~~~~~~~~~l~~l~~L-~~L~Ls~n~l~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~  258 (922)
                       ..+|..+.+++.|+++++++|.+.+.+|..+..+..+ +.+++++|++++..|..+                       
T Consensus       139 -~~~p~~l~~l~~L~~l~l~~n~l~~~ip~~~~~l~~l~~~l~~~~n~l~~~~~~~~-----------------------  194 (313)
T d1ogqa_         139 -GTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTF-----------------------  194 (313)
T ss_dssp             -SCCCGGGGGCTTCCEEECCSSCCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGG-----------------------
T ss_pred             -ccCchhhccCcccceeeccccccccccccccccccccccccccccccccccccccc-----------------------
Confidence             2334444455555555555555544444444444433 444445554444444444                       


Q ss_pred             cCCCCCCcEEEcccCCCCCCchhhhhCCCCCCEEEccCCCCCCCCcccccCCCCCcEEEeeccCCCCcccccccCCCCCc
Q 002435          259 IGNLDCLKRLDISWNELSGELPASIGNLASLEQLELSLNRFRGKTPHSMGNFTRLYWLSLASNDFSGELPASFGNLRSLE  338 (922)
Q Consensus       259 l~~l~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~  338 (922)
                       ..+..+ .++++++...+.+|..+..+++|+.+++++|.+.+.++ .+..+++|+.|++++|+++|.+|..++++++|+
T Consensus       195 -~~l~~~-~l~l~~~~~~~~~~~~~~~~~~l~~l~~~~~~l~~~~~-~~~~~~~L~~L~Ls~N~l~g~iP~~l~~L~~L~  271 (313)
T d1ogqa_         195 -ANLNLA-FVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFDLG-KVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLH  271 (313)
T ss_dssp             -GGCCCS-EEECCSSEEEECCGGGCCTTSCCSEEECCSSEECCBGG-GCCCCTTCCEEECCSSCCEECCCGGGGGCTTCC
T ss_pred             -cccccc-cccccccccccccccccccccccccccccccccccccc-ccccccccccccCccCeecccCChHHhCCCCCC
Confidence             443322 34444444444444444444555555555554443322 344445555555555555555555555555555


Q ss_pred             eEecCCCccCccCchhhcCCCCccEEEccCCC
Q 002435          339 GLDISECKFSSQIPSSLRNLAQLKFLEFSHNN  370 (922)
Q Consensus       339 ~L~Ls~n~l~~~~~~~l~~l~~L~~L~L~~n~  370 (922)
                      +|+|++|+++|.+|+ ++.+++|+.+++++|+
T Consensus       272 ~L~Ls~N~l~g~iP~-~~~L~~L~~l~l~~N~  302 (313)
T d1ogqa_         272 SLNVSFNNLCGEIPQ-GGNLQRFDVSAYANNK  302 (313)
T ss_dssp             EEECCSSEEEEECCC-STTGGGSCGGGTCSSS
T ss_pred             EEECcCCcccccCCC-cccCCCCCHHHhCCCc
Confidence            555555555554442 3445555555555554



>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure