Citrus Sinensis ID: 002472
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 918 | 2.2.26 [Sep-21-2011] | |||||||
| Q8K1N1 | 776 | Calcium-independent phosp | yes | no | 0.333 | 0.394 | 0.316 | 1e-43 | |
| Q5XTS1 | 786 | Calcium-independent phosp | yes | no | 0.338 | 0.395 | 0.308 | 4e-42 | |
| Q9NP80 | 782 | Calcium-independent phosp | yes | no | 0.336 | 0.395 | 0.314 | 5e-42 | |
| P97819 | 807 | 85/88 kDa calcium-indepen | no | no | 0.281 | 0.319 | 0.276 | 3e-17 | |
| P97570 | 807 | 85/88 kDa calcium-indepen | yes | no | 0.281 | 0.319 | 0.276 | 5e-17 | |
| O60733 | 806 | 85/88 kDa calcium-indepen | no | no | 0.281 | 0.320 | 0.267 | 1e-13 | |
| O74874 | 690 | Glucose-repressible alcoh | yes | no | 0.112 | 0.149 | 0.359 | 1e-09 | |
| Q5B778 | 675 | Glucose-repressible alcoh | no | no | 0.135 | 0.183 | 0.346 | 2e-09 | |
| Q7KRY7 | 1851 | Protein lap4 OS=Drosophil | no | no | 0.167 | 0.083 | 0.356 | 1e-08 | |
| Q6XHA7 | 3365 | Probable serine/threonine | no | no | 0.098 | 0.026 | 0.397 | 2e-08 |
| >sp|Q8K1N1|PLPL8_MOUSE Calcium-independent phospholipase A2-gamma OS=Mus musculus GN=Pnpla8 PE=2 SV=1 | Back alignment and function desciption |
|---|
Score = 179 bits (453), Expect = 1e-43, Method: Compositional matrix adjust.
Identities = 117/370 (31%), Positives = 182/370 (49%), Gaps = 64/370 (17%)
Query: 492 ESLRDLLMRLTVGPEPRVNKAAARALAILGENESLRRAIRGRQVPKQGLRILSMDGGGMK 551
E + L+RL + + A LA++G + ++GR G+RIL++DGGG +
Sbjct: 397 EKIIPYLLRLRQVKDETLQAAVREILALIGYVD----PVKGR-----GIRILTIDGGGTR 447
Query: 552 GLATVQILKEIEKGTGKRIHELFDLVCGTSTGGMLAIALAVKLMTLDQCEEIYKNLGKLV 611
G+ +Q L+++ + T K IH+LFD +CG STG +LA L + M LD+CEE+Y+ LG V
Sbjct: 448 GVVALQTLRKLVELTQKPIHQLFDYICGVSTGAILAFMLGLFHMPLDECEELYRKLGSDV 507
Query: 612 FAEPFPKDNEAATWREKLDQIYKSSSQSFRVVVHGSKHSADQFERLLKEMCADEDGDLLI 671
F + +W S +F + ++ +E++LK D G L+
Sbjct: 508 FTQNVIVGTVKMSW-----------SHAF--------YDSNTWEKILK----DRIGSALM 544
Query: 672 ESSVKN--IPKVFTVSTLVNV-MPAQPFIFRNYQYPAGTPEVPFSISENSGITVLGSPTT 728
+ +N PKV +ST+VN + F+FRNY + GT
Sbjct: 545 IETARNPACPKVAAISTIVNRGQTPKAFVFRNYGHFPGT--------------------- 583
Query: 729 GAQVGYKRSAFIGSCKHQVWQAIRASSAAPYYLDDFSDDVFRWQDGAIVANNPTIFAIRE 788
S ++G C++++WQAIRASSAAP Y +++ QDG ++ NNP+ A+ E
Sbjct: 584 -------NSHYLGGCQYKMWQAIRASSAAPGYFAEYALGSDLHQDGGLLLNNPSALALHE 636
Query: 789 AQLLWPDTRIDCLVSIGCGSVPTKTRRGGWRYLDTGQVLIESACSVDRAEEALSTLLPML 848
+ +WPDT ++C+VS+G G + R Y L S EE L +L
Sbjct: 637 CKCIWPDTPLECIVSLGTGRYESDVRNTS-TYTSLKTKLSNVISSATDTEEVHIMLDGLL 695
Query: 849 PEIQYYRFNP 858
P Y+RFNP
Sbjct: 696 PSDTYFRFNP 705
|
Calcium-independent phospholipase A2, which catalyzes the hydrolysis of the sn-2 position of glycerophospholipids, PtdSer and to a lower extent PtdCho. Cleaves membrane phospholipids. Mus musculus (taxid: 10090) EC: 3EC: .EC: 1EC: .EC: 1EC: .EC: 5 |
| >sp|Q5XTS1|PLPL8_RABIT Calcium-independent phospholipase A2-gamma OS=Oryctolagus cuniculus GN=PNPLA8 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q9NP80|PLPL8_HUMAN Calcium-independent phospholipase A2-gamma OS=Homo sapiens GN=PNPLA8 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|P97819|PLPL9_MOUSE 85/88 kDa calcium-independent phospholipase A2 OS=Mus musculus GN=Pla2g6 PE=1 SV=3 | Back alignment and function description |
|---|
| >sp|P97570|PLPL9_RAT 85/88 kDa calcium-independent phospholipase A2 OS=Rattus norvegicus GN=Pla2g6 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|O60733|PLPL9_HUMAN 85/88 kDa calcium-independent phospholipase A2 OS=Homo sapiens GN=PLA2G6 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|O74874|CCR4_SCHPO Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ccr4 PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q5B778|CCR4_EMENI Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ccr4 PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q7KRY7|LAP4_DROME Protein lap4 OS=Drosophila melanogaster GN=scrib PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q6XHA7|ROCO9_DICDI Probable serine/threonine-protein kinase roco9 OS=Dictyostelium discoideum GN=roco9 PE=3 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 918 | ||||||
| 255554945 | 1318 | conserved hypothetical protein [Ricinus | 0.913 | 0.636 | 0.814 | 0.0 | |
| 449488466 | 1563 | PREDICTED: tryptophan synthase beta chai | 0.925 | 0.543 | 0.794 | 0.0 | |
| 449454722 | 1328 | PREDICTED: uncharacterized protein LOC10 | 0.925 | 0.640 | 0.794 | 0.0 | |
| 357480239 | 1425 | Calcium-independent phospholipase A2-gam | 0.921 | 0.593 | 0.750 | 0.0 | |
| 356520053 | 1332 | PREDICTED: uncharacterized protein LOC10 | 0.921 | 0.635 | 0.782 | 0.0 | |
| 305696361 | 1353 | Ca2+-independent phospholipase A2 [Physa | 0.930 | 0.631 | 0.765 | 0.0 | |
| 356564518 | 1333 | PREDICTED: uncharacterized protein LOC10 | 0.921 | 0.634 | 0.782 | 0.0 | |
| 302144085 | 1286 | unnamed protein product [Vitis vinifera] | 0.882 | 0.629 | 0.772 | 0.0 | |
| 147833190 | 1286 | hypothetical protein VITISV_030806 [Viti | 0.882 | 0.629 | 0.771 | 0.0 | |
| 334183567 | 1309 | galactolipase/ phospholipase [Arabidopsi | 0.882 | 0.618 | 0.787 | 0.0 |
| >gi|255554945|ref|XP_002518510.1| conserved hypothetical protein [Ricinus communis] gi|223542355|gb|EEF43897.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 1379 bits (3570), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 697/856 (81%), Positives = 760/856 (88%), Gaps = 17/856 (1%)
Query: 3 SWGLGWKRPLEIFKLTLSYGTEEAGYDPFNRLSTSSSSSTSTSSLSSPTVMTRDPELGFR 62
SWGLGWKRP EIF+LTL+YGTEE+ D NR STSSS S S+SS +S + D + G R
Sbjct: 2 SWGLGWKRPSEIFRLTLNYGTEES-EDDLNRTSTSSSGSFSSSSPTSLSSPPHDQDPGLR 60
Query: 63 IDLEWTSGEEEDQVALKLQSQLMVALPVPEDTVVVELAPQEEGDVATDAANVGVEMRVVK 122
IDL+WT G++EDQVAL+LQSQLMVALP+P+D V V+L +E NVGVEM+VVK
Sbjct: 61 IDLDWTVGDDEDQVALRLQSQLMVALPLPQDCVTVDLNVKE-------GENVGVEMKVVK 113
Query: 123 RREPLRAVVLTKGVGSGHLSDGIGVLTRLMRSDLSTSGPGNNMGSGFCDHWKTVTAVSLC 182
RREPLR ++L+KG GSG SDGIG+LTRL+RS+L T G + G +HW+ VT +SLC
Sbjct: 114 RREPLRGMILSKG-GSGQQSDGIGILTRLLRSNLVTDGVVSTCG----EHWRNVTLLSLC 168
Query: 183 GLGLSALPVDLTRLPVLEKLYLDNNKLSTLPPELGAMKNLKVLIVDNNMLVCVPVELREC 242
G LS LP +L LP+LEKLYLDNN+LS LPPELG +K LKVL VD+N LV VPVELR+C
Sbjct: 169 GCCLSVLPAELIGLPLLEKLYLDNNRLSVLPPELGELKALKVLSVDHNALVSVPVELRQC 228
Query: 243 VGLVELSLEHNRLVRPLLDFRAMAELKILRLFGNPLEFLPEILPLLKLRHLSLANIRIVA 302
VGLVELSLEHN+LVRPLLDFRAMAEL+ILRLFGNPLEFLPEILPL KLRHLSLANIRIVA
Sbjct: 229 VGLVELSLEHNKLVRPLLDFRAMAELQILRLFGNPLEFLPEILPLHKLRHLSLANIRIVA 288
Query: 303 DENLRSVNVQIEMENNSYFGASRHKLSAFFSLIFRFSSCHHPLLASALAKIMQDQENRVV 362
DENLRSVNVQIEMEN+SYFGASRHKLSAFF+LIFRFSSCHHPLLASALAKI+QDQ NR+V
Sbjct: 289 DENLRSVNVQIEMENSSYFGASRHKLSAFFALIFRFSSCHHPLLASALAKIIQDQGNRIV 348
Query: 363 VGKDENAVRQLISMISSDNRHVVEQACSALSSLAGDVSVAMLLMKCDIMQPIIAVLKSFA 422
VGKDENAVRQLISMISSDN+HVVEQACSALSSL+GDVSVAM LMKCDIMQPI +VLKS A
Sbjct: 349 VGKDENAVRQLISMISSDNQHVVEQACSALSSLSGDVSVAMQLMKCDIMQPIESVLKSVA 408
Query: 423 PEEVKSVLQVVGQLAFASDTVAQKMLTKDVLKSLKLLCAHKNPEVQRFALLAVGNLAFCL 482
EEV SVLQVV LAFASDTVAQKMLTKD+ + + + +VQR ALLAVGNLAFCL
Sbjct: 409 QEEVISVLQVVATLAFASDTVAQKMLTKDIHLTFQFVFD----QVQRLALLAVGNLAFCL 464
Query: 483 ENRRILVTSESLRDLLMRLTVGPEPRVNKAAARALAILGENESLRRAIRGRQVPKQGLRI 542
ENRRILVTSESLRDLL+RLTV EP VNKAAARALAILGENE+LRRAIRGRQV KQGLRI
Sbjct: 465 ENRRILVTSESLRDLLLRLTVTSEPLVNKAAARALAILGENENLRRAIRGRQVAKQGLRI 524
Query: 543 LSMDGGGMKGLATVQILKEIEKGTGKRIHELFDLVCGTSTGGMLAIALAVKLMTLDQCEE 602
L+MDGGGMKGLATVQILK IEKGTGKRIHELFDL+CGTSTGGMLA+AL +KLMTL QCEE
Sbjct: 525 LAMDGGGMKGLATVQILKAIEKGTGKRIHELFDLICGTSTGGMLAVALGIKLMTLSQCEE 584
Query: 603 IYKNLGKLVFAEPFPKDNEAATWREKLDQIYKSSSQSFRVVVHGSKHSADQFERLLKEMC 662
IYKNLGKLVFAEP PKDNEAA+WREKLDQ+YKSSSQSFRVVVHGSKHSADQFERLLKEMC
Sbjct: 585 IYKNLGKLVFAEPTPKDNEAASWREKLDQLYKSSSQSFRVVVHGSKHSADQFERLLKEMC 644
Query: 663 ADEDGDLLIESSVKNIPKVFTVSTLVNVMPAQPFIFRNYQYPAGTPEVPFSISENSGITV 722
ADEDGDLLI+S+VKNIPKVF VSTLV+VMPAQP++FRNYQYPAGTPEVP SE+SG+TV
Sbjct: 645 ADEDGDLLIDSAVKNIPKVFVVSTLVSVMPAQPYVFRNYQYPAGTPEVPMPNSESSGVTV 704
Query: 723 LGSPTTGAQVGYKRSAFIGSCKHQVWQAIRASSAAPYYLDDFSDDVFRWQDGAIVANNPT 782
LGSPT GAQVGYKRSAFIGSCKH VWQAIRASSAAPYYLDDFSDDV RWQDGAIVANNPT
Sbjct: 705 LGSPTIGAQVGYKRSAFIGSCKHHVWQAIRASSAAPYYLDDFSDDVNRWQDGAIVANNPT 764
Query: 783 IFAIREAQLLWPDTRIDCLVSIGCGSVPTKTRRGGWRYLDTGQVLIESACSVDRAEEALS 842
IFA+REAQLLWPDT+IDCLVSIGCGSVPTK RRGGWRYLDTGQVLIESACSVDR EEALS
Sbjct: 765 IFAVREAQLLWPDTKIDCLVSIGCGSVPTKVRRGGWRYLDTGQVLIESACSVDRVEEALS 824
Query: 843 TLLPMLPEIQYYRFNP 858
TLLPMLPEIQYYRFNP
Sbjct: 825 TLLPMLPEIQYYRFNP 840
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|449488466|ref|XP_004158047.1| PREDICTED: tryptophan synthase beta chain 2, chloroplastic-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449454722|ref|XP_004145103.1| PREDICTED: uncharacterized protein LOC101211840 [Cucumis sativus] gi|449471727|ref|XP_004153391.1| PREDICTED: tryptophan synthase beta chain 2, chloroplastic-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|357480239|ref|XP_003610405.1| Calcium-independent phospholipase A2-gamma [Medicago truncatula] gi|355511460|gb|AES92602.1| Calcium-independent phospholipase A2-gamma [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|356520053|ref|XP_003528680.1| PREDICTED: uncharacterized protein LOC100788345 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|305696361|gb|ADM67342.1| Ca2+-independent phospholipase A2 [Physaria fendleri] gi|306977649|gb|ADN18711.1| Ca2+-independent phospholipase A2 [Physaria fendleri] | Back alignment and taxonomy information |
|---|
| >gi|356564518|ref|XP_003550500.1| PREDICTED: uncharacterized protein LOC100818519 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|302144085|emb|CBI23190.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|147833190|emb|CAN68639.1| hypothetical protein VITISV_030806 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|334183567|ref|NP_001185288.1| galactolipase/ phospholipase [Arabidopsis thaliana] gi|332195775|gb|AEE33896.1| galactolipase/ phospholipase [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 918 | ||||||
| TAIR|locus:2036808 | 1311 | AT1G61850 [Arabidopsis thalian | 0.873 | 0.611 | 0.773 | 0.0 | |
| UNIPROTKB|E1BVG7 | 782 | E1BVG7 "Uncharacterized protei | 0.130 | 0.153 | 0.384 | 5.3e-37 | |
| ZFIN|ZDB-GENE-070705-553 | 694 | pnpla8 "patatin-like phospholi | 0.131 | 0.174 | 0.432 | 1.1e-36 | |
| MGI|MGI:1914702 | 776 | Pnpla8 "patatin-like phospholi | 0.131 | 0.155 | 0.377 | 4.8e-35 | |
| UNIPROTKB|Q9NP80 | 782 | PNPLA8 "Calcium-independent ph | 0.129 | 0.152 | 0.387 | 6.1e-34 | |
| UNIPROTKB|E1BE78 | 784 | PNPLA8 "Uncharacterized protei | 0.129 | 0.151 | 0.387 | 9.2e-32 | |
| UNIPROTKB|F6Y4R5 | 713 | PNPLA8 "Uncharacterized protei | 0.132 | 0.171 | 0.371 | 1.8e-31 | |
| RGD|1311444 | 776 | Pnpla8 "patatin-like phospholi | 0.131 | 0.155 | 0.377 | 1.8e-31 | |
| UNIPROTKB|E2QZP1 | 784 | PNPLA8 "Uncharacterized protei | 0.132 | 0.155 | 0.371 | 2.5e-31 | |
| WB|WBGene00022233 | 546 | Y73B6BL.4 [Caenorhabditis eleg | 0.132 | 0.223 | 0.398 | 2e-30 |
| TAIR|locus:2036808 AT1G61850 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 3139 (1110.0 bits), Expect = 0., P = 0.
Identities = 626/809 (77%), Positives = 696/809 (86%)
Query: 56 DPELGFRIDLEWTSGEEEDQVALKLQSQLMVALPVPEDTVVVELAPQEEGDVATDAANVG 115
DPELGFRIDL+WT+G+ EDQVAL+L+SQLMVALP P DTVVVEL + D NVG
Sbjct: 13 DPELGFRIDLDWTAGDSEDQVALRLESQLMVALPAPHDTVVVELKGIGDDDEG-GLENVG 71
Query: 116 VEMRVVKRREPLRAVVLTKGVGSGHLSDGIGVLTRLMRSDLSTSG---PGNNMGSGFCDH 172
+EMRV KRREPLRAV L K VGSG DG+GVLTRLMRSD+ + P ++ S H
Sbjct: 72 LEMRVEKRREPLRAVTLMKAVGSGQQYDGVGVLTRLMRSDMMPAAIPAPAIDVASSCGVH 131
Query: 173 WKTVTAVSLCGLGLSALPVDLTRLPVLEKLYLDNNKLSTLPPELGAMKNLKVLIVDNNML 232
WKTVT++SL G GL +PV++T LP+LEKL L++NKLS LPPE+G +KNLK+L VDNNML
Sbjct: 132 WKTVTSLSLSGCGLLVMPVEVTELPLLEKLCLEHNKLSVLPPEIGKLKNLKILRVDNNML 191
Query: 233 VCVPVELRECVGLVELSLEHNRLVRPLLDFRAMAELKILRLFGNXXXXXXXXXXXXXXXX 292
+ VPVELR+CVGLVELSLEHN+LVRPLLDFRAMA L+ILRLFGN
Sbjct: 192 ISVPVELRQCVGLVELSLEHNKLVRPLLDFRAMAGLRILRLFGNPLEFLPEILPLHQLRH 251
Query: 293 XSLANIRIVADENLRSVNVQIEMENNSYFGASRHKLSAFFSLIFRFSSCHHPLLASALAK 352
SL NIRIV+DENLRSVNVQIE EN SYFGASRHKLSAF LIFR SSCHHPLLAS L K
Sbjct: 252 LSLVNIRIVSDENLRSVNVQIETENTSYFGASRHKLSAFSPLIFRSSSCHHPLLASTLVK 311
Query: 353 IMQDQENRVVVGKDENAVRQLISMISSDNRHVVEQACSALSSLAGDVSVAMLLMKCDIMQ 412
IMQD+ NR V+GKDENAVRQLISMI+SDN+HVVEQAC ALSSLA DV VAM LMKCDIM+
Sbjct: 312 IMQDEGNRSVIGKDENAVRQLISMITSDNQHVVEQACVALSSLARDVGVAMQLMKCDIMK 371
Query: 413 PIIAVLKSFAPEEVKSVLQVVGQLAFASDTVAQKMLTKDVLKSLKLLCAHKNPEVQRFAL 472
P VLKS +P+EV SVLQVV LAF SD+V+QKMLTKD+LK+LK LCAHKNPEVQR AL
Sbjct: 372 PTETVLKSSSPDEVISVLQVVVTLAFVSDSVSQKMLTKDMLKALKSLCAHKNPEVQRQAL 431
Query: 473 LAVGNLAFCLENRRILVTSESLRDLLMRLTVGPEPRVNKAAARALAILGENESLRRAIRG 532
LAVGNLAFCLENRRIL+TSESLR+LLMRL V PEPRVNKAAARALAILGENE LRR+I+G
Sbjct: 432 LAVGNLAFCLENRRILITSESLRELLMRLIVTPEPRVNKAAARALAILGENEILRRSIKG 491
Query: 533 RQVPKQGLRILSMDGGGMKGLATVQILKEIEKGTGKRIHELFDLVCGTSTGGMLAIALAV 592
RQVPKQGLRIL+MDGGGMKGLATVQILKEIEKG+GK IHELFDL+CGTSTGGMLAIAL V
Sbjct: 492 RQVPKQGLRILTMDGGGMKGLATVQILKEIEKGSGKPIHELFDLICGTSTGGMLAIALGV 551
Query: 593 KLMTLDQCEEIYKNLGKLVFAEPFPKDNEAATWREKLDQIYKSSSQSFRVVVHGSKHSAD 652
KLMTL+QCEEIYKNLGKLVFAE PKDNEAA+WREKLDQ+YKSSSQSFRVV+HGSKHSA+
Sbjct: 552 KLMTLEQCEEIYKNLGKLVFAESVPKDNEAASWREKLDQLYKSSSQSFRVVIHGSKHSAN 611
Query: 653 QFERLLKEMCADEDGDLLIESSVKNIPKVFTVSTLVNVMPAQPFIFRNYQYPAGTPEVPF 712
+FERLLKEMCADEDGDLLIES+VKN+PKVF VSTLV+VMPAQPFIFRNYQYP GTPE+ +
Sbjct: 612 EFERLLKEMCADEDGDLLIESAVKNVPKVFVVSTLVSVMPAQPFIFRNYQYPVGTPEMSY 671
Query: 713 SISENSGITVLGSPTTGAQVGY-KRSAFIGSCKHQVWQAIRASSAAPYYLDDFS--DDVF 769
+ S++SG + L S T Q GY K+SAF+GSCKHQVWQAIRASSAAPYYLDDFS + +
Sbjct: 672 AFSDHSGGSTLTSSTASDQAGYYKQSAFMGSCKHQVWQAIRASSAAPYYLDDFSVGTNSY 731
Query: 770 RWQDGAIVANNPTIFAIREAQLLWPDTRIDCLVSIGCGSVPTKTRRGGWRYLDTGQVLIE 829
RWQDGAIVANNPTIFAIREAQLLWPDT+IDCLVSIG GSVPT+ R+GGWRYLDTGQVLIE
Sbjct: 732 RWQDGAIVANNPTIFAIREAQLLWPDTKIDCLVSIGSGSVPTRVRKGGWRYLDTGQVLIE 791
Query: 830 SACSVDRAEEALSTLLPMLPEIQYYRFNP 858
SACSV+R EEALSTLLPMLPEIQY+RFNP
Sbjct: 792 SACSVERVEEALSTLLPMLPEIQYFRFNP 820
|
|
| UNIPROTKB|E1BVG7 E1BVG7 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-070705-553 pnpla8 "patatin-like phospholipase domain containing 8" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1914702 Pnpla8 "patatin-like phospholipase domain containing 8" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9NP80 PNPLA8 "Calcium-independent phospholipase A2-gamma" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BE78 PNPLA8 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F6Y4R5 PNPLA8 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| RGD|1311444 Pnpla8 "patatin-like phospholipase domain containing 8" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2QZP1 PNPLA8 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00022233 Y73B6BL.4 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
No confident hit for EC number transfering in SWISSPROT detected by BLAST
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
No EC number assignment, probably not an enzyme!
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 918 | |||
| cd07211 | 308 | cd07211, Pat_PNPLA8, Patatin-like phospholipase do | 1e-135 | |
| cd07212 | 312 | cd07212, Pat_PNPLA9, Patatin-like phospholipase do | 7e-38 | |
| cd07216 | 309 | cd07216, Pat17_PNPLA8_PNPLA9_like3, Patatin-like p | 2e-37 | |
| cd07199 | 258 | cd07199, Pat17_PNPLA8_PNPLA9_like, Patatin-like ph | 1e-25 | |
| cd07199 | 258 | cd07199, Pat17_PNPLA8_PNPLA9_like, Patatin-like ph | 9e-18 | |
| pfam01734 | 189 | pfam01734, Patatin, Patatin-like phospholipase | 2e-17 | |
| COG3621 | 394 | COG3621, COG3621, Patatin [General function predic | 4e-16 | |
| cd07217 | 344 | cd07217, Pat17_PNPLA8_PNPLA9_like4, Patatin-like p | 1e-13 | |
| cd07214 | 349 | cd07214, Pat17_isozyme_like, Patatin-like phosphol | 8e-13 | |
| COG4886 | 394 | COG4886, COG4886, Leucine-rich repeat (LRR) protei | 6e-12 | |
| COG4886 | 394 | COG4886, COG4886, Leucine-rich repeat (LRR) protei | 5e-10 | |
| cd00020 | 120 | cd00020, ARM, Armadillo/beta-catenin-like repeats | 5e-10 | |
| cd07215 | 329 | cd07215, Pat17_PNPLA8_PNPLA9_like2, Patatin-like p | 1e-09 | |
| cd07213 | 288 | cd07213, Pat17_PNPLA8_PNPLA9_like1, Patatin-like p | 7e-09 | |
| COG4886 | 394 | COG4886, COG4886, Leucine-rich repeat (LRR) protei | 3e-07 | |
| PRK15370 | 754 | PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl | 2e-06 | |
| pfam13855 | 60 | pfam13855, LRR_8, Leucine rich repeat | 2e-06 | |
| COG5064 | 526 | COG5064, SRP1, Karyopherin (importin) alpha [Intra | 2e-05 | |
| COG4886 | 394 | COG4886, COG4886, Leucine-rich repeat (LRR) protei | 6e-05 | |
| pfam12799 | 43 | pfam12799, LRR_4, Leucine Rich repeats (2 copies) | 2e-04 | |
| COG4886 | 394 | COG4886, COG4886, Leucine-rich repeat (LRR) protei | 3e-04 | |
| pfam13646 | 88 | pfam13646, HEAT_2, HEAT repeats | 3e-04 | |
| PLN00113 | 968 | PLN00113, PLN00113, leucine-rich repeat receptor-l | 4e-04 | |
| COG4886 | 394 | COG4886, COG4886, Leucine-rich repeat (LRR) protei | 8e-04 | |
| PRK15370 | 754 | PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl | 8e-04 | |
| cd07215 | 329 | cd07215, Pat17_PNPLA8_PNPLA9_like2, Patatin-like p | 0.001 | |
| cd07207 | 194 | cd07207, Pat_ExoU_VipD_like, ExoU and VipD-like pr | 0.001 | |
| cd00020 | 120 | cd00020, ARM, Armadillo/beta-catenin-like repeats | 0.002 | |
| PRK15370 | 754 | PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl | 0.002 | |
| pfam00514 | 41 | pfam00514, Arm, Armadillo/beta-catenin-like repeat | 0.002 | |
| cd13394 | 597 | cd13394, Syo1_like, Fungal symportin 1 (syo1) and | 0.002 | |
| PLN00113 | 968 | PLN00113, PLN00113, leucine-rich repeat receptor-l | 0.003 |
| >gnl|CDD|132850 cd07211, Pat_PNPLA8, Patatin-like phospholipase domain containing protein 8 | Back alignment and domain information |
|---|
Score = 406 bits (1046), Expect = e-135
Identities = 138/329 (41%), Positives = 191/329 (58%), Gaps = 54/329 (16%)
Query: 533 RQVPKQGLRILSMDGGGMKGLATVQILKEIEKGTGKRIHELFDLVCGTSTGGMLAIALAV 592
V +G+RILS+DGGG +G+ ++IL++IEK TGK IHELFD +CG STG +LA L +
Sbjct: 1 PPVKGRGIRILSIDGGGTRGVVALEILRKIEKLTGKPIHELFDYICGVSTGAILAFLLGL 60
Query: 593 KLMTLDQCEEIYKNLGKLVFAEPFPKDNEAATWREKLDQIYKSSSQSFRVVVHGSKHSAD 652
K M+LD+CEE+Y+ LGK VF++ S + R+V+ + + +
Sbjct: 61 KKMSLDECEELYRKLGKDVFSQNTY------------------ISGTSRLVLSHAYYDTE 102
Query: 653 QFERLLKEMCADEDGDLLIESSVKNIPKVFTVSTLVNVMPAQPFIFRNYQYPAGTPEVPF 712
+E++LKEM + +L+ S+ N PKV VST VN P +P++FRNY +P GT
Sbjct: 103 TWEKILKEMMGSD--ELIDTSADPNCPKVACVSTQVNRTPLKPYVFRNYNHPPGT----- 155
Query: 713 SISENSGITVLGSPTTGAQVGYKRSAFIGSCKHQVWQAIRASSAAPYYLDDFSDDVFRWQ 772
RS ++GSCKH++W+AIRASSAAP Y ++F Q
Sbjct: 156 -----------------------RSHYLGSCKHKLWEAIRASSAAPGYFEEFKLGNNLHQ 192
Query: 773 DGAIVANNPTIFAIREAQLLWPDTRIDCLVSIGCGSVPTKTR--RGGWRYLDTGQV-LIE 829
DG ++ANNPT A+ EA+LLWPDT I CLVS+G G P+ R GG+ L T + LI+
Sbjct: 193 DGGLLANNPTALALHEAKLLWPDTPIQCLVSVGTGRYPSSVRLETGGYTSLKTKLLNLID 252
Query: 830 SACSVDRAEEALSTLLPMLPEIQYYRFNP 858
SA +R AL L LP Y+RFNP
Sbjct: 253 SATDTERVHTALDDL---LPPDVYFRFNP 278
|
PNPLA8 is a Ca-independent myocardial phospholipase which maintains mitochondrial integrity. PNPLA8 is also known as iPLA2-gamma. In humans, it is predominantly expressed in heart tissue. iPLA2-gamma can catalyze both phospholipase A1 and A2 reactions (PLA1 and PLA2 respectively). This family includes PNPLA8 (iPLA2-gamma) from Homo sapiens and iPLA2-2 from Mus musculus. Length = 308 |
| >gnl|CDD|132851 cd07212, Pat_PNPLA9, Patatin-like phospholipase domain containing protein 9 | Back alignment and domain information |
|---|
| >gnl|CDD|132855 cd07216, Pat17_PNPLA8_PNPLA9_like3, Patatin-like phospholipase | Back alignment and domain information |
|---|
| >gnl|CDD|132838 cd07199, Pat17_PNPLA8_PNPLA9_like, Patatin-like phospholipase; includes PNPLA8, PNPLA9, and Pat17 | Back alignment and domain information |
|---|
| >gnl|CDD|132838 cd07199, Pat17_PNPLA8_PNPLA9_like, Patatin-like phospholipase; includes PNPLA8, PNPLA9, and Pat17 | Back alignment and domain information |
|---|
| >gnl|CDD|216671 pfam01734, Patatin, Patatin-like phospholipase | Back alignment and domain information |
|---|
| >gnl|CDD|226148 COG3621, COG3621, Patatin [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|132856 cd07217, Pat17_PNPLA8_PNPLA9_like4, Patatin-like phospholipase | Back alignment and domain information |
|---|
| >gnl|CDD|132853 cd07214, Pat17_isozyme_like, Patatin-like phospholipase of plants | Back alignment and domain information |
|---|
| >gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|237987 cd00020, ARM, Armadillo/beta-catenin-like repeats | Back alignment and domain information |
|---|
| >gnl|CDD|132854 cd07215, Pat17_PNPLA8_PNPLA9_like2, Patatin-like phospholipase of bacteria | Back alignment and domain information |
|---|
| >gnl|CDD|132852 cd07213, Pat17_PNPLA8_PNPLA9_like1, Patatin-like phospholipase | Back alignment and domain information |
|---|
| >gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat | Back alignment and domain information |
|---|
| >gnl|CDD|227396 COG5064, SRP1, Karyopherin (importin) alpha [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) | Back alignment and domain information |
|---|
| >gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|222285 pfam13646, HEAT_2, HEAT repeats | Back alignment and domain information |
|---|
| >gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|132854 cd07215, Pat17_PNPLA8_PNPLA9_like2, Patatin-like phospholipase of bacteria | Back alignment and domain information |
|---|
| >gnl|CDD|132846 cd07207, Pat_ExoU_VipD_like, ExoU and VipD-like proteins; homologus to patatin, cPLA2, and iPLA2 | Back alignment and domain information |
|---|
| >gnl|CDD|237987 cd00020, ARM, Armadillo/beta-catenin-like repeats | Back alignment and domain information |
|---|
| >gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|201276 pfam00514, Arm, Armadillo/beta-catenin-like repeat | Back alignment and domain information |
|---|
| >gnl|CDD|240521 cd13394, Syo1_like, Fungal symportin 1 (syo1) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 918 | |||
| KOG4231 | 763 | consensus Intracellular membrane-bound Ca2+-indepe | 100.0 | |
| cd07211 | 308 | Pat_PNPLA8 Patatin-like phospholipase domain conta | 100.0 | |
| cd07216 | 309 | Pat17_PNPLA8_PNPLA9_like3 Patatin-like phospholipa | 100.0 | |
| cd07212 | 312 | Pat_PNPLA9 Patatin-like phospholipase domain conta | 100.0 | |
| cd07215 | 329 | Pat17_PNPLA8_PNPLA9_like2 Patatin-like phospholipa | 100.0 | |
| cd07214 | 349 | Pat17_isozyme_like Patatin-like phospholipase of p | 100.0 | |
| cd07213 | 288 | Pat17_PNPLA8_PNPLA9_like1 Patatin-like phospholipa | 100.0 | |
| cd07199 | 258 | Pat17_PNPLA8_PNPLA9_like Patatin-like phospholipas | 100.0 | |
| cd07217 | 344 | Pat17_PNPLA8_PNPLA9_like4 Patatin-like phospholipa | 100.0 | |
| COG3621 | 394 | Patatin [General function prediction only] | 99.97 | |
| cd07207 | 194 | Pat_ExoU_VipD_like ExoU and VipD-like proteins; ho | 99.95 | |
| cd07205 | 175 | Pat_PNPLA6_PNPLA7_NTE1_like Patatin-like phospholi | 99.95 | |
| cd07210 | 221 | Pat_hypo_W_succinogenes_WS1459_like Hypothetical p | 99.94 | |
| cd07225 | 306 | Pat_PNPLA6_PNPLA7 Patatin-like phospholipase domai | 99.94 | |
| cd07228 | 175 | Pat_NTE_like_bacteria Bacterial patatin-like phosp | 99.94 | |
| cd07209 | 215 | Pat_hypo_Ecoli_Z1214_like Hypothetical patatin sim | 99.93 | |
| cd07230 | 421 | Pat_TGL4-5_like Triacylglycerol lipase 4 and 5. TG | 99.92 | |
| cd07227 | 269 | Pat_Fungal_NTE1 Fungal patatin-like phospholipase | 99.91 | |
| cd07232 | 407 | Pat_PLPL Patain-like phospholipase. Patatin-like p | 99.91 | |
| PRK10279 | 300 | hypothetical protein; Provisional | 99.89 | |
| cd07208 | 266 | Pat_hypo_Ecoli_yjju_like Hypothetical patatin simi | 99.89 | |
| cd07198 | 172 | Patatin Patatin-like phospholipase. Patatin is a s | 99.88 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 99.86 | |
| COG1752 | 306 | RssA Predicted esterase of the alpha-beta hydrolas | 99.86 | |
| cd07206 | 298 | Pat_TGL3-4-5_SDP1 Triacylglycerol lipase 3, 4, and | 99.85 | |
| cd07221 | 252 | Pat_PNPLA3 Patatin-like phospholipase domain conta | 99.85 | |
| cd07229 | 391 | Pat_TGL3_like Triacylglycerol lipase 3. Triacylgly | 99.85 | |
| cd07222 | 246 | Pat_PNPLA4 Patatin-like phospholipase domain conta | 99.85 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 99.84 | |
| COG5064 | 526 | SRP1 Karyopherin (importin) alpha [Intracellular t | 99.84 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 99.84 | |
| cd07218 | 245 | Pat_iPLA2 Calcium-independent phospholipase A2; Cl | 99.84 | |
| PF01734 | 204 | Patatin: Patatin-like phospholipase This Prosite f | 99.84 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 99.84 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 99.84 | |
| cd07231 | 323 | Pat_SDP1-like Sugar-Dependent 1 like lipase. Sugar | 99.84 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 99.83 | |
| cd07219 | 382 | Pat_PNPLA1 Patatin-like phospholipase domain conta | 99.83 | |
| cd07204 | 243 | Pat_PNPLA_like Patatin-like phospholipase domain c | 99.83 | |
| cd07220 | 249 | Pat_PNPLA2 Patatin-like phospholipase domain conta | 99.81 | |
| cd07224 | 233 | Pat_like Patatin-like phospholipase. Patatin-like | 99.79 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 99.79 | |
| KOG0166 | 514 | consensus Karyopherin (importin) alpha [Intracellu | 99.79 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 99.77 | |
| COG4667 | 292 | Predicted esterase of the alpha-beta hydrolase sup | 99.75 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 99.72 | |
| cd07223 | 405 | Pat_PNPLA5-mammals Patatin-like phospholipase doma | 99.72 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 99.71 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 99.7 | |
| cd01819 | 155 | Patatin_and_cPLA2 Patatins and Phospholipases. Pat | 99.68 | |
| COG5064 | 526 | SRP1 Karyopherin (importin) alpha [Intracellular t | 99.68 | |
| KOG2214 | 543 | consensus Predicted esterase of the alpha-beta hyd | 99.68 | |
| KOG2968 | 1158 | consensus Predicted esterase of the alpha-beta hyd | 99.68 | |
| KOG0166 | 514 | consensus Karyopherin (importin) alpha [Intracellu | 99.67 | |
| TIGR03607 | 739 | patatin-related protein. This bacterial protein fa | 99.67 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 99.66 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 99.62 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 99.59 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 99.58 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 99.56 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 99.54 | |
| KOG0532 | 722 | consensus Leucine-rich repeat (LRR) protein, conta | 99.5 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 99.45 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 99.45 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 99.44 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 99.4 | |
| KOG0513 | 503 | consensus Ca2+-independent phospholipase A2 [Lipid | 99.39 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 99.38 | |
| KOG0513 | 503 | consensus Ca2+-independent phospholipase A2 [Lipid | 99.37 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 99.34 | |
| KOG0532 | 722 | consensus Leucine-rich repeat (LRR) protein, conta | 99.31 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 99.27 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 99.25 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 99.23 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 99.22 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 99.21 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 99.21 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 99.19 | |
| PLN03200 | 2102 | cellulose synthase-interactive protein; Provisiona | 99.02 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 98.93 | |
| PLN03200 | 2102 | cellulose synthase-interactive protein; Provisiona | 98.85 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 98.85 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 98.83 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 98.8 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 98.77 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 98.7 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 98.65 | |
| cd00020 | 120 | ARM Armadillo/beta-catenin-like repeats. An approx | 98.65 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 98.6 | |
| KOG4224 | 550 | consensus Armadillo repeat protein VAC8 required f | 98.57 | |
| KOG3773 | 354 | consensus Adiponutrin and related vesicular transp | 98.54 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 98.52 | |
| KOG4224 | 550 | consensus Armadillo repeat protein VAC8 required f | 98.51 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 98.5 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 98.49 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 98.45 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 98.43 | |
| KOG4579 | 177 | consensus Leucine-rich repeat (LRR) protein associ | 98.4 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 98.2 | |
| KOG4579 | 177 | consensus Leucine-rich repeat (LRR) protein associ | 98.18 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 98.1 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 98.06 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 98.03 | |
| cd00020 | 120 | ARM Armadillo/beta-catenin-like repeats. An approx | 98.02 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 98.0 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 97.99 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 97.94 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 97.94 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 97.94 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 97.87 | |
| PF04826 | 254 | Arm_2: Armadillo-like; InterPro: IPR006911 This en | 97.84 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 97.83 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 97.79 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 97.76 | |
| PF05804 | 708 | KAP: Kinesin-associated protein (KAP) | 97.72 | |
| PF05804 | 708 | KAP: Kinesin-associated protein (KAP) | 97.63 | |
| PF00514 | 41 | Arm: Armadillo/beta-catenin-like repeat; InterPro: | 97.6 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 97.46 | |
| KOG1048 | 717 | consensus Neural adherens junction protein Plakoph | 97.45 | |
| PF10508 | 503 | Proteasom_PSMB: Proteasome non-ATPase 26S subunit; | 97.43 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 97.29 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 97.24 | |
| cd00147 | 438 | cPLA2_like Cytosolic phospholipase A2, catalytic d | 97.19 | |
| KOG4199 | 461 | consensus Uncharacterized conserved protein [Funct | 96.97 | |
| KOG4199 | 461 | consensus Uncharacterized conserved protein [Funct | 96.95 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 96.87 | |
| PF04826 | 254 | Arm_2: Armadillo-like; InterPro: IPR006911 This en | 96.49 | |
| PF13306 | 129 | LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ | 96.23 | |
| PF00514 | 41 | Arm: Armadillo/beta-catenin-like repeat; InterPro: | 96.15 | |
| KOG4308 | 478 | consensus LRR-containing protein [Function unknown | 96.03 | |
| smart00185 | 41 | ARM Armadillo/beta-catenin-like repeats. Approx. 4 | 95.99 | |
| PF13306 | 129 | LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ | 95.96 | |
| KOG2160 | 342 | consensus Armadillo/beta-catenin-like repeat-conta | 95.69 | |
| PF10508 | 503 | Proteasom_PSMB: Proteasome non-ATPase 26S subunit; | 95.63 | |
| KOG4308 | 478 | consensus LRR-containing protein [Function unknown | 95.41 | |
| KOG4500 | 604 | consensus Rho/Rac GTPase guanine nucleotide exchan | 95.35 | |
| KOG2122 | 2195 | consensus Beta-catenin-binding protein APC, contai | 95.23 | |
| KOG0473 | 326 | consensus Leucine-rich repeat protein [Function un | 95.06 | |
| PF13513 | 55 | HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O | 95.04 | |
| KOG2160 | 342 | consensus Armadillo/beta-catenin-like repeat-conta | 95.02 | |
| KOG3678 | 832 | consensus SARM protein (with sterile alpha and arm | 95.0 | |
| PF00560 | 22 | LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le | 94.93 | |
| PF13513 | 55 | HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O | 94.84 | |
| KOG0473 | 326 | consensus Leucine-rich repeat protein [Function un | 94.74 | |
| PF00560 | 22 | LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le | 94.52 | |
| PRK09687 | 280 | putative lyase; Provisional | 94.51 | |
| PF13646 | 88 | HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I | 94.31 | |
| KOG1048 | 717 | consensus Neural adherens junction protein Plakoph | 93.91 | |
| cd07202 | 430 | cPLA2_Grp-IVC Group IVC cytoplasmic phospholipase | 93.83 | |
| PRK09687 | 280 | putative lyase; Provisional | 93.7 | |
| cd07201 | 541 | cPLA2_Grp-IVB-IVD-IVE-IVF Group IVB, IVD, IVE, and | 93.25 | |
| KOG4646 | 173 | consensus Uncharacterized conserved protein, conta | 93.22 | |
| smart00185 | 41 | ARM Armadillo/beta-catenin-like repeats. Approx. 4 | 92.76 | |
| KOG0168 | 1051 | consensus Putative ubiquitin fusion degradation pr | 92.43 | |
| PF13504 | 17 | LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO | 92.24 | |
| PF13504 | 17 | LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO | 92.14 | |
| KOG1293 | 678 | consensus Proteins containing armadillo/beta-caten | 90.74 | |
| PF13646 | 88 | HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I | 90.33 | |
| PF11698 | 119 | V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011 | 90.18 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 90.04 | |
| KOG2122 | 2195 | consensus Beta-catenin-binding protein APC, contai | 88.76 | |
| cd07200 | 505 | cPLA2_Grp-IVA Group IVA cytosolic phospholipase A2 | 88.6 | |
| smart00369 | 26 | LRR_TYP Leucine-rich repeats, typical (most popula | 87.3 | |
| smart00370 | 26 | LRR Leucine-rich repeats, outliers. | 87.3 | |
| PRK13800 | 897 | putative oxidoreductase/HEAT repeat-containing pro | 86.68 | |
| smart00370 | 26 | LRR Leucine-rich repeats, outliers. | 86.53 | |
| smart00369 | 26 | LRR_TYP Leucine-rich repeats, typical (most popula | 86.53 | |
| PRK13800 | 897 | putative oxidoreductase/HEAT repeat-containing pro | 86.41 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 85.59 | |
| PF03224 | 312 | V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004 | 85.58 | |
| smart00022 | 549 | PLAc Cytoplasmic phospholipase A2, catalytic subun | 85.47 | |
| KOG0168 | 1051 | consensus Putative ubiquitin fusion degradation pr | 85.14 | |
| KOG1222 | 791 | consensus Kinesin associated protein KAP [Intracel | 85.13 | |
| KOG1293 | 678 | consensus Proteins containing armadillo/beta-caten | 84.94 | |
| KOG2023 | 885 | consensus Nuclear transport receptor Karyopherin-b | 84.91 | |
| KOG1325 | 571 | consensus Lysophospholipase [Lipid transport and m | 84.31 | |
| PF02985 | 31 | HEAT: HEAT repeat; InterPro: IPR000357 The HEAT re | 83.95 | |
| KOG4500 | 604 | consensus Rho/Rac GTPase guanine nucleotide exchan | 83.21 | |
| PF12755 | 97 | Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region | 83.21 | |
| PF01735 | 491 | PLA2_B: Lysophospholipase catalytic domain; InterP | 83.2 | |
| TIGR02270 | 410 | conserved hypothetical protein. Members are found | 81.79 |
| >KOG4231 consensus Intracellular membrane-bound Ca2+-independent phospholipase A2 [Lipid transport and metabolism] | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.5e-77 Score=623.86 Aligned_cols=690 Identities=63% Similarity=0.956 Sum_probs=515.3
Q ss_pred cccCCcchhHHHHHhhhhhhcCCCCCCceeeecCCCccCCcccCCcceeeehhhcCCCCCccEEEeecCCCCCcCccccc
Q 002472 67 WTSGEEEDQVALKLQSQLMVALPVPEDTVVVELAPQEEGDVATDAANVGVEMRVVKRREPLRAVVLTKGVGSGHLSDGIG 146 (918)
Q Consensus 67 ~~~~~~~~~~~~~l~~~~~~~l~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~l~~L~~L~L~~n~l~~~~p~~~~ 146 (918)
|+.++.+++++..+.++++.++|.+.+.+++.++.. +.+ +..++.+++..-.+-..++...+..-.-++.--+..+
T Consensus 1 ~t~~~s~d~~~~~l~~~~~v~~~~~~~~~~~~~~~~---~~~-~l~~v~l~~~~~~~~~~~r~~~~~~~~~s~~~y~~~~ 76 (763)
T KOG4231|consen 1 WTAGDSEDQVALRLESQLMVALPAPHDTVVVELKDD---DEG-GLENVGLEMRVEKRREPLRAVTLMKAVGSGQQYDGVG 76 (763)
T ss_pred CCcccchhHHHHHhhhhhhhccCCCCceEEEEeccc---ccc-ccchhhhhhhhhhcccchhhhHHHhhhcCCcccCCcc
Confidence 778899999999999999999999999999999743 222 5666666655444444444333322111121111222
Q ss_pred CCCCCCEEeCCCCCCCCCCccccccCCCCccEEEccCCCCcccCcccCCCCCCcEEeccCCCCCCCcccccCCcCcceee
Q 002472 147 VLTRLMRSDLSTSGPGNNMGSGFCDHWKTVTAVSLCGLGLSALPVDLTRLPVLEKLYLDNNKLSTLPPELGAMKNLKVLI 226 (918)
Q Consensus 147 ~l~~L~~L~L~~n~~~~~~~~~~~~~l~~L~~L~L~~n~l~~lp~~l~~l~~L~~L~L~~n~l~~lp~~l~~l~~L~~L~ 226 (918)
.+.+|-.+-++-- .|... .-++|.. ....-+.+.++++.+...|..+..|+.|+.+.
T Consensus 77 ~~~~l~~~~~a~~------ap~~~---------~~~~~~~--------~~~~~t~~s~s~~~~~~~~~~vt~l~~~~~~~ 133 (763)
T KOG4231|consen 77 VLTRLMMMPAAIP------APAID---------VASSCGV--------HWKTVTSLSLSGCGLLVMPVEVTELPLLEKLC 133 (763)
T ss_pred hheeeeeeeccCC------Ccchh---------hhhceee--------eeeeeeecccccceeccChHHHHhhhhhhHHH
Confidence 2333332222210 01000 0000100 11223445555565555566666666666666
Q ss_pred cccccccccchhccCCCCCcEEEeecCCCCCCcccccCCCCCCEEEeeCCCCCCCc-CcCCCCCCcEEEccCCCCCCCcC
Q 002472 227 VDNNMLVCVPVELRECVGLVELSLEHNRLVRPLLDFRAMAELKILRLFGNPLEFLP-EILPLLKLRHLSLANIRIVADEN 305 (918)
Q Consensus 227 Ls~N~l~~lp~~l~~l~~L~~L~L~~N~l~~~~~~l~~l~~L~~L~L~~N~l~~l~-~l~~l~~L~~L~L~~N~i~~~~~ 305 (918)
+..|+++..|..+.++.++..+.+. ..+..+....-+-++.+..|.....+ .+..
T Consensus 134 ~~~~k~s~~~~li~k~~~~~i~r~~-----s~~d~l~~~~pf~e~s~~~~~~~~p~g~~~~------------------- 189 (763)
T KOG4231|consen 134 LEHNKLSVLPPLIGKLKNLKILRVD-----SVPDELRQCVPFVELSLEHNKLVRPLGDFRS------------------- 189 (763)
T ss_pred HHHhhhccchhhhhhhhhHHHhccC-----CccccccccCCchhhhhhccCccCCCccccc-------------------
Confidence 6666666666655555544444332 12222333333333333333332111 1100
Q ss_pred cchhhhhhcccCCccccccccccchhhhhhhhccCCCCchhhHHHHhhhccCCCceeecccccccCcccEEECcCCcchh
Q 002472 306 LRSVNVQIEMENNSYFGASRHKLSAFFSLIFRFSSCHHPLLASALAKIMQDQENRVVVGKDENAVRQLISMISSDNRHVV 385 (918)
Q Consensus 306 l~~l~~~~~l~~l~~l~l~~n~l~~~~~~l~~l~~l~~~~l~~~L~~ll~l~~N~l~ip~~~~~L~~L~~L~ls~N~~v~ 385 (918)
+.. .-.+-.++.-+...++...+.++.-+++..+.....+.+......|...+.....++..++...-|+ ..+.
T Consensus 190 ~~~-----~~~~ts~fg~S~~~lSn~~~~~Fk~~~~~~~~~~~~fv~k~e~e~n~~~iGk~~~~I~~~~~~ieS~-~hvV 263 (763)
T KOG4231|consen 190 LGQ-----RAENTSYFGASRHKLSNFSPLIFKSSSCHHPLLASTFVKKMEDEGNRSVIGKDENAIRQLISMIESD-QHVV 263 (763)
T ss_pred ccC-----cccccccccchhhhhhccchHhhccccccchhHHHHHHHHhhCcccceeecccchhhhhhccccccc-chhh
Confidence 000 0122234444555566666777777778777777777777788888776655555566666655554 5677
Q ss_pred HHHHHHhccCCCCchhhhHHHhCCCchhHHHhhccCChHHHHHHHHHHHHHhhCChHHHHHHhhhchHHHHHHHhcCCCh
Q 002472 386 EQACSALSSLAGDVSVAMLLMKCDIMQPIIAVLKSFAPEEVKSVLQVVGQLAFASDTVAQKMLTKDVLKSLKLLCAHKNP 465 (918)
Q Consensus 386 e~a~~~L~~L~~~~~~~~~v~~~~~~~~ll~ll~~~~~~~~~~~l~~L~~l~~~~~~~~~~v~~~g~~p~L~~Ll~~~~~ 465 (918)
++++.++...+.+...-..++.+.++.+--..++...+. +..-++.+..+.+.++...|++........|..+..+.++
T Consensus 264 ek~~~~~~s~~~~~~~t~ql~k~~l~~pTe~v~~l~~~~-I~~l~~~v~~~~~~s~s~~Qe~~~K~~~~~lk~~~a~~n~ 342 (763)
T KOG4231|consen 264 EKACVALSSLARDVGVTMQLMKCDLMKPTETVLKLSSPD-IISLLQVVVTLAFVSDSVSQEMLTKDMLKALKSLCAHKNP 342 (763)
T ss_pred cccccccccHHHHHHHHHHHHHHHhcCcchhhhhhcccc-HhhHHHHHhcCCchhhhHHhhhhHHHHHHHHHHHhcccCh
Confidence 777777766664443335555555555433333332233 4456788888888888888888888888889999999999
Q ss_pred hHHHHHHHHHHHhhcCcccccceeeccCcccchhccccCCChhhHHHHHHHHHHhccchHHHHHhhcCCCCCCcceEEEe
Q 002472 466 EVQRFALLAVGNLAFCLENRRILVTSESLRDLLMRLTVGPEPRVNKAAARALAILGENESLRRAIRGRQVPKQGLRILSM 545 (918)
Q Consensus 466 ~v~~~al~a~~nl~~~~~~~~~~~~~~~~~~~L~~ll~~~~~~i~~~a~~al~~l~~~~~~~~~~~~~~~~~~~~riL~L 545 (918)
.++.+|..++++++++.++++....+..+...+++++...++++.+.+..|++.+++++-+++.+++++.+++|+|||++
T Consensus 343 ~l~~qa~~~v~~~~~~~~~r~~~~tsp~l~~~~~~~i~~~~~~~~~~~~~a~~~~~~~eil~~~~~~~~vkg~G~rILSi 422 (763)
T KOG4231|consen 343 ELQRQALLAVGNLAFCLENRRILITSPSLRELLMRLIVTPEPRVNKAAARALAILGENEILRRSIKGRQVKGQGLRILSI 422 (763)
T ss_pred HHHHHHHHHHHHheecccccccccCChHHHHHHHHHhcccccccchhhhHHHHHhhhhHHHHhhccccccCCCceEEEEe
Confidence 99999999999999999999999989999999999999999999999999999999999999999999999999999999
Q ss_pred cCCCchHHHHHHHHHHHHHhcCCCCccccceeeecChHHHHHHHHHcCCCCHHHHHHHHHHhhccccCCCCCCCchhhhH
Q 002472 546 DGGGMKGLATVQILKEIEKGTGKRIHELFDLVCGTSTGGMLAIALAVKLMTLDQCEEIYKNLGKLVFAEPFPKDNEAATW 625 (918)
Q Consensus 546 dGGG~rG~~~~~vL~~Le~~~~~~~~~~fD~i~GTS~Gaiia~~l~~~~~s~~~~~~~y~~~~~~iF~~~~~~~~~~~~~ 625 (918)
||||+||++.+.+|+.||+..|+++++.||+|||+|||||+|++|+...|+.+||.++|.++++.+|.+..+..++..+|
T Consensus 423 DGGGtrG~~~lqiL~kieklsgKpIheLFD~ICGvSTG~ilA~~Lg~k~m~l~eCeEiY~~lgk~vFsq~v~~g~~~~sw 502 (763)
T KOG4231|consen 423 DGGGTRGLATLQILKKIEKLSGKPIHELFDLICGVSTGGILAIALGVKLMTLEECEEIYKNLGKLVFSQSVPKGNEAASW 502 (763)
T ss_pred cCCCccchhHHHHHHHHHHhcCCcHHHHHHHHhccCchHHHHHHHHhcCccHHHHHHHHHHHhHHHhhccccccchhhee
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999988888777
Q ss_pred HHHHHHHhhhcccceeEEeecCCCCHHHHHHHHHHHhcCCCCCchhccccCCCCEEEEEEeeeccC-CCcceEeccCCCC
Q 002472 626 REKLDQIYKSSSQSFRVVVHGSKHSADQFERLLKEMCADEDGDLLIESSVKNIPKVFTVSTLVNVM-PAQPFIFRNYQYP 704 (918)
Q Consensus 626 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~le~~l~~~~~~~~~~~~~~~~~~~~~~~~v~~t~~~~~-~~~~~~f~ny~~~ 704 (918)
. .+.|++..+|++|++.+++ .++.......+..||+++++|.++.. +.+|++||||.+|
T Consensus 503 ~-------------------Hs~y~~n~we~iLKem~ge-d~~mi~tsr~~~~PkvavVStiVn~~pT~qpfIFRNY~hp 562 (763)
T KOG4231|consen 503 I-------------------HSKYSANEWERILKEMCGE-DGDMIITSRVKNVPKVAVVSTIVNVMPTAQPFIFRNYQHP 562 (763)
T ss_pred h-------------------hhhcchHHHHHHHHHHhhh-hhhHHHhhccCCCCceeehhhhhhcCCCccceeeeccCCC
Confidence 5 4789999999999999984 35556666678899999999988854 4899999999999
Q ss_pred CCCCCCCccccCCCCccccCCCCCCCccccccccccCCCchhHHHHHHhhccCCCCCCCccCCCceeeecccccCCcHHH
Q 002472 705 AGTPEVPFSISENSGITVLGSPTTGAQVGYKRSAFIGSCKHQVWQAIRASSAAPYYLDDFSDDVFRWQDGAIVANNPTIF 784 (918)
Q Consensus 705 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~a~rASsAaP~~F~p~~~~~~~~vDGGl~~NnP~~~ 784 (918)
.+. .++|.|+|+..+|+|+|||+|||.||..|..++..++|||+.+|||+..
T Consensus 563 ~G~----------------------------~Shy~Ggc~h~~WqAIrASsAAP~Yf~e~~lgn~l~QDGgi~aNNPta~ 614 (763)
T KOG4231|consen 563 VGT----------------------------QSHYMGGCKHQVWQAIRASSAAPYYFDEFSLGNYLWQDGGIVANNPTAF 614 (763)
T ss_pred CCc----------------------------chhhcccchHHHHHHHHhcccCCcchhhhccccceeccCcEeecCccHH
Confidence 765 3578999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHhCCCCCCCEEEEECCCCCCCccCCCCcccccccceeeeeccchhHHHHHHHHHCCCCCCCCeEEeCCCCch
Q 002472 785 AIREAQLLWPDTRIDCLVSIGCGSVPTKTRRGGWRYLDTGQVLIESACSVDRAEEALSTLLPMLPEIQYYRFNPGSIS 862 (918)
Q Consensus 785 al~ea~~~~~~~~~~~vvSlGTG~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~YfR~np~~~~ 862 (918)
|++||+.+||+.+++|+||||||+.+...++..|.+...++.|+++..+.+.+++.+.++.+|+++..||||||.+++
T Consensus 615 A~hEaklLWPD~~i~C~VSiGsGr~~t~Vr~~tv~yts~~~kL~~~i~SatdtEevh~~l~~mLPe~~YfRFNPvm~~ 692 (763)
T KOG4231|consen 615 AIHEAKLLWPDTKIDCLVSIGSGRVPTRVRKGTVRYTSTGQKLIESICSATDTEEVHSTLLPMLPEIQYFRFNPVMDR 692 (763)
T ss_pred HhhhhhccCCCCCccEEEEecCCcccccccCCceEEecHHHHHHHHHhcccchHHHHHhhhccCCchheEecchhhhc
Confidence 999999999999999999999999999988889999999998888766666677777777788889999999999753
|
|
| >cd07211 Pat_PNPLA8 Patatin-like phospholipase domain containing protein 8 | Back alignment and domain information |
|---|
| >cd07216 Pat17_PNPLA8_PNPLA9_like3 Patatin-like phospholipase | Back alignment and domain information |
|---|
| >cd07212 Pat_PNPLA9 Patatin-like phospholipase domain containing protein 9 | Back alignment and domain information |
|---|
| >cd07215 Pat17_PNPLA8_PNPLA9_like2 Patatin-like phospholipase of bacteria | Back alignment and domain information |
|---|
| >cd07214 Pat17_isozyme_like Patatin-like phospholipase of plants | Back alignment and domain information |
|---|
| >cd07213 Pat17_PNPLA8_PNPLA9_like1 Patatin-like phospholipase | Back alignment and domain information |
|---|
| >cd07199 Pat17_PNPLA8_PNPLA9_like Patatin-like phospholipase; includes PNPLA8, PNPLA9, and Pat17 | Back alignment and domain information |
|---|
| >cd07217 Pat17_PNPLA8_PNPLA9_like4 Patatin-like phospholipase | Back alignment and domain information |
|---|
| >COG3621 Patatin [General function prediction only] | Back alignment and domain information |
|---|
| >cd07207 Pat_ExoU_VipD_like ExoU and VipD-like proteins; homologus to patatin, cPLA2, and iPLA2 | Back alignment and domain information |
|---|
| >cd07205 Pat_PNPLA6_PNPLA7_NTE1_like Patatin-like phospholipase domain containing protein 6, protein 7, and fungal NTE1 | Back alignment and domain information |
|---|
| >cd07210 Pat_hypo_W_succinogenes_WS1459_like Hypothetical patatin similar to WS1459 of Wolinella succinogenes | Back alignment and domain information |
|---|
| >cd07225 Pat_PNPLA6_PNPLA7 Patatin-like phospholipase domain containing protein 6 and protein 7 | Back alignment and domain information |
|---|
| >cd07228 Pat_NTE_like_bacteria Bacterial patatin-like phospholipase domain containing protein 6 | Back alignment and domain information |
|---|
| >cd07209 Pat_hypo_Ecoli_Z1214_like Hypothetical patatin similar to Z1214 protein of Escherichia coli | Back alignment and domain information |
|---|
| >cd07230 Pat_TGL4-5_like Triacylglycerol lipase 4 and 5 | Back alignment and domain information |
|---|
| >cd07227 Pat_Fungal_NTE1 Fungal patatin-like phospholipase domain containing protein 6 | Back alignment and domain information |
|---|
| >cd07232 Pat_PLPL Patain-like phospholipase | Back alignment and domain information |
|---|
| >PRK10279 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd07208 Pat_hypo_Ecoli_yjju_like Hypothetical patatin similar to yjju protein of Escherichia coli | Back alignment and domain information |
|---|
| >cd07198 Patatin Patatin-like phospholipase | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >COG1752 RssA Predicted esterase of the alpha-beta hydrolase superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >cd07206 Pat_TGL3-4-5_SDP1 Triacylglycerol lipase 3, 4, and 5 and Sugar-Dependent 1 lipase | Back alignment and domain information |
|---|
| >cd07221 Pat_PNPLA3 Patatin-like phospholipase domain containing protein 3 | Back alignment and domain information |
|---|
| >cd07229 Pat_TGL3_like Triacylglycerol lipase 3 | Back alignment and domain information |
|---|
| >cd07222 Pat_PNPLA4 Patatin-like phospholipase domain containing protein 4 | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd07218 Pat_iPLA2 Calcium-independent phospholipase A2; Classified as Group IVA-1 PLA2 | Back alignment and domain information |
|---|
| >PF01734 Patatin: Patatin-like phospholipase This Prosite family is a subset of the Pfam family; InterPro: IPR002641 This domain is structurally and functionally related to the animal cytosolic phospholipase A2 | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >cd07231 Pat_SDP1-like Sugar-Dependent 1 like lipase | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >cd07219 Pat_PNPLA1 Patatin-like phospholipase domain containing protein 1 | Back alignment and domain information |
|---|
| >cd07204 Pat_PNPLA_like Patatin-like phospholipase domain containing protein family | Back alignment and domain information |
|---|
| >cd07220 Pat_PNPLA2 Patatin-like phospholipase domain containing protein 2 | Back alignment and domain information |
|---|
| >cd07224 Pat_like Patatin-like phospholipase | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0166 consensus Karyopherin (importin) alpha [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >COG4667 Predicted esterase of the alpha-beta hydrolase superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >cd07223 Pat_PNPLA5-mammals Patatin-like phospholipase domain containing protein 5 | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd01819 Patatin_and_cPLA2 Patatins and Phospholipases | Back alignment and domain information |
|---|
| >COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >KOG2214 consensus Predicted esterase of the alpha-beta hydrolase superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2968 consensus Predicted esterase of the alpha-beta hydrolase superfamily (Neuropathy target esterase), contains cAMP-binding domains [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0166 consensus Karyopherin (importin) alpha [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >TIGR03607 patatin-related protein | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >KOG0513 consensus Ca2+-independent phospholipase A2 [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >KOG0513 consensus Ca2+-independent phospholipase A2 [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >PLN03200 cellulose synthase-interactive protein; Provisional | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN03200 cellulose synthase-interactive protein; Provisional | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd00020 ARM Armadillo/beta-catenin-like repeats | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4224 consensus Armadillo repeat protein VAC8 required for vacuole fusion, inheritance and cytosol-to-vacuole protein targeting [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG3773 consensus Adiponutrin and related vesicular transport proteins; predicted alpha/beta hydrolase [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4224 consensus Armadillo repeat protein VAC8 required for vacuole fusion, inheritance and cytosol-to-vacuole protein targeting [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >cd00020 ARM Armadillo/beta-catenin-like repeats | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >PF05804 KAP: Kinesin-associated protein (KAP) | Back alignment and domain information |
|---|
| >PF05804 KAP: Kinesin-associated protein (KAP) | Back alignment and domain information |
|---|
| >PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >KOG1048 consensus Neural adherens junction protein Plakophilin and related Armadillo repeat proteins [Signal transduction mechanisms; Extracellular structures] | Back alignment and domain information |
|---|
| >PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >cd00147 cPLA2_like Cytosolic phospholipase A2, catalytic domain; hydrolyses arachidonyl phospholipids | Back alignment and domain information |
|---|
| >KOG4199 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4199 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function | Back alignment and domain information |
|---|
| >PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A | Back alignment and domain information |
|---|
| >PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless | Back alignment and domain information |
|---|
| >KOG4308 consensus LRR-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >smart00185 ARM Armadillo/beta-catenin-like repeats | Back alignment and domain information |
|---|
| >PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A | Back alignment and domain information |
|---|
| >KOG2160 consensus Armadillo/beta-catenin-like repeat-containing protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells | Back alignment and domain information |
|---|
| >KOG4308 consensus LRR-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4500 consensus Rho/Rac GTPase guanine nucleotide exchange factor smgGDS/Vimar [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2122 consensus Beta-catenin-binding protein APC, contains ARM repeats [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0473 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >PF13513 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O_A 2H4M_A 2QMR_A 1QBK_B 2Z5M_A 2Z5K_A 2Z5N_A 1GCJ_B | Back alignment and domain information |
|---|
| >KOG2160 consensus Armadillo/beta-catenin-like repeat-containing protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3678 consensus SARM protein (with sterile alpha and armadillo motifs) [Extracellular structures] | Back alignment and domain information |
|---|
| >PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >PF13513 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O_A 2H4M_A 2QMR_A 1QBK_B 2Z5M_A 2Z5K_A 2Z5N_A 1GCJ_B | Back alignment and domain information |
|---|
| >KOG0473 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >PRK09687 putative lyase; Provisional | Back alignment and domain information |
|---|
| >PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A | Back alignment and domain information |
|---|
| >KOG1048 consensus Neural adherens junction protein Plakophilin and related Armadillo repeat proteins [Signal transduction mechanisms; Extracellular structures] | Back alignment and domain information |
|---|
| >cd07202 cPLA2_Grp-IVC Group IVC cytoplasmic phospholipase A2; catalytic domain; Ca-independent | Back alignment and domain information |
|---|
| >PRK09687 putative lyase; Provisional | Back alignment and domain information |
|---|
| >cd07201 cPLA2_Grp-IVB-IVD-IVE-IVF Group IVB, IVD, IVE, and IVF cytosolic phospholipase A2; catalytic domain; Ca-dependent | Back alignment and domain information |
|---|
| >KOG4646 consensus Uncharacterized conserved protein, contains ARM repeats [Function unknown] | Back alignment and domain information |
|---|
| >smart00185 ARM Armadillo/beta-catenin-like repeats | Back alignment and domain information |
|---|
| >KOG0168 consensus Putative ubiquitin fusion degradation protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D | Back alignment and domain information |
|---|
| >PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D | Back alignment and domain information |
|---|
| >KOG1293 consensus Proteins containing armadillo/beta-catenin-like repeat [General function prediction only] | Back alignment and domain information |
|---|
| >PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A | Back alignment and domain information |
|---|
| >PF11698 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011987 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2122 consensus Beta-catenin-binding protein APC, contains ARM repeats [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >cd07200 cPLA2_Grp-IVA Group IVA cytosolic phospholipase A2; catalytic domain; Ca-dependent | Back alignment and domain information |
|---|
| >smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily | Back alignment and domain information |
|---|
| >smart00370 LRR Leucine-rich repeats, outliers | Back alignment and domain information |
|---|
| >PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional | Back alignment and domain information |
|---|
| >smart00370 LRR Leucine-rich repeats, outliers | Back alignment and domain information |
|---|
| >smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily | Back alignment and domain information |
|---|
| >PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >PF03224 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004908 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane | Back alignment and domain information |
|---|
| >smart00022 PLAc Cytoplasmic phospholipase A2, catalytic subunit | Back alignment and domain information |
|---|
| >KOG0168 consensus Putative ubiquitin fusion degradation protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1222 consensus Kinesin associated protein KAP [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG1293 consensus Proteins containing armadillo/beta-catenin-like repeat [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2023 consensus Nuclear transport receptor Karyopherin-beta2/Transportin (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG1325 consensus Lysophospholipase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PF02985 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins, including the four name-giving proteins huntingtin, elongation factor 3 (EF3), the 65 Kd alpha regulatory subunit of protein phosphatase 2A (PP2A) and the yeast PI3-kinase TOR1 [] | Back alignment and domain information |
|---|
| >KOG4500 consensus Rho/Rac GTPase guanine nucleotide exchange factor smgGDS/Vimar [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF12755 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region | Back alignment and domain information |
|---|
| >PF01735 PLA2_B: Lysophospholipase catalytic domain; InterPro: IPR002642 This family consists of lysophospholipase / phospholipase B 3 | Back alignment and domain information |
|---|
| >TIGR02270 conserved hypothetical protein | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 918 | ||||
| 4b8c_D | 727 | Nuclease Module Of The Yeast Ccr4-Not Complex Lengt | 2e-06 | ||
| 2o6q_A | 270 | Structural Diversity Of The Hagfish Variable Lympho | 8e-05 | ||
| 3ukw_B | 510 | Mouse Importin Alpha: Bimax1 Peptide Complex Length | 5e-04 | ||
| 1q1s_C | 466 | Mouse Importin Alpha- Phosphorylated Sv40 Cn Peptid | 5e-04 | ||
| 1ejl_I | 460 | Mouse Importin Alpha-Sv40 Large T Antigen Nls Pepti | 5e-04 | ||
| 3rz9_A | 510 | Mouse Importin Alpha-Ku80 Nls Peptide Complex Lengt | 5e-04 | ||
| 4ba3_A | 496 | Mimp_alphadibb_a89nls Length = 496 | 6e-04 | ||
| 4htv_A | 509 | Mouse Importin Alpha: Bfdv Cap Nls Peptide Complex | 6e-04 | ||
| 3btr_C | 427 | Ar-Nls:importin-Alpha Complex Length = 427 | 6e-04 | ||
| 3l3q_A | 427 | Mouse Importin Alpha-Peptm Nls Peptide Complex Leng | 6e-04 | ||
| 3fex_C | 467 | Crystal Structure Of The Cbc-Importin Alpha Complex | 6e-04 | ||
| 1y2a_C | 428 | Structure Of Mammalian Importin Bound To The Non-Cl | 6e-04 | ||
| 3tpm_A | 422 | Crystal Structure Of Mal Rpel Domain In Complex Wit | 6e-04 | ||
| 3ve6_A | 426 | Crystal Structure Analysis Of Venezuelan Equine Enc | 6e-04 | ||
| 2ynr_A | 461 | Mimp_alphadibb_b54nls Length = 461 | 7e-04 | ||
| 2c1m_A | 424 | Nup50:importin-Alpha Complex Length = 424 | 7e-04 | ||
| 1ial_A | 453 | Importin Alpha, Mouse Length = 453 | 7e-04 |
| >pdb|4B8C|D Chain D, Nuclease Module Of The Yeast Ccr4-Not Complex Length = 727 | Back alignment and structure |
|
| >pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 | Back alignment and structure |
| >pdb|3UKW|B Chain B, Mouse Importin Alpha: Bimax1 Peptide Complex Length = 510 | Back alignment and structure |
| >pdb|1Q1S|C Chain C, Mouse Importin Alpha- Phosphorylated Sv40 Cn Peptide Complex Length = 466 | Back alignment and structure |
| >pdb|1EJL|I Chain I, Mouse Importin Alpha-Sv40 Large T Antigen Nls Peptide Complex Length = 460 | Back alignment and structure |
| >pdb|3RZ9|A Chain A, Mouse Importin Alpha-Ku80 Nls Peptide Complex Length = 510 | Back alignment and structure |
| >pdb|4BA3|A Chain A, Mimp_alphadibb_a89nls Length = 496 | Back alignment and structure |
| >pdb|4HTV|A Chain A, Mouse Importin Alpha: Bfdv Cap Nls Peptide Complex Length = 509 | Back alignment and structure |
| >pdb|3BTR|C Chain C, Ar-Nls:importin-Alpha Complex Length = 427 | Back alignment and structure |
| >pdb|3L3Q|A Chain A, Mouse Importin Alpha-Peptm Nls Peptide Complex Length = 427 | Back alignment and structure |
| >pdb|3FEX|C Chain C, Crystal Structure Of The Cbc-Importin Alpha Complex. Length = 467 | Back alignment and structure |
| >pdb|1Y2A|C Chain C, Structure Of Mammalian Importin Bound To The Non-Classical Plscr1-Nls Length = 428 | Back alignment and structure |
| >pdb|3TPM|A Chain A, Crystal Structure Of Mal Rpel Domain In Complex With Importin-Alpha Length = 422 | Back alignment and structure |
| >pdb|3VE6|A Chain A, Crystal Structure Analysis Of Venezuelan Equine Encephalitis Virus Capsid Protein Nls And Importin Alpha Length = 426 | Back alignment and structure |
| >pdb|2YNR|A Chain A, Mimp_alphadibb_b54nls Length = 461 | Back alignment and structure |
| >pdb|2C1M|A Chain A, Nup50:importin-Alpha Complex Length = 424 | Back alignment and structure |
| >pdb|1IAL|A Chain A, Importin Alpha, Mouse Length = 453 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >1oxw_A Patatin; alpha/beta class fold with approximately three layers; 2.20A {Solanum cardiophyllum} SCOP: c.19.1.3 Length = 373 | Back alignment and structure |
|---|
Score = 147 bits (371), Expect = 1e-38
Identities = 57/371 (15%), Positives = 110/371 (29%), Gaps = 112/371 (30%)
Query: 531 RGRQVPKQGLRILSMDGGGMKGLATVQILKEIEK-------GTGKRIHELFDLVCGTSTG 583
+ + +LS+DGGG++G+ IL+ +E R+ + FD++ GTSTG
Sbjct: 7 HAMAQLGEMVTVLSIDGGGIRGIIPATILEFLEGQLQEMDNNADARLADYFDVIGGTSTG 66
Query: 584 GMLAIALAVK------LMTLDQCEEIYKNLGKLVFAEPFPKDNEAATWREKLDQIYKSSS 637
G+L ++ + Y G +F
Sbjct: 67 GLLTAMISTPNENNRPFAAAKEIVPFYFEHGPQIF------------------------- 101
Query: 638 QSFRVVVHGSKHSADQFERLLKEMCADEDGDLLIESSVKNIPKVFTVSTLVNVMPAQPFI 697
+ + G K+ ++L+E G+ + ++ V + ++ +P I
Sbjct: 102 -NPSGQILGPKYDGKYLMQVLQEKL----GETRVHQALTE-----VVISSFDIKTNKPVI 151
Query: 698 FRNYQYPAGTPEVPFSISENSGITVLGSPTTGAQVGYKRSAFIGSCKHQVWQAIRASSAA 757
F +++ +++AA
Sbjct: 152 FTKSNLANSP----------------------------------ELDAKMYDISYSTAAA 177
Query: 758 PYYLDDFSDDVFRWQ---------DGAIVA-NNPTIFAIREAQLLWP-----------DT 796
P Y DGA+ +P + +I A L +
Sbjct: 178 PTYFPPHYFVTNTSNGDEYEFNLVDGAVATVADPALLSISVATRLAQKDPAFASIRSLNY 237
Query: 797 RIDCLVSIGCGSVPTKTRR------GGWRYLDTGQVL--IESACSVDRAEEALSTLLPML 848
+ L+S+G G+ + W + V+ + A S + LST L
Sbjct: 238 KKMLLLSLGTGTTSEFDKTYTAKEAATWTAVHWMLVIQKMTDAASSYMTDYYLSTAFQAL 297
Query: 849 -PEIQYYRFNP 858
+ Y R
Sbjct: 298 DSKNNYLRVQE 308
|
| >3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Length = 810 | Back alignment and structure |
|---|
| >3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Length = 810 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 | Back alignment and structure |
|---|
| >2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 | Back alignment and structure |
|---|
| >2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 | Back alignment and structure |
|---|
| >2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 | Back alignment and structure |
|---|
| >2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 | Back alignment and structure |
|---|
| >2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 | Back alignment and structure |
|---|
| >2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 | Back alignment and structure |
|---|
| >2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 | Back alignment and structure |
|---|
| >1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 | Back alignment and structure |
|---|
| >1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 | Back alignment and structure |
|---|
| >1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 | Back alignment and structure |
|---|
| >2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 | Back alignment and structure |
|---|
| >2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 | Back alignment and structure |
|---|
| >2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 | Back alignment and structure |
|---|
| >2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 | Back alignment and structure |
|---|
| >2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 | Back alignment and structure |
|---|
| >2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 | Back alignment and structure |
|---|
| >2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 | Back alignment and structure |
|---|
| >2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 | Back alignment and structure |
|---|
| >2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 | Back alignment and structure |
|---|
| >2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 | Back alignment and structure |
|---|
| >4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 | Back alignment and structure |
|---|
| >4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 | Back alignment and structure |
|---|
| >4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 | Back alignment and structure |
|---|
| >1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 | Back alignment and structure |
|---|
| >1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 | Back alignment and structure |
|---|
| >1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 | Back alignment and structure |
|---|
| >1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 | Back alignment and structure |
|---|
| >1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 | Back alignment and structure |
|---|
| >3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 | Back alignment and structure |
|---|
| >3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 | Back alignment and structure |
|---|
| >3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 | Back alignment and structure |
|---|
| >4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 | Back alignment and structure |
|---|
| >4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458 | Back alignment and structure |
|---|
| >3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458 | Back alignment and structure |
|---|
| >3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458 | Back alignment and structure |
|---|
| >3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458 | Back alignment and structure |
|---|
| >3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354 | Back alignment and structure |
|---|
| >3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354 | Back alignment and structure |
|---|
| >3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 | Back alignment and structure |
|---|
| >1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Length = 296 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 | Back alignment and structure |
|---|
| >1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Length = 457 | Back alignment and structure |
|---|
| >1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Length = 457 | Back alignment and structure |
|---|
| >1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Length = 457 | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 | Back alignment and structure |
|---|
| >3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Length = 233 | Back alignment and structure |
|---|
| >3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Length = 233 | Back alignment and structure |
|---|
| >3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Length = 584 | Back alignment and structure |
|---|
| >3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Length = 584 | Back alignment and structure |
|---|
| >3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Length = 584 | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 | Back alignment and structure |
|---|
| >2qk1_A Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, heat repeat, microtubule plus END, +TIP, protein binding; 1.70A {Saccharomyces cerevisiae} Length = 249 | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 | Back alignment and structure |
|---|
| >3tu3_B EXOU; type III secretion system, SPC infectious diseases, structural genomics, center for struct genomics of infectious diseases, csgid; 1.92A {Pseudomonas aeruginosa} PDB: 4akx_B* Length = 711 | Back alignment and structure |
|---|
| >3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Length = 211 | Back alignment and structure |
|---|
| >3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Length = 211 | Back alignment and structure |
|---|
| >3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Length = 211 | Back alignment and structure |
|---|
| >3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Length = 201 | Back alignment and structure |
|---|
| >3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Length = 201 | Back alignment and structure |
|---|
| >3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Length = 201 | Back alignment and structure |
|---|
| >2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} Length = 242 | Back alignment and structure |
|---|
| >1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Length = 280 | Back alignment and structure |
|---|
| >1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Length = 280 | Back alignment and structure |
|---|
| >2db0_A 253AA long hypothetical protein; heat repeats, helical structure, structural genomics; 2.20A {Pyrococcus horikoshii} Length = 253 | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 | Back alignment and structure |
|---|
| >1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Length = 588 | Back alignment and structure |
|---|
| >1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Length = 131 | Back alignment and structure |
|---|
| >3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Length = 778 | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
No hit with probability above 80.00
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 918 | ||||
| d1oxwa_ | 360 | c.19.1.3 (A:) Patatin {Heartleaf nightshade (Solan | 1e-25 | |
| d2omza2 | 384 | c.10.2.1 (A:33-416) Internalin A {Listeria monocyt | 9e-10 | |
| d2omza2 | 384 | c.10.2.1 (A:33-416) Internalin A {Listeria monocyt | 5e-07 | |
| d2omza2 | 384 | c.10.2.1 (A:33-416) Internalin A {Listeria monocyt | 3e-05 | |
| d1dcea3 | 124 | c.10.2.2 (A:444-567) Rab geranylgeranyltransferase | 3e-09 | |
| d1dcea3 | 124 | c.10.2.2 (A:444-567) Rab geranylgeranyltransferase | 1e-07 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 1e-08 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 9e-05 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 2e-04 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 2e-04 | |
| d1jdha_ | 529 | a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) | 1e-08 | |
| d1jdha_ | 529 | a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) | 1e-07 | |
| d1jdha_ | 529 | a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) | 3e-06 | |
| d1jdha_ | 529 | a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) | 5e-05 | |
| d1jdha_ | 529 | a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) | 3e-04 | |
| d1ogqa_ | 313 | c.10.2.8 (A:) Polygalacturonase inhibiting protein | 7e-08 | |
| d1ogqa_ | 313 | c.10.2.8 (A:) Polygalacturonase inhibiting protein | 3e-05 | |
| d1ogqa_ | 313 | c.10.2.8 (A:) Polygalacturonase inhibiting protein | 0.002 | |
| d1xm9a1 | 457 | a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo | 1e-07 | |
| d1xm9a1 | 457 | a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo | 4e-07 | |
| d1xm9a1 | 457 | a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo | 9e-07 | |
| d1xqra1 | 264 | a.118.1.21 (A:87-350) Hsp70-binding protein 1 (Hsp | 5e-07 | |
| d1xkua_ | 305 | c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 | 9e-07 | |
| d1xkua_ | 305 | c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 | 2e-06 | |
| d1xkua_ | 305 | c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 | 6e-05 | |
| d1xkua_ | 305 | c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 | 5e-04 | |
| d1q1sc_ | 434 | a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus | 1e-06 | |
| d1q1sc_ | 434 | a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus | 0.001 | |
| d1koha1 | 162 | c.10.2.3 (A:201-362) mRNA export factor tap {Human | 2e-06 | |
| d1p9ag_ | 266 | c.10.2.7 (G:) von Willebrand factor binding domain | 8e-06 | |
| d1p9ag_ | 266 | c.10.2.7 (G:) von Willebrand factor binding domain | 3e-05 | |
| d1p9ag_ | 266 | c.10.2.7 (G:) von Willebrand factor binding domain | 0.004 | |
| d1h6ua2 | 227 | c.10.2.1 (A:36-262) Internalin H {Listeria monocyt | 6e-05 | |
| d1h6ua2 | 227 | c.10.2.1 (A:36-262) Internalin H {Listeria monocyt | 5e-04 | |
| d1h6ua2 | 227 | c.10.2.1 (A:36-262) Internalin H {Listeria monocyt | 0.002 | |
| d1ibrb_ | 458 | a.118.1.1 (B:) Importin beta {Human (Homo sapiens) | 2e-04 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 3e-04 | |
| d1b3ua_ | 588 | a.118.1.2 (A:) Constant regulatory domain of prote | 4e-04 | |
| d1b3ua_ | 588 | a.118.1.2 (A:) Constant regulatory domain of prote | 0.001 | |
| d1h6ta2 | 210 | c.10.2.1 (A:31-240) Internalin B {Listeria monocyt | 6e-04 | |
| d1a9na_ | 162 | c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom | 7e-04 | |
| d1ozna_ | 284 | c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept | 0.001 | |
| d1ozna_ | 284 | c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept | 0.002 | |
| d2omxa2 | 199 | c.10.2.1 (A:37-235) Internalin B {Listeria monocyt | 0.001 | |
| d1xwdc1 | 242 | c.10.2.7 (C:18-259) Follicle-stimulating hormone r | 0.001 | |
| d2ca6a1 | 344 | c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom | 0.003 |
| >d1oxwa_ c.19.1.3 (A:) Patatin {Heartleaf nightshade (Solanum cardiophyllum) [TaxId: 160510]} Length = 360 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: FabD/lysophospholipase-like superfamily: FabD/lysophospholipase-like family: Patatin domain: Patatin species: Heartleaf nightshade (Solanum cardiophyllum) [TaxId: 160510]
Score = 107 bits (267), Expect = 1e-25
Identities = 57/362 (15%), Positives = 116/362 (32%), Gaps = 100/362 (27%)
Query: 538 QGLRILSMDGGGMKGLATVQILKEIEK-------GTGKRIHELFDLVCGTSTGGMLAIAL 590
+ + +LS+DGGG++G+ IL+ +E R+ + FD++ GTSTGG+L +
Sbjct: 3 EMVTVLSIDGGGIRGIIPATILEFLEGQLQEMDNNADARLADYFDVIGGTSTGGLLTAMI 62
Query: 591 AVKLMTLDQCEEIYKNLGKLVFAEPFPKDNEAATWREKLDQIYKSSSQSFRVVVHGSKHS 650
+ ++ K + F N + G K+
Sbjct: 63 STP-NENNRPFAAAKEIVPFYFEHGPQIFNPSGQIL-------------------GPKYD 102
Query: 651 ADQFERLLKEMCADEDGDLLIESSVKNIPKVFTVSTLVNVMPAQPFIFRNYQYPAGTPEV 710
++L+E G+ + ++ + ++ +P IF
Sbjct: 103 GKYLMQVLQEKL----GETRVHQALTEVVISSF-----DIKTNKPVIFTKSNLANSP--- 150
Query: 711 PFSISENSGITVLGSPTTGAQVGYKRSAFIGSCKHQVWQAIRASSAAP-----YYLDDFS 765
+++ +++AAP +Y +
Sbjct: 151 -------------------------------ELDAKMYDISYSTAAAPTYFPPHYFVTNT 179
Query: 766 DD----VFRWQDGAIVAN-NPTIFAIREAQLLWP-----------DTRIDCLVSIGCGSV 809
+ F DGA+ +P + +I A L + + L+S+G G+
Sbjct: 180 SNGDEYEFNLVDGAVATVADPALLSISVATRLAQKDPAFASIRSLNYKKMLLLSLGTGTT 239
Query: 810 PTKTRR------GGWRYLDTGQVLIE--SACSVDRAEEALSTLLPML-PEIQYYRFNPGS 860
+ W + V+ + A S + LST L + Y R +
Sbjct: 240 SEFDKTYTAKEAATWTAVHWMLVIQKMTDAASSYMTDYYLSTAFQALDSKNNYLRVQENA 299
Query: 861 IS 862
++
Sbjct: 300 LT 301
|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
| >d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 | Back information, alignment and structure |
|---|
| >d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 | Back information, alignment and structure |
|---|
| >d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 | Back information, alignment and structure |
|---|
| >d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 | Back information, alignment and structure |
|---|
| >d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 | Back information, alignment and structure |
|---|
| >d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 457 | Back information, alignment and structure |
|---|
| >d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 457 | Back information, alignment and structure |
|---|
| >d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 457 | Back information, alignment and structure |
|---|
| >d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 264 | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 | Back information, alignment and structure |
|---|
| >d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 434 | Back information, alignment and structure |
|---|
| >d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 434 | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 | Back information, alignment and structure |
|---|
| >d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Length = 458 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 588 | Back information, alignment and structure |
|---|
| >d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 588 | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 918 | |||
| d1oxwa_ | 360 | Patatin {Heartleaf nightshade (Solanum cardiophyll | 100.0 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 99.94 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 99.94 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 99.93 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 99.93 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 99.93 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 99.93 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 99.91 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 99.9 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 99.9 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 99.89 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.87 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 99.87 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.86 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.85 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.85 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 99.82 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 99.75 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 99.74 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 99.73 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 99.72 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 99.69 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 99.67 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 99.65 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 99.64 | |
| d1wa5b_ | 503 | Karyopherin alpha {Baker's yeast (Saccharomyces ce | 99.63 | |
| d1wa5b_ | 503 | Karyopherin alpha {Baker's yeast (Saccharomyces ce | 99.62 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 99.59 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 99.59 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 99.56 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 99.54 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 99.54 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 99.54 | |
| d1xqra1 | 264 | Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi | 99.53 | |
| d1q1sc_ | 434 | Importin alpha {Mouse (Mus musculus) [TaxId: 10090 | 99.52 | |
| d1jdha_ | 529 | beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} | 99.51 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 99.5 | |
| d1q1sc_ | 434 | Importin alpha {Mouse (Mus musculus) [TaxId: 10090 | 99.5 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 99.47 | |
| d1jdha_ | 529 | beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} | 99.41 | |
| d1xm9a1 | 457 | Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} | 99.4 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 99.38 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 99.36 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 99.33 | |
| d1xm9a1 | 457 | Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} | 99.27 | |
| d1xqra1 | 264 | Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi | 99.26 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 98.53 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 98.52 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 98.21 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 97.77 | |
| d1cjya2 | 580 | Cytosolic phospholipase A2 catalytic domain {Human | 97.71 | |
| d1te4a_ | 111 | MTH187 {Archaeon Methanobacterium thermoautotrophi | 97.7 | |
| d2vglb_ | 579 | Adaptin beta subunit N-terminal fragment {Human (H | 97.33 | |
| d1b3ua_ | 588 | Constant regulatory domain of protein phosphatase | 97.3 | |
| d1qbkb_ | 888 | Karyopherin beta2 {Human (Homo sapiens) [TaxId: 96 | 96.94 | |
| d1qbkb_ | 888 | Karyopherin beta2 {Human (Homo sapiens) [TaxId: 96 | 96.81 | |
| d1oyza_ | 276 | Hypothetical protein YibA {Escherichia coli [TaxId | 96.03 | |
| d1ibrb_ | 458 | Importin beta {Human (Homo sapiens) [TaxId: 9606]} | 96.02 | |
| d1b3ua_ | 588 | Constant regulatory domain of protein phosphatase | 95.98 | |
| d1oyza_ | 276 | Hypothetical protein YibA {Escherichia coli [TaxId | 94.79 | |
| d1te4a_ | 111 | MTH187 {Archaeon Methanobacterium thermoautotrophi | 94.75 | |
| d1u6gc_ | 1207 | Cullin-associated NEDD8-dissociated protein 1 (Tip | 94.6 | |
| d1ho8a_ | 477 | Regulatory subunit H of the V-type ATPase {Baker's | 91.9 | |
| d2vgla_ | 584 | Adaptin alpha C subunit N-terminal fragment {Mouse | 91.51 | |
| d1upka_ | 330 | Mo25 protein {Human (Homo sapiens) [TaxId: 9606]} | 82.71 |
| >d1oxwa_ c.19.1.3 (A:) Patatin {Heartleaf nightshade (Solanum cardiophyllum) [TaxId: 160510]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: FabD/lysophospholipase-like superfamily: FabD/lysophospholipase-like family: Patatin domain: Patatin species: Heartleaf nightshade (Solanum cardiophyllum) [TaxId: 160510]
Probab=100.00 E-value=0 Score=307.55 Aligned_cols=256 Identities=23% Similarity=0.386 Sum_probs=195.5
Q ss_pred CCCCEEEEECCCCCHHHHHHHHHHHHHHHC-------CCCCCCCCCEEEECCHHHHHHHHHHCC------CCCHHHHHHH
Q ss_conf 876149984199700778999999999850-------999753432465227589999999837------9999899999
Q 002472 537 KQGLRILSMDGGGMKGLATVQILKEIEKGT-------GKRIHELFDLVCGTSTGGMLAIALAVK------LMTLDQCEEI 603 (918)
Q Consensus 537 ~~~~~iL~ldGGG~rG~~~~~iL~~Le~~~-------~~~~~~~fD~i~GtS~Gaiia~~l~~~------~~s~~~~~~~ 603 (918)
++.+|||||||||+||+++++||++||+.. +.+++++||+|+|||+|||+|++++.+ .+..+++.+.
T Consensus 2 ~~~v~iLsldGGG~rG~~~~~vL~~L~~~~~~~~~~~~~~~~d~fD~i~GTS~Gaiia~~la~g~~~~~~~~~~~~~~~~ 81 (360)
T d1oxwa_ 2 GEMVTVLSIDGGGIRGIIPATILEFLEGQLQEMDNNADARLADYFDVIGGTSTGGLLTAMISTPNENNRPFAAAKEIVPF 81 (360)
T ss_dssp CSCEEEEEECCCGGGGHHHHHHHHHHHHHHHHHTTCTTCCHHHHCSEEEECTHHHHHHHHHHSBCTTSSBSSCGGGHHHH
T ss_pred CCCEEEEEECCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHCCEEEEECHHHHHHHHHHCCCCCHHHHHHHHHHHHH
T ss_conf 97008999898789999999999999974972346679971420999999639999999998699703189999999999
Q ss_pred HHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHHHHCCCCCCCHHCCCCCCCCEEEE
Q ss_conf 99851001589899982145688877888640356405886057888789999999982298887201012489997999
Q 002472 604 YKNLGKLVFAEPFPKDNEAATWREKLDQIYKSSSQSFRVVVHGSKHSADQFERLLKEMCADEDGDLLIESSVKNIPKVFT 683 (918)
Q Consensus 604 y~~~~~~iF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~le~~l~~~~~~~~~~~~~~~~~~~~~~~~v 683 (918)
|......+|..... ..+++|+.+.+++++++.|+ +..+.+.. .++.+
T Consensus 82 ~~~~~~~~f~~~~~--------------------------~~~~~~~~~~l~~~l~~~~~----~~~~~~~~---~~~~~ 128 (360)
T d1oxwa_ 82 YFEHGPQIFNPSGQ--------------------------ILGPKYDGKYLMQVLQEKLG----ETRVHQAL---TEVVI 128 (360)
T ss_dssp HHHHHHHHTCCCCC--------------------------SSSCSCCCHHHHHHHHHHHT----TCBGGGCS---SEEEE
T ss_pred HHHHCCHHHHCCCC--------------------------CCCCCCCHHHHHHHHHHHHC----CCHHHHCC---CCCEE
T ss_conf 98612101001233--------------------------46764546999999999958----70133216---75326
Q ss_pred EEEEECCCCCCCEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCC
Q ss_conf 97420258995347305789999999876456798731138998787445544334588851377998750368989877
Q 002472 684 VSTLVNVMPAQPFIFRNYQYPAGTPEVPFSISENSGITVLGSPTTGAQVGYKRSAFIGSCKHQVWQAIRASSAAPYYLDD 763 (918)
Q Consensus 684 ~~t~~~~~~~~~~~f~~y~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~a~rASsAaP~~F~p 763 (918)
++ .+..++++++|++|+....+ ..+.++|+|+|||||+|+||||
T Consensus 129 ~a--~~~~~~~~~~~~~~~~~~~~----------------------------------~~~~~l~~a~~ASsA~P~~F~p 172 (360)
T d1oxwa_ 129 SS--FDIKTNKPVIFTKSNLANSP----------------------------------ELDAKMYDISYSTAAAPTYFPP 172 (360)
T ss_dssp EE--EETTTTEEEEEESSSTTTCG----------------------------------GGCCBHHHHHHHHHCCTTTSCC
T ss_pred EE--CCCCCCCEEEEECCCCCCCC----------------------------------CCCCHHHHHHHHHHCCCCCCCC
T ss_conf 73--01588874897364435688----------------------------------6322698861155138877787
Q ss_pred CCCCC---------CEEEECCCCC-CCCHHHHHHHHHHHCCCCC-----------CCEEEEECCCCCCCCCC------CC
Q ss_conf 44898---------2155242024-8908999999999399999-----------98999977899998557------89
Q 002472 764 FSDDV---------FRWQDGAIVA-NNPTIFAIREAQLLWPDTR-----------IDCLVSIGCGSVPTKTR------RG 816 (918)
Q Consensus 764 ~~~~~---------~~~vDGGi~~-NnP~~~al~ea~~~~~~~~-----------~~~vvSiGTG~~~~~~~------~~ 816 (918)
+.+.+ ..|+|||+.+ |||+..|+.|+..+|+... ..+++|+|||..+.... ..
T Consensus 173 ~~~~~~~~~~~~~~~~~~Dgg~~~~nnp~~~a~~e~~~l~~~~~~~~~~~~~~~~~~~~~s~gtg~~~~~~~~~~~~~~~ 252 (360)
T d1oxwa_ 173 HYFVTNTSNGDEYEFNLVDGAVATVADPALLSISVATRLAQKDPAFASIRSLNYKKMLLLSLGTGTTSEFDKTYTAKEAA 252 (360)
T ss_dssp EEEEEECTTSCEEEEEEEEGGGGTCSSCHHHHHHHHHHHTTTCGGGTTSTTCCGGGEEEEEECCCCBCTTSSCCCHHHHT
T ss_pred EEEECCCCCCCCEEEEECCCCHHHCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCEEEECCCCCCCCCCCCCCCHHHHH
T ss_conf 79732247787326774033542256726778999987624675322245677663155314666664333332124420
Q ss_pred CCCCCCCCCEEEE--ECCCHHHHHHHHHHHCCCC-CCCCEEEECCCCC
Q ss_conf 9533344343210--0125267999999877999-9998598299990
Q 002472 817 GWRYLDTGQVLIE--SACSVDRAEEALSTLLPML-PEIQYYRFNPGSI 861 (918)
Q Consensus 817 ~~~~~~~~~~l~~--~~~~~~~~~~~~~~~~~~~-~~~~YfR~np~~~ 861 (918)
.|+...|...+.+ .....+..++.++..++.. .+.+||||||...
T Consensus 253 ~~g~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~Y~R~~~~~~ 300 (360)
T d1oxwa_ 253 TWTAVHWMLVIQKMTDAASSYMTDYYLSTAFQALDSKNNYLRVQENAL 300 (360)
T ss_dssp TCCHHHHHTTHHHHHHHHHHHHHHHHHHHHHHHTTCGGGEEEECCCCB
T ss_pred HCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEECCCCC
T ss_conf 011676899999998765599999999999874479884799748866
|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1cjya2 c.19.1.2 (A:142-721) Cytosolic phospholipase A2 catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ho8a_ a.118.1.9 (A:) Regulatory subunit H of the V-type ATPase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1upka_ a.118.1.15 (A:) Mo25 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|