Citrus Sinensis ID: 002511

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910----
MPLRLEIKRKLAQRSERVKSVDLHPSEPWILASLYSGTVCIWNYQSQTMAKSFEVTELPVRSAKFVARKQWVVAGADDMFIRVYNYNTMDKVKVFEAHTDYIRCVAVHPTLPYVLSSSDDMLIKLWDWEKGWMCTQIFEGHSHYVMQVTFNPKDTNTFASASLDRTIKIWNLGSPDPNFTLDAHQKGVNCVDYFTGGDKPYLITGSDDHTAKVWDYQTKSCVQTLEGHTHNVSAVCFHPELPIIITGSEDGTVRIWHATTYRLENTLNYGLERVWAIGYMKSSRRIVIGYDEGTIMVKIGREEPVASMDNSGKIIWAKHNEIQTVNIKSVGADYEVTDGERLPLAVKELGTCDLYPQSLKHNPNGRFVVVCGDGEYIIYTALAWRNRSFGSALEFVWSSDGEYAVRESSSKIKIFSKNFQEKRSVRPTFSAERIYGGTLLAMCSNDFICFYDWAECRLIRRIDVTVKNLYWADSGDLVAIASDTSFYILKYNRDVVSAYLDSGKPVDEQGVEDAFELLHETNERVRTGLWVGDCFIYNNSSWRLNYCVGGEVTTMFHLDRPMYLLGYLASQSRVYLIDKEFNVMGYTLLLSLIEYKTLVMRGDLERANEILPSIPKEHHNSVARFLESRGMIEEAIEVATDPDYRFELAIQLGRLEVAQEIATEVQSESKWKQLGELAMSTGKLEMAEGCMKQAMDLSGLLLLYSSLGDAEGISKLASLAKEQGKNNVAFLCLFMLGKLEDCLQLLVESNRIPEAALMARSYLPSKVSEIVAIWRKDLQKVNPKAAESLADPEEYSNLFDDWQVALAVESKAAATRGVHPPAEDYVNHADKSYMTLVEAFRHMQIEEEDTLENGDLAHEGSEQNGEENAEEQNGEEGSQEEPVVVDADSTDGAVLVNGNEAEEQWVLTPRHQDS
ccccccccEEEEcccccEEEEEEcccccEEEEEcccccEEEEEcccccEEEEEEEccccEEEEEEEccccEEEEEEcccEEEEEEcccccEEEEEEcccccEEEEEEcccccEEEEEEccccEEEEEcccccEEEEEEEcccccEEEEEEccccccEEEEEEccccEEEEEcccccccEEEccccccEEEEEEEEcccccEEEEEEcccEEEEEEccccEEEEEcccccccEEEEEEcccccEEEEEcccccEEEEEcccccEEEEEEcccccEEEEEEcccccEEEEEEcccEEEEEEccccEEEEEcccccEEEEEEEEEEEEEEEEcccEEEEccccEEccEEEcccccccccEEEEEcccccEEEEEEcccEEEEEEEccccccccccEEEEEcccccEEEEEcccEEEEEEcccEEEEEEcccccEEEEccccEEEEEEccEEEEEEcccccEEEEEEccccEEEEEccccEEEEEEcccEEEEEEccccEEEEcccccccccccccccEEEEcccccEEEEEEEEccEEEEEccccEEEEEEccEEEEEEEccccEEEEEEEEcccEEEEEcccccEEEEEEcHHHHHHHHHHHcccHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHcccccccccHHHHHcccHHHHHHHHHHHccHHHHHHHHHHHHHcccHHHHHHHHHHHccccHHHHHHHHcccHHHHHHHHHHHHHccccHHHHHHHHHcccHHHHHHHHHHccccHHHHHHHHHccccHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHcccccccccccccccccccccccccccHHHccccccccccccccccccccccccccccccccEEEEccccccc
ccccEEEEEEEEcccccEEEEEccccccEEEEEccccEEEEEEccccEEEEEEEEccccEEEEEEcccccEEEEEccccEEEEEEccccEEEEEEEcccccEEEEEEcccccEEEEEccccEEEEEEccccccEEEEEcccccEEEEEEEccccccEEEEEccccEEEEEEccccccEEEEccccccEEEEEEcccccccEEEEEccccEEEEEEEccccEEEEEccccccEEEEEEcccccEEEEEccccEEEEEEccccEEEEEEccccccEEEEEEcccccEEEEEccccEEEEEEcccccEEEEcccccEEEEEEcEEEEEEEEEcccccEEcccccccccccccccccccccEEEEcccccEEEEEccccEEEEEEHHcHccccccccEEEEEccccEEEEEcccEEEEEEcccEEEEEEcccccHHHHcccEEEEEEcccEEEEEEcccccEEEEEEEccEEEEEcccccEEEEEEcccEEEEEccHHHHHHHHHcccccccccHHHHHHHHHHHccEEcccEEcccEEEEEccccEEEEEEcccEEEEEEccccEEEEEEEccccEEEEEEccccEEEEEEcHHHEHHHHHHHHccHHHHHHHHccccHHHHHHHHHHHHHccccHHHHHHcccccccEHEEEEcccHHHHHHHHHHcccHHHHHHHHHHHHHcccHHHHHHHHHHHccHHHHHEHHHccccHHHHHHHHHHHHHccccHHHHHHHHHcccHHHHHHHHHHccccHHHHHHHHHccccHHHHHHHHHHHHHHHccHHHHHHcccccccccccccHHHHHHHHHHHHHHccccccHHHccccccccHHHHHHHccccccHHHHHHHccccccccccccccccccHccccccccccEEEEEccccccEEEEEcccccHEEEcccccccc
MPLRLEIKRKLAQRservksvdlhpsepwilASLYSGTVCIWNYQSQTMAKSfevtelpvrsaKFVARKQWVVAGADDMFIRVYNYNTMDKVKVFEAHTDYIRcvavhptlpyvlsssdDMLIKLWDWekgwmctqifegHSHYVMQVtfnpkdtntfasASLDRTIKIwnlgspdpnftldahqkgvncvdyftggdkpylitgsddhtaKVWDYQTKSCVQtleghthnvsavcfhpelpiiitgsedgtvrIWHATTYRLENTLNYGLERVWAIGYMKSSRRIVIGYDEGTIMVKIgreepvasmdnsGKIIWAKHNeiqtvniksvgadyevtdgerlplavkelgtcdlypqslkhnpngrfvvVCGDGEYIIYTALAWrnrsfgsalefvwssdgeyavreSSSKIKIFSKNfqekrsvrptfsaeriyggTLLAMCSNDFICFYDWAECRLIRRIDVTvknlywadsgdlvaIASDTSFYILKYNRDVVSAYldsgkpvdeqGVEDAFELLHETNERvrtglwvgdcfiynnsswrlnycvggevttmfhldrpMYLLGYLASQSRVYLIDKEFNVMGYTLLLSLIEYKTLVMRGDLEraneilpsipkehHNSVARFLESRGMIEEAIEVATDPDYRFELAIQLGRLEVAQEIATEVQSESKWKQLGELAMSTGKLEMAEGCMKQAMDLSGLLLLYSSLGDAEGISKLASLAKEQGKNNVAFLCLFMLGKLEDCLQLLVESNRIPEAALMARSYLPSKVSEIVAIWRKDLqkvnpkaaesladpeeysnLFDDWQVALAVESKaaatrgvhppaedyvnhadKSYMTLVEAFRHMqieeedtlengdlahegseqngeenaeeqngeegsqeepvvvdadstdgavlvngneaeeqwvltprhqds
MPLRLEIKRklaqrservksvdlhpsepwILASLYSGTVCIWNYQSQTMAKSFEVTELPVRSAKFVARKQWVVAGADDMFIRVYNYNTMDKVKVFEAHTDYIRCVAVHPTLPYVLSSSDDMLIKLWDWEKGWMCTQIFEGHSHYVMQVTFNPKDTNTFASASLDRTIKIWNLGSPDPNFTLDAHQKGVNCVDYFTGGDKPYLITGSDDHTAKVWDYQTKSCVQTLEGHTHNVSAVCFHPELPIIITGSEDGTVRIWHATTYRLENTLNYGLERVWAIGYMKSSRRIVIGYDEGTIMVKIGREEPVASMDNSGKIIWAKHNEIQTVNIKSVGADYEVTDGERLPLAVKELGTCDLypqslkhnpngRFVVVCGDGEYIIYTALAWRNRSFGSALEFVWSSDGEyavressskikifsknfqekrsvrptfSAERIYGGTLLAMCSNDFICFYDWAECRLIRRIDVTVKNLYWADSGDLVAIASDTSFYILKYNRDVVSAYLDSGKPVDEQGVEDAFELLHETnervrtglwvgDCFIYNNSSWRLNYCVGGEVTTMFHLDRPMYLLGYLASQSRVYLIDKEFNVMGYTLLLSLIEYKTLVMRGDLERAneilpsipkehhNSVARFLESRGMIEEAIEVATDPDYRFELAIQLGRLEVAQEIATevqseskwkQLGELAMSTGKLEMAEGCMKQAMDLSGLLLLYSSLGDAEGISKLASLAKEQGKNNVAFLCLFMLGKLEDCLQLLVESNRIPEAALMARSYLPSKVSEIVAIWRKDLQKVNPKAaesladpeeYSNLFDDWQVALAVESKAAATRGVHPPAEDYVNHADKSYMTLVEAFRHMQIEEEDTLENGDLAHEGSEQNGEENAEEQNGEEGSQEEPVVVDADSTDGAVLVNGneaeeqwvltprhqds
MPLRLEIKRKLAQRSERVKSVDLHPSEPWILASLYSGTVCIWNYQSQTMAKSFEVTELPVRSAKFVARKQWVVAGADDMFIRVYNYNTMDKVKVFEAHTDYIRCVAVHPTLPYVLSSSDDMLIKLWDWEKGWMCTQIFEGHSHYVMQVTFNPKDTNTFASASLDRTIKIWNLGSPDPNFTLDAHQKGVNCVDYFTGGDKPYLITGSDDHTAKVWDYQTKSCVQTLEGHTHNVSAVCFHPELPIIITGSEDGTVRIWHATTYRLENTLNYGLERVWAIGYMKSSRRIVIGYDEGTIMVKIGREEPVASMDNSGKIIWAKHNEIQTVNIKSVGADYEVTDGERLPLAVKELGTCDLYPQSLKHNPNGRFVVVCGDGEYIIYTALAWRNRSFGSALEFVWSSDGEYAVREssskikifskNFQEKRSVRPTFSAERIYGGTLLAMCSNDFICFYDWAECRLIRRIDVTVKNLYWADSGDLVAIASDTSFYILKYNRDVVSAYLDSGKPVDEQGVEDAFELLHETNERVRTGLWVGDCFIYNNSSWRLNYCVGGEVTTMFHLDRPMYLLGYLASQSRVYLIDKEFNVMGYTLLLSLIEYKTLVMRGDLERANEILPSIPKEHHNSVARFLESRGMIEEAIEVATDPDYRFELAIQLGRLEVAQEIATEVQSESKWKQLGELAMSTGKLEMAEGCMKQAMDlsgllllysslgDAEGISKLASLAKEQGKNNVAFLCLFMLGKLEDCLQLLVESNRIPEAALMARSYLPSKVSEIVAIWRKDLQKVNPKAAESLADPEEYSNLFDDWQVALAVESKAAATRGVHPPAEDYVNHADKSYMTLVEAFRHMQIEEEDTLENGDLAHegseqngeenaeeqngeegsqeePVVVDADSTDGAVLVNGNEAEEQWVLTPRHQDS
**************************EPWILASLYSGTVCIWNYQSQTMAKSFEVTELPVRSAKFVARKQWVVAGADDMFIRVYNYNTMDKVKVFEAHTDYIRCVAVHPTLPYVLSSSDDMLIKLWDWEKGWMCTQIFEGHSHYVMQVTFNPKDTNTFASASLDRTIKIWNLGSPDPNFTLDAHQKGVNCVDYFTGGDKPYLITGSDDHTAKVWDYQTKSCVQTLEGHTHNVSAVCFHPELPIIITGSEDGTVRIWHATTYRLENTLNYGLERVWAIGYMKSSRRIVIGYDEGTIMVKIGREEPVASMDNSGKIIWAKHNEIQTVNIKSVGADYEVTDGERLPLAVKELGTCDLYPQSLKHNPNGRFVVVCGDGEYIIYTALAWRNRSFGSALEFVWSSDGEYAVRE***KIKIFSKNF****SVRPTFSAERIYGGTLLAMCSNDFICFYDWAECRLIRRIDVTVKNLYWADSGDLVAIASDTSFYILKYNRDVVSAYLDSGKPVDEQGVEDAFELLHETNERVRTGLWVGDCFIYNNSSWRLNYCVGGEVTTMFHLDRPMYLLGYLASQSRVYLIDKEFNVMGYTLLLSLIEYKTLVMRGDLERANEILPSIPKEHHNSVARFLESRGMIEEAIEVATDPDYRFELAIQLGRLEVAQEIATEVQ***KWKQLGELAMSTGKLEMAEGCMKQAMDLSGLLLLYSSLGDAEGISKLASLAKEQGKNNVAFLCLFMLGKLEDCLQLLVESNRIPEAALMARSYLPSKVSEIVAIWRKDLQKV************EYSNLFDDWQVALAVESKAAATRGVH**AEDYVNHADKSYMTLVEAFRHM***********************************************************************
*PLRLEIKRKLAQRSERVKSVDLHPSEPWILASLYSGTVCIWNYQSQTMAKSFEVTELPVRSAKFVARKQWVVAGADDMFIRVYNYNTMDKVKVFEAHTDYIRCVAVHPTLPYVLSSSDDMLIKLWDWEKGWMCTQIFEGHSHYVMQVTFNPKDTNTFASASLDRTIKIWNLGSPDPNFTLDAHQKGVNCVDYFTGGDKPYLITGSDDHTAKVWDYQTKSCVQTLEGHTHNVSAVCFHPELPIIITGSEDGTVRIWHATTYRLENTLNYGLERVWAIGYMKSSRRIVIGYDEGTIMVKIGREEPVASMDNSGKIIWAKHNEIQTVNIKSVGADYEVTDGERLPLAVKELGTCDLYPQSLKHNPNGRFVVVCGDGEYIIYTALAWRNRSFGSALEFVWSSDGEYAVRESSSKIKIFSKNFQEKRSVRPTFSAERIYGGTLLAMCSNDFICFYDWAECRLIRRIDVTVKNLYWADSGDLVAIASDTSFYILKYNRDVVSAYLDSGKPVDEQGVEDAFELLHETNERVRTGLWVGDCFIYNNSSWRLNYCVGGEVTTMFHLDRPMYLLGYLASQSRVYLIDKEFNVMGYTLLLSLIEYKTLVMRGDLERANEILPSIPKEHHNSVARFLESRGMIEEAIEVATDPDYRFELAIQLGRLEVAQEIATEVQSESKWKQLGELAMSTGKLEMAEGCMKQAMDLSGLLLLYSSLGDAEGISKLAS*AKEQGKNNVAFLCLFMLGKLEDCLQLLVESNRIPEAALMARSYLPSKVSEIV**********************EYSNLFDDWQVAL****************************TLVEAFR*****************EGSEQNGEENAEEQNGEEGSQEEPVVVDADST************************
MPLRLEIKRKLAQRSERVKSVDLHPSEPWILASLYSGTVCIWNYQSQTMAKSFEVTELPVRSAKFVARKQWVVAGADDMFIRVYNYNTMDKVKVFEAHTDYIRCVAVHPTLPYVLSSSDDMLIKLWDWEKGWMCTQIFEGHSHYVMQVTFNPKDTNTFASASLDRTIKIWNLGSPDPNFTLDAHQKGVNCVDYFTGGDKPYLITGSDDHTAKVWDYQTKSCVQTLEGHTHNVSAVCFHPELPIIITGSEDGTVRIWHATTYRLENTLNYGLERVWAIGYMKSSRRIVIGYDEGTIMVKIGREEPVASMDNSGKIIWAKHNEIQTVNIKSVGADYEVTDGERLPLAVKELGTCDLYPQSLKHNPNGRFVVVCGDGEYIIYTALAWRNRSFGSALEFVWSSDGEYAVRESSSKIKIFSKNFQEKRSVRPTFSAERIYGGTLLAMCSNDFICFYDWAECRLIRRIDVTVKNLYWADSGDLVAIASDTSFYILKYNRDVVSAYLDSGKPVDEQGVEDAFELLHETNERVRTGLWVGDCFIYNNSSWRLNYCVGGEVTTMFHLDRPMYLLGYLASQSRVYLIDKEFNVMGYTLLLSLIEYKTLVMRGDLERANEILPSIPKEHHNSVARFLESRGMIEEAIEVATDPDYRFELAIQLGRLEVAQEIATEVQSESKWKQLGELAMSTGKLEMAEGCMKQAMDLSGLLLLYSSLGDAEGISKLASLAKEQGKNNVAFLCLFMLGKLEDCLQLLVESNRIPEAALMARSYLPSKVSEIVAIWRKDLQKVNPKAAESLADPEEYSNLFDDWQVALAVESKAAATRGVHPPAEDYVNHADKSYMTLVEAFRHMQIEEEDTLENGDLAH**************************VDADSTDGAVLVNGNEAEEQW*********
*PLRLEIKRKLAQRSERVKSVDLHPSEPWILASLYSGTVCIWNYQSQTMAKSFEVTELPVRSAKFVARKQWVVAGADDMFIRVYNYNTMDKVKVFEAHTDYIRCVAVHPTLPYVLSSSDDMLIKLWDWEKGWMCTQIFEGHSHYVMQVTFNPKDTNTFASASLDRTIKIWNLGSPDPNFTLDAHQKGVNCVDYFTGGDKPYLITGSDDHTAKVWDYQTKSCVQTLEGHTHNVSAVCFHPELPIIITGSEDGTVRIWHATTYRLENTLNYGLERVWAIGYMKSSRRIVIGYDEGTIMVKIGREEPVASMDNSGKIIWAKHNEIQTVNIKSVGADYEVTDGERLPLAVKELGTCDLYPQSLKHNPNGRFVVVCGDGEYIIYTALAWRNRSFGSALEFVWSSDGEYAVRESSSKIKIFSKNFQEKRSVRPTFSAERIYGGTLLAMCSNDFICFYDWAECRLIRRIDVTVKNLYWADSGDLVAIASDTSFYILKYNRDVVSAYLDSGKPVDEQGVEDAFELLHETNERVRTGLWVGDCFIYNNSSWRLNYCVGGEVTTMFHLDRPMYLLGYLASQSRVYLIDKEFNVMGYTLLLSLIEYKTLVMRGDLERANEILPSIPKEHHNSVARFLESRGMIEEAIEVATDPDYRFELAIQLGRLEVAQEIATEVQSESKWKQLGELAMSTGKLEMAEGCMKQAMDLSGLLLLYSSLGDAEGISKLASLAKEQGKNNVAFLCLFMLGKLEDCLQLLVESNRIPEAALMARSYLPSKVSEIVAIWRKDLQKVNPKAAESLADPEEYSNLFDDWQVALAVESKAAATRGVHPPAEDY*****KSYMTLVEAFRH**************************************EPVVVDADSTDGAVLVNGNEAEEQWVLT******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPLRLEIKRKLAQRSERVKSVDLHPSEPWILASLYSGTVCIWNYQSQTMAKSFEVTELPVRSAKFVARKQWVVAGADDMFIRVYNYNTMDKVKVFEAHTDYIRCVAVHPTLPYVLSSSDDMLIKLWDWEKGWMCTQIFEGHSHYVMQVTFNPKDTNTFASASLDRTIKIWNLGSPDPNFTLDAHQKGVNCVDYFTGGDKPYLITGSDDHTAKVWDYQTKSCVQTLEGHTHNVSAVCFHPELPIIITGSEDGTVRIWHATTYRLENTLNYGLERVWAIGYMKSSRRIVIGYDEGTIMVKIGREEPVASMDNSGKIIWAKHNEIQTVNIKSVGADYEVTDGERLPLAVKELGTCDLYPQSLKHNPNGRFVVVCGDGEYIIYTALAWRNRSFGSALEFVWSSDGEYAVRESSSKIKIFSKNFQEKRSVRPTFSAERIYGGTLLAMCSNDFICFYDWAECRLIRRIDVTVKNLYWADSGDLVAIASDTSFYILKYNRDVVSAYLDSGKPVDEQGVEDAFELLHETNERVRTGLWVGDCFIYNNSSWRLNYCVGGEVTTMFHLDRPMYLLGYLASQSRVYLIDKEFNVMGYTLLLSLIEYKTLVMRGDLERANEILPSIPKEHHNSVARFLESRGMIEEAIEVATDPDYRFELAIQLGRLEVAQEIATEVQSESKWKQLGELAMSTGKLEMAEGCMKQAMDLSGLLLLYSSLGDAEGISKLASLAKEQGKNNVAFLCLFMLGKLEDCLQLLVESNRIPEAALMARSYLPSKVSEIVAIWRKDLQKVNPKAAESLADPEEYSNLFDDWQVALAVESKAAATRGVHPPAEDYVNHADKSYMTLVEAFRHMQIEEEDTLENGDLAHEGSEQNGEENAEEQNGEEGSQEEPVVVDADSTDGAVLVNGNEAEEQWVLTPRHQDS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query914 2.2.26 [Sep-21-2011]
Q9C827926 Coatomer subunit beta'-2 yes no 0.987 0.975 0.872 0.0
Q9CAA0920 Coatomer subunit beta'-1 no no 0.992 0.985 0.860 0.0
Q8L828909 Coatomer subunit beta'-3 no no 0.989 0.994 0.861 0.0
Q5VQ78907 Coatomer subunit beta'-1 yes no 0.986 0.994 0.849 0.0
Q6H8D5910 Coatomer subunit beta'-2 no no 0.980 0.984 0.824 0.0
Q6H8D6910 Putative coatomer subunit no no 0.980 0.984 0.820 0.0
O55029905 Coatomer subunit beta' OS yes no 0.900 0.909 0.617 0.0
P35606906 Coatomer subunit beta' OS yes no 0.900 0.908 0.616 0.0
Q5R664906 Coatomer subunit beta' OS yes no 0.900 0.908 0.616 0.0
P35605906 Coatomer subunit beta' OS yes no 0.900 0.908 0.616 0.0
>sp|Q9C827|COB22_ARATH Coatomer subunit beta'-2 OS=Arabidopsis thaliana GN=At1g52360 PE=2 SV=1 Back     alignment and function desciption
 Score = 1665 bits (4313), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 801/918 (87%), Positives = 866/918 (94%), Gaps = 15/918 (1%)

Query: 1   MPLRLEIKRKLAQRSERVKSVDLHPSEPWILASLYSGTVCIWNYQSQTMAKSFEVTELPV 60
           MPLRLEIKRKLAQRSERVKSVDLHP+EPWILASLYSGT+CIWNYQ+Q MAKSFEVTELPV
Sbjct: 1   MPLRLEIKRKLAQRSERVKSVDLHPTEPWILASLYSGTLCIWNYQTQVMAKSFEVTELPV 60

Query: 61  RSAKFVARKQWVVAGADDMFIRVYNYNTMDKVKVFEAHTDYIRCVAVHPTLPYVLSSSDD 120
           RSAKFVARKQWVVAGADDM+IRVYNYNTMDKVKVFEAH+DYIRCVAVHPTLPYVLSSSDD
Sbjct: 61  RSAKFVARKQWVVAGADDMYIRVYNYNTMDKVKVFEAHSDYIRCVAVHPTLPYVLSSSDD 120

Query: 121 MLIKLWDWEKGWMCTQIFEGHSHYVMQVTFNPKDTNTFASASLDRTIKIWNLGSPDPNFT 180
           MLIKLWDWEKGW CTQIFEGHSHYVMQVTFNPKDTNTFASASLDRTIKIWNLGSPDPNFT
Sbjct: 121 MLIKLWDWEKGWACTQIFEGHSHYVMQVTFNPKDTNTFASASLDRTIKIWNLGSPDPNFT 180

Query: 181 LDAHQKGVNCVDYFTGGDKPYLITGSDDHTAKVWDYQTKSCVQTLEGHTHNVSAVCFHPE 240
           LDAHQKGVNCVDYFTGGDKPYLITGSDDHTAKVWDYQTKSCVQTLEGHTHNVSAVCFHPE
Sbjct: 181 LDAHQKGVNCVDYFTGGDKPYLITGSDDHTAKVWDYQTKSCVQTLEGHTHNVSAVCFHPE 240

Query: 241 LPIIITGSEDGTVRIWHATTYRLENTLNYGLERVWAIGYMKSSRRIVIGYDEGTIMVKIG 300
           LPIIITGSEDGTVRIWHATTYRLENTLNYGLERVWAIGY+KSSRR+VIGYDEGTIMVK+G
Sbjct: 241 LPIIITGSEDGTVRIWHATTYRLENTLNYGLERVWAIGYIKSSRRVVIGYDEGTIMVKLG 300

Query: 301 REEPVASMDNSGKIIWAKHNEIQTVNIKSVGADYEVTDGERLPLAVKELGTCDLYPQSLK 360
           RE PVASMDN+GKIIWAKHNEIQT NIKS+GADYEVTDGERLPL+VKELGTCDLYPQSLK
Sbjct: 301 REIPVASMDNTGKIIWAKHNEIQTANIKSIGADYEVTDGERLPLSVKELGTCDLYPQSLK 360

Query: 361 HNPNGRFVVVCGDGEYIIYTALAWRNRSFGSALEFVWSSDGEYAVRESSSKIKIFSKNFQ 420
           HNPNGRFVVVCGDGEYIIYTALAWRNRSFGS LEFVWSS+GE AVRESSSKIKIFSKNFQ
Sbjct: 361 HNPNGRFVVVCGDGEYIIYTALAWRNRSFGSGLEFVWSSEGECAVRESSSKIKIFSKNFQ 420

Query: 421 EKRSVRPTFSAERIYGGTLLAMCSNDFICFYDWAECRLIRRIDVTVKNLYWADSGDLVAI 480
           EKRS+RPTFSAE+I+GGTLLAMCS+DFICFYDWAECRLI+RIDVTVKNLYWADSGDLVAI
Sbjct: 421 EKRSIRPTFSAEKIFGGTLLAMCSSDFICFYDWAECRLIQRIDVTVKNLYWADSGDLVAI 480

Query: 481 ASDTSFYILKYNRDVVSAYLDSGKPVDEQGVEDAFELLHETNERVRTGLWVGDCFIYNNS 540
           ASDTSFYILK+NRD+V+++ DSG+P +E+GVEDAFE+LHE +ERVRTG+WVGDCFIYNNS
Sbjct: 481 ASDTSFYILKFNRDLVTSHFDSGRPTEEEGVEDAFEVLHENDERVRTGIWVGDCFIYNNS 540

Query: 541 SWRLNYCVGGEVTTMFHLDRPMYLLGYLASQSRVYLIDKEFNVMGYTLLLSLIEYKTLVM 600
           SW+LNYCVGGEVTTM+HLDRPMYLLGYLASQSRV+L+DKEFNV+GYTLLLSLIEYKTLVM
Sbjct: 541 SWKLNYCVGGEVTTMYHLDRPMYLLGYLASQSRVFLVDKEFNVIGYTLLLSLIEYKTLVM 600

Query: 601 RGDLERANEILPSIPKEHHNSVARFLESRGMIEEAIEVATDPDYRFELAIQLGRLEVAQE 660
           RGDL++A+EILP+IPK+ HNSVA FLESRGMIE+A+E+ATDPDYRFELAIQLGRLE+AQE
Sbjct: 601 RGDLDKASEILPTIPKDQHNSVAHFLESRGMIEDALEIATDPDYRFELAIQLGRLEIAQE 660

Query: 661 IATEVQSESKWKQLGELAMSTGKLEMAEGCMKQAMDLSGLLLLYSSLGDAEGISKLASLA 720
           IA EVQSESKWKQLGELAMS+GKL+MAE CMK AMDLSGLLLLYSSLGDAEG++KLA+LA
Sbjct: 661 IAVEVQSESKWKQLGELAMSSGKLQMAEECMKYAMDLSGLLLLYSSLGDAEGVTKLATLA 720

Query: 721 KEQGKNNVAFLCLFMLGKLEDCLQLLVESNRIPEAALMARSYLPSKVSEIVAIWRKDLQK 780
           KEQGKNNVAFLCLFMLGKLEDCLQLLVESNRIPEAALMARSYLPSKVSEIVA+WRKDL K
Sbjct: 721 KEQGKNNVAFLCLFMLGKLEDCLQLLVESNRIPEAALMARSYLPSKVSEIVALWRKDLSK 780

Query: 781 VNPKAAESLADPEEYSNLFDDWQVALAVESKAAATRGVHPPAEDYVNHADKSYMTLVEAF 840
           VN KAAESLADPEEYSNLF+DWQVAL+VE+KA  TRGV+  A+DY +HADKS MTLVEAF
Sbjct: 781 VNSKAAESLADPEEYSNLFEDWQVALSVEAKAVETRGVYTGAKDYPSHADKSSMTLVEAF 840

Query: 841 RHMQIEEEDTLENGDLAHEGSEQNGEENAEEQNGEEGSQEEPV-------------VVDA 887
           R++Q+EEE++LENGD+ HE  E   EEN  EQ  E+   E                +VD 
Sbjct: 841 RNLQVEEEESLENGDMDHE--EVVAEENGNEQRNEDDVAEHVEEHHEEKEAEEEEGIVDG 898

Query: 888 DSTDGAVLVNGNEAEEQW 905
           DSTDGAVLVNG+EA+E+W
Sbjct: 899 DSTDGAVLVNGSEADEEW 916
The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. Coatomer complex is required for budding from Golgi membranes, and is essential for the retrograde Golgi-to-ER transport of dilysine-tagged proteins.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9CAA0|COB21_ARATH Coatomer subunit beta'-1 OS=Arabidopsis thaliana GN=At1g79990 PE=2 SV=2 Back     alignment and function description
>sp|Q8L828|COB23_ARATH Coatomer subunit beta'-3 OS=Arabidopsis thaliana GN=At3g15980 PE=2 SV=1 Back     alignment and function description
>sp|Q5VQ78|COB21_ORYSJ Coatomer subunit beta'-1 OS=Oryza sativa subsp. japonica GN=Os06g0143900 PE=2 SV=1 Back     alignment and function description
>sp|Q6H8D5|COB22_ORYSJ Coatomer subunit beta'-2 OS=Oryza sativa subsp. japonica GN=Os02g0209100 PE=2 SV=1 Back     alignment and function description
>sp|Q6H8D6|COB23_ORYSJ Putative coatomer subunit beta'-3 OS=Oryza sativa subsp. japonica GN=Os02g0209000 PE=3 SV=2 Back     alignment and function description
>sp|O55029|COPB2_MOUSE Coatomer subunit beta' OS=Mus musculus GN=Copb2 PE=2 SV=2 Back     alignment and function description
>sp|P35606|COPB2_HUMAN Coatomer subunit beta' OS=Homo sapiens GN=COPB2 PE=1 SV=2 Back     alignment and function description
>sp|Q5R664|COPB2_PONAB Coatomer subunit beta' OS=Pongo abelii GN=COPB2 PE=2 SV=1 Back     alignment and function description
>sp|P35605|COPB2_BOVIN Coatomer subunit beta' OS=Bos taurus GN=COPB2 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query914
255574556914 coatomer beta subunit, putative [Ricinus 0.987 0.987 0.932 0.0
359482613952 PREDICTED: coatomer subunit beta'-2-like 0.987 0.948 0.924 0.0
224058817922 predicted protein [Populus trichocarpa] 0.989 0.980 0.924 0.0
297743300933 unnamed protein product [Vitis vinifera] 0.981 0.961 0.923 0.0
356526157905 PREDICTED: coatomer subunit beta'-2-like 0.987 0.997 0.924 0.0
356556032920 PREDICTED: coatomer subunit beta'-2-like 0.990 0.983 0.916 0.0
147789985901 hypothetical protein VITISV_004513 [Viti 0.973 0.987 0.921 0.0
356550555916 PREDICTED: coatomer subunit beta'-2-like 0.996 0.994 0.918 0.0
449448050907 PREDICTED: coatomer subunit beta'-2-like 0.991 0.998 0.905 0.0
449491719907 PREDICTED: coatomer subunit beta'-2-like 0.991 0.998 0.904 0.0
>gi|255574556|ref|XP_002528189.1| coatomer beta subunit, putative [Ricinus communis] gi|223532401|gb|EEF34196.1| coatomer beta subunit, putative [Ricinus communis] Back     alignment and taxonomy information
 Score = 1752 bits (4538), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 845/906 (93%), Positives = 883/906 (97%), Gaps = 3/906 (0%)

Query: 1   MPLRLEIKRKLAQRSERVKSVDLHPSEPWILASLYSGTVCIWNYQSQTMAKSFEVTELPV 60
           MPLRLEIKRKLAQRSERVKSVDLHP+EPWIL SLYSGTVCIWNYQSQTMAKSFEVTELPV
Sbjct: 1   MPLRLEIKRKLAQRSERVKSVDLHPTEPWILVSLYSGTVCIWNYQSQTMAKSFEVTELPV 60

Query: 61  RSAKFVARKQWVVAGADDMFIRVYNYNTMDKVKVFEAHTDYIRCVAVHPTLPYVLSSSDD 120
           RSAKF+ARKQWVVAGADDMFIRVYNYNTMDK+KVFEAHTDYIRCVAVHPTLPYVLSSSDD
Sbjct: 61  RSAKFIARKQWVVAGADDMFIRVYNYNTMDKIKVFEAHTDYIRCVAVHPTLPYVLSSSDD 120

Query: 121 MLIKLWDWEKGWMCTQIFEGHSHYVMQVTFNPKDTNTFASASLDRTIKIWNLGSPDPNFT 180
           MLIKLWDWEKGW+CTQIFEGHSHYVMQVTFNPKDTNTFASASLDRTIKIWNLGSPDPNFT
Sbjct: 121 MLIKLWDWEKGWVCTQIFEGHSHYVMQVTFNPKDTNTFASASLDRTIKIWNLGSPDPNFT 180

Query: 181 LDAHQKGVNCVDYFTGGDKPYLITGSDDHTAKVWDYQTKSCVQTLEGHTHNVSAVCFHPE 240
           LDAHQKGVNCVDYFTGGDKPYLITGSDDHTAKVWDYQTKSCVQTLEGHTHNVSAVCFHPE
Sbjct: 181 LDAHQKGVNCVDYFTGGDKPYLITGSDDHTAKVWDYQTKSCVQTLEGHTHNVSAVCFHPE 240

Query: 241 LPIIITGSEDGTVRIWHATTYRLENTLNYGLERVWAIGYMKSSRRIVIGYDEGTIMVKIG 300
           LPIIITGSEDGTVR+WH+TTYRLENTLNYGLERVWA+GYMK SRRIVIGYDEGTIMVKIG
Sbjct: 241 LPIIITGSEDGTVRLWHSTTYRLENTLNYGLERVWAVGYMKGSRRIVIGYDEGTIMVKIG 300

Query: 301 REEPVASMDNSGKIIWAKHNEIQTVNIKSVGADYEVTDGERLPLAVKELGTCDLYPQSLK 360
           REEPVASMDNSGKIIWAKHNEIQTVNIKSVGAD+EVTDGERLPLAVKELGTCDLYPQSLK
Sbjct: 301 REEPVASMDNSGKIIWAKHNEIQTVNIKSVGADFEVTDGERLPLAVKELGTCDLYPQSLK 360

Query: 361 HNPNGRFVVVCGDGEYIIYTALAWRNRSFGSALEFVWSSDGEYAVRESSSKIKIFSKNFQ 420
           HNPNGRFVVVCGDGEYIIYTALAWRNRSFGSALEFVWSSDGEYAVRES+SKIKIFSKNFQ
Sbjct: 361 HNPNGRFVVVCGDGEYIIYTALAWRNRSFGSALEFVWSSDGEYAVRESTSKIKIFSKNFQ 420

Query: 421 EKRSVRPTFSAERIYGGTLLAMCSNDFICFYDWAECRLIRRIDVTVKNLYWADSGDLVAI 480
           EKRSVRPTFSAERI+GGTLLAMC+NDFICFYDWAECRLIRRIDVTVKNLYWADSGDLVAI
Sbjct: 421 EKRSVRPTFSAERIFGGTLLAMCANDFICFYDWAECRLIRRIDVTVKNLYWADSGDLVAI 480

Query: 481 ASDTSFYILKYNRDVVSAYLDSGKPVDEQGVEDAFELLHETNERVRTGLWVGDCFIYNNS 540
           ASDTSFYILKYNRD+VS+YLDSG+PVDEQGVEDAFELLHETNERVRTGLWVGDCFIYNNS
Sbjct: 481 ASDTSFYILKYNRDLVSSYLDSGRPVDEQGVEDAFELLHETNERVRTGLWVGDCFIYNNS 540

Query: 541 SWRLNYCVGGEVTTMFHLDRPMYLLGYLASQSRVYLIDKEFNVMGYTLLLSLIEYKTLVM 600
           SWRLNYCVGGEVTTM+HLDRPMYLLGYLASQSRVYLIDKEFNVMGYTLLLSLIEYKTLVM
Sbjct: 541 SWRLNYCVGGEVTTMYHLDRPMYLLGYLASQSRVYLIDKEFNVMGYTLLLSLIEYKTLVM 600

Query: 601 RGDLERANEILPSIPKEHHNSVARFLESRGMIEEAIEVATDPDYRFELAIQLGRLEVAQE 660
           RGDLERANE+LPSIPKEHHNSVARFLESRGMIE A+EVATDPDY+FELAIQLGRLE+A+E
Sbjct: 601 RGDLERANELLPSIPKEHHNSVARFLESRGMIENALEVATDPDYKFELAIQLGRLEIAKE 660

Query: 661 IATEVQSESKWKQLGELAMSTGKLEMAEGCMKQAMDLSGLLLLYSSLGDAEGISKLASLA 720
           IATEVQSESKWKQLGELA+STGKLEMAE CMK+A DLSGLLLLYSSLGDAEGISKLA LA
Sbjct: 661 IATEVQSESKWKQLGELAISTGKLEMAEECMKRATDLSGLLLLYSSLGDAEGISKLAPLA 720

Query: 721 KEQGKNNVAFLCLFMLGKLEDCLQLLVESNRIPEAALMARSYLPSKVSEIVAIWRKDLQK 780
           KEQGKNNVAFLCLFMLGKLEDCLQ+LVESNRIPEAALMARSYLPSKV EIVA+WRKDL K
Sbjct: 721 KEQGKNNVAFLCLFMLGKLEDCLQILVESNRIPEAALMARSYLPSKVPEIVALWRKDLNK 780

Query: 781 VNPKAAESLADPEEYSNLFDDWQVALAVESKAAATRGVHPPAEDYVNHADKSYMTLVEAF 840
           VNPKAAESLADP+EY NLFDDWQVAL+VE++ A TRGV+PPAE+Y+NHAD++ +TLVEAF
Sbjct: 781 VNPKAAESLADPDEYPNLFDDWQVALSVETRVAETRGVYPPAEEYLNHADRTNITLVEAF 840

Query: 841 RHMQIEEEDTLENGDLAHEGSEQNGEEN-AEEQNGEEGSQEEPVVVDADSTDGAVLVNGN 899
           R+MQ+EE   LENGD  HE +EQNGEE   EE NGEEGSQEE VVVDADSTDGAVLVNGN
Sbjct: 841 RNMQVEE--PLENGDYDHEAAEQNGEEQIIEEHNGEEGSQEEAVVVDADSTDGAVLVNGN 898

Query: 900 EAEEQW 905
           EAEE+W
Sbjct: 899 EAEEEW 904

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359482613|ref|XP_002284773.2| PREDICTED: coatomer subunit beta'-2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224058817|ref|XP_002299635.1| predicted protein [Populus trichocarpa] gi|222846893|gb|EEE84440.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297743300|emb|CBI36167.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356526157|ref|XP_003531686.1| PREDICTED: coatomer subunit beta'-2-like [Glycine max] Back     alignment and taxonomy information
>gi|356556032|ref|XP_003546331.1| PREDICTED: coatomer subunit beta'-2-like [Glycine max] Back     alignment and taxonomy information
>gi|147789985|emb|CAN59846.1| hypothetical protein VITISV_004513 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356550555|ref|XP_003543651.1| PREDICTED: coatomer subunit beta'-2-like [Glycine max] Back     alignment and taxonomy information
>gi|449448050|ref|XP_004141779.1| PREDICTED: coatomer subunit beta'-2-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449491719|ref|XP_004158983.1| PREDICTED: coatomer subunit beta'-2-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query914
TAIR|locus:20162141135 AT1G79990 [Arabidopsis thalian 0.992 0.799 0.836 0.0
ZFIN|ZDB-GENE-010724-7934 copb2 "coatomer protein comple 0.900 0.881 0.607 4.9e-291
UNIPROTKB|P35606906 COPB2 "Coatomer subunit beta'" 0.900 0.908 0.601 1e-290
UNIPROTKB|F1SL54906 COPB2 "Uncharacterized protein 0.900 0.908 0.601 2.1e-290
UNIPROTKB|P35605906 COPB2 "Coatomer subunit beta'" 0.900 0.908 0.601 3.4e-290
RGD|628746905 Copb2 "coatomer protein comple 0.900 0.909 0.600 3.4e-290
UNIPROTKB|E1C016913 COPB2 "Uncharacterized protein 0.900 0.901 0.604 5.6e-290
MGI|MGI:1354962905 Copb2 "coatomer protein comple 0.900 0.909 0.602 3.1e-289
UNIPROTKB|E2R667906 COPB2 "Uncharacterized protein 0.900 0.908 0.602 6.4e-289
UNIPROTKB|B4DZI8877 COPB2 "Coatomer protein comple 0.868 0.905 0.593 7.2e-277
TAIR|locus:2016214 AT1G79990 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 4077 (1440.2 bits), Expect = 0., P = 0.
 Identities = 767/917 (83%), Positives = 824/917 (89%)

Query:     2 PLRLEIKRKLAQRSERVKSVDLHPSEPWILASLYSGTVCIWNYQSQTMAKSFEVTELPVR 61
             PLRLEIKRK AQRSERVKSVDLHP+EPWILASLYSGT+CIWNYQ+QTM KSF+VTELPVR
Sbjct:   217 PLRLEIKRKFAQRSERVKSVDLHPTEPWILASLYSGTLCIWNYQTQTMVKSFDVTELPVR 276

Query:    62 SAKFVARKQWVVAGADDMFIRVYNYNTMDKVKVFEAHTDYIRCVAVHPTLPYVLSSSDDM 121
             SAKF+ARKQWVVAGADDMFIRVYNYNTMDK+KVFEAH DYIRCVAVHPTLPYVLSSSDDM
Sbjct:   277 SAKFIARKQWVVAGADDMFIRVYNYNTMDKIKVFEAHADYIRCVAVHPTLPYVLSSSDDM 336

Query:   122 LIKLWDWEKGWMCTQIFEGHSHYVMQVTFNPKDTNTFASASLDRTIKIWNLGSPDPNFTL 181
             LIKLWDWEKGW+CTQIFEGHSHYVMQVTFNPKDTNTFASASLDRTIKIWNLGSPDPNFTL
Sbjct:   337 LIKLWDWEKGWLCTQIFEGHSHYVMQVTFNPKDTNTFASASLDRTIKIWNLGSPDPNFTL 396

Query:   182 DAHQKGVNCVDYFTGGDKPYLITGSDDHTAKVWDYQTKSCVQTLEGHTHNVSAVCFHPEL 241
             DAH KGVNCVDYFTGGDKPYLITGSDDHTAKVWDYQTKSCVQTLEGHTHNVSAV FHPEL
Sbjct:   397 DAHLKGVNCVDYFTGGDKPYLITGSDDHTAKVWDYQTKSCVQTLEGHTHNVSAVSFHPEL 456

Query:   242 PIIITGSEDGTVRIWHATTYRLENTLNYGLERVWAIGYMKSSRRIVIGYDEGTIMVKIGR 301
             PIIITGSEDGTVRIWHATTYRLENTLNYGLERVWAIG++K SRR+VIGYDEG+IMVK+GR
Sbjct:   457 PIIITGSEDGTVRIWHATTYRLENTLNYGLERVWAIGHIKGSRRVVIGYDEGSIMVKLGR 516

Query:   302 EEPVASMDNSGKIIWAKHNEIQTVNIKSVGADYEVTDGERLPLAVKELGTCDLYPQSLKH 361
             E PVASMDNSGKIIWAKHNEI TVNIKSVGAD EVTDGERLPLAVKELGTCDLYPQSLKH
Sbjct:   517 EIPVASMDNSGKIIWAKHNEIHTVNIKSVGAD-EVTDGERLPLAVKELGTCDLYPQSLKH 575

Query:   362 NPNGRFVVVCGDGEYIIYTALAWRNRSFGSALEFVWSSDGEYAVREXXXXXXXXXXNFQE 421
             NPNGRFVVVCGDGEYIIYTALAWRNRSFGSALEFVWSSDGE+AVRE          NFQE
Sbjct:   576 NPNGRFVVVCGDGEYIIYTALAWRNRSFGSALEFVWSSDGEHAVRESSTKIKIFSKNFQE 635

Query:   422 KRSVRPTFSAERIYGGTLLAMCSNDFICFYDWAECRLIRRIDVTVKNLYWADSGDLVAIA 481
             K++VRPTFSAE I+GGTLL MCS+DFICFYDWAECRLIRRIDVTVKNLYWADSGDLVAIA
Sbjct:   636 KKTVRPTFSAEHIFGGTLLTMCSSDFICFYDWAECRLIRRIDVTVKNLYWADSGDLVAIA 695

Query:   482 SDTSFYILKYNRDVVSAYLDSGKPVDEQGVEDAFELLHETNERVRTGLWVGDCFIYNNSS 541
             SDTSFYILK+NRD+VS+Y D GK +DE+G+EDAFELL+ETNERVRTGLWVGDCFIY NSS
Sbjct:   696 SDTSFYILKFNRDIVSSYFDGGKQIDEEGIEDAFELLNETNERVRTGLWVGDCFIYTNSS 755

Query:   542 WRLNYCVGGEVTTMFHLDRPMYLLGYLASQSRVYLIDKEFNVMGYTLLLSLIEYKTLVMR 601
             WRLNYCVGGEVTTM+HLDRPMYLLGYLA+QSRVYLIDKEFNV+GYTLLLSLIEYKTLVMR
Sbjct:   756 WRLNYCVGGEVTTMYHLDRPMYLLGYLANQSRVYLIDKEFNVIGYTLLLSLIEYKTLVMR 815

Query:   602 GDLERANEILPSIPKEHHNSVARFLESRGMIEEAIEVATDPDYRFELAIQLGRLEVAQEI 661
             GDLE+ANE+LPSIPKEHHNSVA FLESRGM E+A+EVATDPDYRFELAIQLGRL VA++I
Sbjct:   816 GDLEQANEVLPSIPKEHHNSVAHFLESRGMTEDALEVATDPDYRFELAIQLGRLAVAKDI 875

Query:   662 ATEVQSESKWKQLGELAMSTGKLEMAEGCMKQAMDXXXXXXXXXXXXDAEGISKLASLAK 721
             A E Q+ESKWKQLGELAMS+GKL+MAE CM+ AMD            DA+G+ KLA+LAK
Sbjct:   876 AVEAQNESKWKQLGELAMSSGKLDMAEECMRHAMDLSGLLLLYSSLGDADGMMKLAALAK 935

Query:   722 EQGKNNVAFLCLFMLGKLEDCLQLLVESNRIPEAALMARSYLPSKVSEIVAIWRKDLQKV 781
             EQGKNNVAFLCLFMLG++EDCL LLVESNRIPEAALMARSYLPSKVSEIVA+WR DL K+
Sbjct:   936 EQGKNNVAFLCLFMLGQVEDCLHLLVESNRIPEAALMARSYLPSKVSEIVALWRNDLTKI 995

Query:   782 NPKAAESLADPEEYSNLFDDWQVALAVESKAAATRGVHPPAEDYVNHADKSYMTLVEAFR 841
             +PKAAESLADPEEY NLF++WQVAL++E++AA TRGVHPPA DY +HAD+ + TLV+AFR
Sbjct:   996 SPKAAESLADPEEYPNLFEEWQVALSLENRAAETRGVHPPAGDYCSHADRDHTTLVDAFR 1055

Query:   842 HMQIEEEDTLENGDLAHXXXXXXXXXXXXXXXXXXXXXXX---------PVVVDADSTDG 892
              MQIEEE  LE GD+                                   VVVDADSTDG
Sbjct:  1056 IMQIEEEGRLEQGDVLDEVGEEGEDGEEEEEEDRQEESSDGRQQNVEEEAVVVDADSTDG 1115

Query:   893 AVLVNGNEAEEQWVLTP 909
             AVLVNGNE+EEQWVLTP
Sbjct:  1116 AVLVNGNESEEQWVLTP 1132
GO:0000139 "Golgi membrane" evidence=IEA
GO:0005198 "structural molecule activity" evidence=IEA
GO:0005737 "cytoplasm" evidence=ISM
GO:0005886 "plasma membrane" evidence=ISM
GO:0006886 "intracellular protein transport" evidence=IEA
GO:0016192 "vesicle-mediated transport" evidence=IEA
GO:0030117 "membrane coat" evidence=IEA
GO:0030126 "COPI vesicle coat" evidence=ISS
GO:0005829 "cytosol" evidence=IDA
GO:0006094 "gluconeogenesis" evidence=RCA
GO:0006661 "phosphatidylinositol biosynthetic process" evidence=RCA
GO:0007010 "cytoskeleton organization" evidence=RCA
GO:0010498 "proteasomal protein catabolic process" evidence=RCA
ZFIN|ZDB-GENE-010724-7 copb2 "coatomer protein complex, subunit beta 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|P35606 COPB2 "Coatomer subunit beta'" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1SL54 COPB2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|P35605 COPB2 "Coatomer subunit beta'" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|628746 Copb2 "coatomer protein complex, subunit beta 2 (beta prime)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E1C016 COPB2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:1354962 Copb2 "coatomer protein complex, subunit beta 2 (beta prime)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E2R667 COPB2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|B4DZI8 COPB2 "Coatomer protein complex, subunit beta 2 (Beta prime), isoform CRA_b" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P35605COPB2_BOVINNo assigned EC number0.61620.90040.9083yesno
P35606COPB2_HUMANNo assigned EC number0.61620.90040.9083yesno
P41811COPB2_YEASTNo assigned EC number0.46970.84790.8717yesno
O35142COPB2_RATNo assigned EC number0.61500.90040.9093yesno
Q6H8D6COB23_ORYSJNo assigned EC number0.82080.98030.9846nono
Q6H8D5COB22_ORYSJNo assigned EC number0.82410.98030.9846nono
O42937COPB2_SCHPONo assigned EC number0.46210.86540.9937yesno
Q4R4I8COPB2_MACFANo assigned EC number0.61130.90040.9083N/Ano
O55029COPB2_MOUSENo assigned EC number0.61740.90040.9093yesno
Q9C827COB22_ARATHNo assigned EC number0.87250.98790.9751yesno
Q5R664COPB2_PONABNo assigned EC number0.61620.90040.9083yesno
Q8L828COB23_ARATHNo assigned EC number0.86180.98900.9944nono
Q20168COPB2_CAEELNo assigned EC number0.52670.93870.858yesno
Q5VQ78COB21_ORYSJNo assigned EC number0.84940.98680.9944yesno
Q54YD8COPB2_DICDINo assigned EC number0.57620.90480.8228yesno
O62621COPB2_DROMENo assigned EC number0.56790.89820.8982yesno
Q9CAA0COB21_ARATHNo assigned EC number0.86050.99230.9858nono

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query914
pfam04053429 pfam04053, Coatomer_WDAD, Coatomer WD associated r 0.0
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 4e-68
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 2e-59
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 1e-45
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 4e-39
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 1e-38
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 1e-37
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 3e-17
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 2e-11
smart0032040 smart00320, WD40, WD40 repeats 2e-11
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 1e-10
smart0032040 smart00320, WD40, WD40 repeats 3e-08
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 3e-08
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 4e-08
smart0032040 smart00320, WD40, WD40 repeats 2e-07
smart0032040 smart00320, WD40, WD40 repeats 5e-06
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 5e-06
PTZ00421493 PTZ00421, PTZ00421, coronin; Provisional 2e-04
PTZ00421493 PTZ00421, PTZ00421, coronin; Provisional 6e-04
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 0.004
PTZ00420568 PTZ00420, PTZ00420, coronin; Provisional 0.004
>gnl|CDD|217864 pfam04053, Coatomer_WDAD, Coatomer WD associated region Back     alignment and domain information 
 Score =  582 bits (1503), Expect = 0.0
 Identities = 215/447 (48%), Positives = 301/447 (67%), Gaps = 20/447 (4%)

Query: 320 NEIQTVNIKSVGADYEVTDGERLPLAVKELGTCDLYPQSLKHNPNGRFVVVCGDGEYIIY 379
           +E+++ NIK       + DGE LPL++KELG+ ++YPQSL HNPNGRFV+VCGDGEYIIY
Sbjct: 1   SEVRSYNIKGN----NLKDGELLPLSLKELGSTEVYPQSLSHNPNGRFVLVCGDGEYIIY 56

Query: 380 TALAWRNRSFGSALEFVWSSDGEYAVRESSSKIKIFSKNFQEK--RSVRPTFSAERIYGG 437
           TALAWRN++FGS L+FVW S   YAV E S  +KIF KNF+E   +S++  +S ++I+GG
Sbjct: 57  TALAWRNKAFGSGLDFVWVSRNRYAVLEKSGTVKIF-KNFKESVTKSIKLPYSVDKIFGG 115

Query: 438 TLLAMCSNDFICFYDWAECRLIRRIDVTVKNLYWADSGDLVAIASDTSFYILKYNRDVVS 497
            LL + S  F+ FYDW + +LIRRIDV+ K + W+D G+LVA+ +  + YIL YN + V 
Sbjct: 116 ALLGVKSESFVSFYDWEQGKLIRRIDVSPKYVIWSDDGELVALLTKDTVYILNYNLEAV- 174

Query: 498 AYLDSGKPVDEQGVEDAFELLHETNERVRTGLWVGDCFIYNNSSWRLNYCVGGEVTTMFH 557
                      +GVEDAFE+LHE  ERV++G W GD FIY   +  L Y V GE   + H
Sbjct: 175 ----------AEGVEDAFEVLHEVTERVKSGAWDGDVFIYTTLN-HLKYLVNGETGIIKH 223

Query: 558 LDRPMYLLGYLASQSRVYLIDKEFNVMGYTLLLSLIEYKTLVMRGDLERANEILPSIPKE 617
           LD+PMYLLGYL   +RVYL+D++ NV+ Y +  + +E+KT ++R D E    I+ +    
Sbjct: 224 LDKPMYLLGYLPKDNRVYLLDRDGNVVSYEIDPTELEFKTALLRKDYEEVLRIIAN-SNL 282

Query: 618 HHNSVARFLESRGMIEEAIEVATDPDYRFELAIQLGRLEVAQEIATEVQSESKWKQLGEL 677
               + RFLE +G  E A++  TDPD RF+LA++LG L+VA EIA E+  E KWK+LG+ 
Sbjct: 283 LGQKIIRFLEKKGYPELALQFVTDPDTRFDLALELGNLDVALEIAKELDDEHKWKRLGDA 342

Query: 678 AMSTGKLEMAEGCMKQAMDLSGLLLLYSSLGDAEGISKLASLAKEQGKNNVAFLCLFMLG 737
           A+S G +++AE   ++A D   LLLLY S G+ E + KLA +A+E+G  N AF     LG
Sbjct: 343 ALSQGNIKLAEEAYQKAKDFDKLLLLYLSTGNKEKLKKLAKIAEERGDYNSAFQNALYLG 402

Query: 738 KLEDCLQLLVESNRIPEAALMARSYLP 764
            +E C+ +L+++ R+PEA L A++Y P
Sbjct: 403 DVEKCVDILIKTGRLPEAYLFAKTYGP 429

This region is composed of WD40 repeats. Length = 429
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|173611 PTZ00421, PTZ00421, coronin; Provisional Back     alignment and domain information
>gnl|CDD|173611 PTZ00421, PTZ00421, coronin; Provisional Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|240412 PTZ00420, PTZ00420, coronin; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 914
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 100.0
KOG0292 1202 consensus Vesicle coat complex COPI, alpha subunit 100.0
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 100.0
KOG0271480 consensus Notchless-like WD40 repeat-containing pr 100.0
KOG0318603 consensus WD40 repeat stress protein/actin interac 100.0
KOG0271480 consensus Notchless-like WD40 repeat-containing pr 100.0
KOG0291893 consensus WD40-repeat-containing subunit of the 18 100.0
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 100.0
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 100.0
KOG0286343 consensus G-protein beta subunit [General function 100.0
KOG0318603 consensus WD40 repeat stress protein/actin interac 100.0
KOG1524737 consensus WD40 repeat-containing protein CHE-2 [Ge 100.0
KOG0319775 consensus WD40-repeat-containing subunit of the 18 100.0
KOG0306888 consensus WD40-repeat-containing subunit of the 18 100.0
KOG0291893 consensus WD40-repeat-containing subunit of the 18 100.0
KOG0279315 consensus G protein beta subunit-like protein [Sig 100.0
KOG2041 1189 consensus WD40 repeat protein [General function pr 100.0
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 100.0
KOG0292 1202 consensus Vesicle coat complex COPI, alpha subunit 100.0
KOG0319775 consensus WD40-repeat-containing subunit of the 18 100.0
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 100.0
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 100.0
KOG0295406 consensus WD40 repeat-containing protein [Function 100.0
KOG0286343 consensus G-protein beta subunit [General function 100.0
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 100.0
KOG0279315 consensus G protein beta subunit-like protein [Sig 100.0
KOG0284464 consensus Polyadenylation factor I complex, subuni 100.0
KOG0285460 consensus Pleiotropic regulator 1 [RNA processing 100.0
KOG0315311 consensus G-protein beta subunit-like protein (con 100.0
KOG0265338 consensus U5 snRNP-specific protein-like factor an 100.0
KOG0306888 consensus WD40-repeat-containing subunit of the 18 100.0
KOG0296399 consensus Angio-associated migratory cell protein 100.0
KOG0645312 consensus WD40 repeat protein [General function pr 100.0
KOG0263707 consensus Transcription initiation factor TFIID, s 100.0
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 100.0
KOG0284464 consensus Polyadenylation factor I complex, subuni 100.0
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 100.0
KOG0266456 consensus WD40 repeat-containing protein [General 100.0
KOG0293519 consensus WD40 repeat-containing protein [Function 100.0
KOG0315311 consensus G-protein beta subunit-like protein (con 100.0
KOG2106626 consensus Uncharacterized conserved protein, conta 100.0
KOG0316307 consensus Conserved WD40 repeat-containing protein 100.0
KOG0263707 consensus Transcription initiation factor TFIID, s 100.0
KOG0296399 consensus Angio-associated migratory cell protein 100.0
KOG0285460 consensus Pleiotropic regulator 1 [RNA processing 100.0
KOG0275508 consensus Conserved WD40 repeat-containing protein 100.0
KOG0645312 consensus WD40 repeat protein [General function pr 100.0
KOG0282503 consensus mRNA splicing factor [Function unknown] 100.0
KOG0265338 consensus U5 snRNP-specific protein-like factor an 100.0
KOG0281499 consensus Beta-TrCP (transducin repeats containing 100.0
KOG0295406 consensus WD40 repeat-containing protein [Function 100.0
PLN00181793 protein SPA1-RELATED; Provisional 100.0
KOG0278334 consensus Serine/threonine kinase receptor-associa 100.0
KOG2048691 consensus WD40 repeat protein [General function pr 100.0
KOG14081080 consensus WD40 repeat protein [Function unknown] 99.98
KOG0313423 consensus Microtubule binding protein YTM1 (contai 99.98
KOG0310487 consensus Conserved WD40 repeat-containing protein 99.98
KOG1539910 consensus WD repeat protein [General function pred 99.98
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.98
KOG1407313 consensus WD40 repeat protein [Function unknown] 99.97
KOG0316307 consensus Conserved WD40 repeat-containing protein 99.97
KOG0266456 consensus WD40 repeat-containing protein [General 99.97
KOG1063764 consensus RNA polymerase II elongator complex, sub 99.97
KOG0643327 consensus Translation initiation factor 3, subunit 99.97
PLN00181793 protein SPA1-RELATED; Provisional 99.97
KOG2041 1189 consensus WD40 repeat protein [General function pr 99.97
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 99.97
KOG0288459 consensus WD40 repeat protein TipD [General functi 99.97
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 99.97
KOG0277311 consensus Peroxisomal targeting signal type 2 rece 99.97
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 99.97
KOG0268433 consensus Sof1-like rRNA processing protein (conta 99.97
KOG0282503 consensus mRNA splicing factor [Function unknown] 99.97
KOG1539910 consensus WD repeat protein [General function pred 99.97
KOG2106626 consensus Uncharacterized conserved protein, conta 99.97
KOG0772641 consensus Uncharacterized conserved protein, conta 99.97
KOG0643327 consensus Translation initiation factor 3, subunit 99.97
KOG0299479 consensus U3 snoRNP-associated protein (contains W 99.96
KOG0293519 consensus WD40 repeat-containing protein [Function 99.96
KOG0281499 consensus Beta-TrCP (transducin repeats containing 99.96
KOG1407313 consensus WD40 repeat protein [Function unknown] 99.96
KOG0973942 consensus Histone transcription regulator HIRA, WD 99.96
KOG0289506 consensus mRNA splicing factor [General function p 99.96
KOG14081080 consensus WD40 repeat protein [Function unknown] 99.96
KOG0294362 consensus WD40 repeat-containing protein [Function 99.96
KOG0301745 consensus Phospholipase A2-activating protein (con 99.96
KOG0278334 consensus Serine/threonine kinase receptor-associa 99.96
KOG0308735 consensus Conserved WD40 repeat-containing protein 99.96
KOG0283712 consensus WD40 repeat-containing protein [Function 99.96
PTZ00421493 coronin; Provisional 99.96
KOG0277311 consensus Peroxisomal targeting signal type 2 rece 99.96
KOG0275508 consensus Conserved WD40 repeat-containing protein 99.96
KOG0640430 consensus mRNA cleavage stimulating factor complex 99.96
KOG0647347 consensus mRNA export protein (contains WD40 repea 99.96
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 99.96
KOG0310487 consensus Conserved WD40 repeat-containing protein 99.96
KOG1036323 consensus Mitotic spindle checkpoint protein BUB3, 99.96
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 99.95
KOG0300481 consensus WD40 repeat-containing protein [Function 99.95
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 99.95
KOG2048691 consensus WD40 repeat protein [General function pr 99.95
KOG0641350 consensus WD40 repeat protein [General function pr 99.95
KOG0283712 consensus WD40 repeat-containing protein [Function 99.95
PTZ00420568 coronin; Provisional 99.95
KOG1063764 consensus RNA polymerase II elongator complex, sub 99.95
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 99.95
PTZ00421493 coronin; Provisional 99.95
KOG0308735 consensus Conserved WD40 repeat-containing protein 99.95
KOG0973942 consensus Histone transcription regulator HIRA, WD 99.95
KOG0313423 consensus Microtubule binding protein YTM1 (contai 99.95
KOG0268433 consensus Sof1-like rRNA processing protein (conta 99.94
KOG0288459 consensus WD40 repeat protein TipD [General functi 99.94
KOG1274933 consensus WD40 repeat protein [General function pr 99.94
KOG0640430 consensus mRNA cleavage stimulating factor complex 99.94
KOG0299479 consensus U3 snoRNP-associated protein (contains W 99.94
PTZ00420568 coronin; Provisional 99.94
KOG0264422 consensus Nucleosome remodeling factor, subunit CA 99.94
KOG0289506 consensus mRNA splicing factor [General function p 99.94
KOG0772641 consensus Uncharacterized conserved protein, conta 99.94
KOG0647347 consensus mRNA export protein (contains WD40 repea 99.94
KOG2055514 consensus WD40 repeat protein [General function pr 99.93
KOG0641350 consensus WD40 repeat protein [General function pr 99.93
KOG0639705 consensus Transducin-like enhancer of split protei 99.93
KOG1332299 consensus Vesicle coat complex COPII, subunit SEC1 99.93
KOG1332299 consensus Vesicle coat complex COPII, subunit SEC1 99.93
KOG2096420 consensus WD40 repeat protein [General function pr 99.93
KOG0300481 consensus WD40 repeat-containing protein [Function 99.93
KOG0294362 consensus WD40 repeat-containing protein [Function 99.93
KOG0650733 consensus WD40 repeat nucleolar protein Bop1, invo 99.92
KOG2096420 consensus WD40 repeat protein [General function pr 99.92
KOG0301745 consensus Phospholipase A2-activating protein (con 99.92
KOG0646476 consensus WD40 repeat protein [General function pr 99.92
KOG0264422 consensus Nucleosome remodeling factor, subunit CA 99.92
KOG4283397 consensus Transcription-coupled repair protein CSA 99.92
KOG1036323 consensus Mitotic spindle checkpoint protein BUB3, 99.92
KOG4328498 consensus WD40 protein [Function unknown] 99.92
KOG1273405 consensus WD40 repeat protein [General function pr 99.91
KOG0646476 consensus WD40 repeat protein [General function pr 99.91
KOG0267825 consensus Microtubule severing protein katanin p80 99.91
KOG14451012 consensus Tumor-specific antigen (contains WD repe 99.91
KOG2055514 consensus WD40 repeat protein [General function pr 99.91
KOG0269839 consensus WD40 repeat-containing protein [Function 99.9
KOG0639705 consensus Transducin-like enhancer of split protei 99.9
KOG0267825 consensus Microtubule severing protein katanin p80 99.9
KOG0269839 consensus WD40 repeat-containing protein [Function 99.9
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.9
KOG1273405 consensus WD40 repeat protein [General function pr 99.89
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.89
KOG0270463 consensus WD40 repeat-containing protein [Function 99.89
KOG2445361 consensus Nuclear pore complex component (sc Seh1) 99.88
KOG1274933 consensus WD40 repeat protein [General function pr 99.88
KOG1524737 consensus WD40 repeat-containing protein CHE-2 [Ge 99.88
KOG2445361 consensus Nuclear pore complex component (sc Seh1) 99.88
KOG4328498 consensus WD40 protein [Function unknown] 99.88
KOG4378673 consensus Nuclear protein COP1 [Signal transductio 99.88
KOG0302440 consensus Ribosome Assembly protein [General funct 99.88
KOG0650733 consensus WD40 repeat nucleolar protein Bop1, invo 99.87
KOG0302440 consensus Ribosome Assembly protein [General funct 99.87
KOG0270463 consensus WD40 repeat-containing protein [Function 99.87
KOG2919406 consensus Guanine nucleotide-binding protein [Gene 99.87
KOG0307 1049 consensus Vesicle coat complex COPII, subunit SEC3 99.87
KOG1034385 consensus Transcriptional repressor EED/ESC/FIE, r 99.86
KOG1963792 consensus WD40 repeat protein [General function pr 99.86
KOG0321720 consensus WD40 repeat-containing protein L2DTL [Fu 99.85
KOG1009434 consensus Chromatin assembly complex 1 subunit B/C 99.85
COG2319466 FOG: WD40 repeat [General function prediction only 99.85
KOG4378673 consensus Nuclear protein COP1 [Signal transductio 99.85
KOG1188376 consensus WD40 repeat protein [General function pr 99.85
KOG0642577 consensus Cell-cycle nuclear protein, contains WD- 99.85
KOG4497447 consensus Uncharacterized conserved protein WDR8, 99.84
KOG1009434 consensus Chromatin assembly complex 1 subunit B/C 99.84
KOG4283397 consensus Transcription-coupled repair protein CSA 99.83
KOG03071049 consensus Vesicle coat complex COPII, subunit SEC3 99.83
KOG1963792 consensus WD40 repeat protein [General function pr 99.83
KOG1007370 consensus WD repeat protein TSSC1, WD repeat super 99.83
KOG1034385 consensus Transcriptional repressor EED/ESC/FIE, r 99.82
KOG06441113 consensus Uncharacterized conserved protein, conta 99.82
KOG1007370 consensus WD repeat protein TSSC1, WD repeat super 99.81
KOG0321720 consensus WD40 repeat-containing protein L2DTL [Fu 99.81
KOG4227609 consensus WD40 repeat protein [General function pr 99.81
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 99.8
KOG15171387 consensus Guanine nucleotide binding protein MIP1 99.8
KOG14451012 consensus Tumor-specific antigen (contains WD repe 99.8
KOG1587555 consensus Cytoplasmic dynein intermediate chain [C 99.8
KOG0322323 consensus G-protein beta subunit-like protein GNB1 99.8
KOG0649325 consensus WD40 repeat protein [General function pr 99.79
KOG2919406 consensus Guanine nucleotide-binding protein [Gene 99.79
KOG0642577 consensus Cell-cycle nuclear protein, contains WD- 99.77
COG2319466 FOG: WD40 repeat [General function prediction only 99.77
KOG19121062 consensus WD40 repeat protein [General function pr 99.77
KOG0290364 consensus Conserved WD40 repeat-containing protein 99.77
KOG1310758 consensus WD40 repeat protein [General function pr 99.76
KOG0649325 consensus WD40 repeat protein [General function pr 99.76
PF04762928 IKI3: IKI3 family; InterPro: IPR006849 Members of 99.75
KOG1587555 consensus Cytoplasmic dynein intermediate chain [C 99.75
KOG4497447 consensus Uncharacterized conserved protein WDR8, 99.74
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 99.74
KOG1188376 consensus WD40 repeat protein [General function pr 99.74
KOG1334559 consensus WD40 repeat protein [General function pr 99.74
KOG1523361 consensus Actin-related protein Arp2/3 complex, su 99.73
KOG0303472 consensus Actin-binding protein Coronin, contains 99.73
KOG4227609 consensus WD40 repeat protein [General function pr 99.72
KOG0290364 consensus Conserved WD40 repeat-containing protein 99.72
KOG0303472 consensus Actin-binding protein Coronin, contains 99.71
KOG1272545 consensus WD40-repeat-containing subunit of the 18 99.71
PRK01742429 tolB translocation protein TolB; Provisional 99.7
KOG1523361 consensus Actin-related protein Arp2/3 complex, su 99.7
PRK11028330 6-phosphogluconolactonase; Provisional 99.7
KOG2110391 consensus Uncharacterized conserved protein, conta 99.7
KOG2110391 consensus Uncharacterized conserved protein, conta 99.69
KOG15171387 consensus Guanine nucleotide binding protein MIP1 99.68
KOG2111346 consensus Uncharacterized conserved protein, conta 99.68
KOG2111346 consensus Uncharacterized conserved protein, conta 99.68
KOG2139445 consensus WD40 repeat protein [General function pr 99.67
PRK11028330 6-phosphogluconolactonase; Provisional 99.67
KOG0322323 consensus G-protein beta subunit-like protein GNB1 99.66
KOG1310758 consensus WD40 repeat protein [General function pr 99.66
KOG3616 1636 consensus Selective LIM binding factor [Transcript 99.65
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 99.65
PRK01742429 tolB translocation protein TolB; Provisional 99.64
KOG06441113 consensus Uncharacterized conserved protein, conta 99.63
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 99.63
KOG1272545 consensus WD40-repeat-containing subunit of the 18 99.62
KOG12401431 consensus Protein kinase containing WD40 repeats [ 99.61
KOG1354433 consensus Serine/threonine protein phosphatase 2A, 99.61
KOG0771398 consensus Prolactin regulatory element-binding pro 99.61
KOG12401431 consensus Protein kinase containing WD40 repeats [ 99.6
KOG3881412 consensus Uncharacterized conserved protein [Funct 99.59
KOG0771398 consensus Prolactin regulatory element-binding pro 99.59
KOG2139445 consensus WD40 repeat protein [General function pr 99.59
KOG2321703 consensus WD40 repeat protein [General function pr 99.59
PRK03629429 tolB translocation protein TolB; Provisional 99.58
KOG1334559 consensus WD40 repeat protein [General function pr 99.58
COG5354561 Uncharacterized protein, contains Trp-Asp (WD) rep 99.57
PRK02889427 tolB translocation protein TolB; Provisional 99.56
PF04762928 IKI3: IKI3 family; InterPro: IPR006849 Members of 99.56
PRK04922433 tolB translocation protein TolB; Provisional 99.55
PRK05137435 tolB translocation protein TolB; Provisional 99.54
PRK03629429 tolB translocation protein TolB; Provisional 99.54
KOG2315566 consensus Predicted translation initiation factor 99.53
KOG2315566 consensus Predicted translation initiation factor 99.53
COG5354561 Uncharacterized protein, contains Trp-Asp (WD) rep 99.52
KOG2394636 consensus WD40 protein DMR-N9 [General function pr 99.52
COG4946668 Uncharacterized protein related to the periplasmic 99.51
PRK02889427 tolB translocation protein TolB; Provisional 99.51
KOG19121062 consensus WD40 repeat protein [General function pr 99.5
KOG2314698 consensus Translation initiation factor 3, subunit 99.5
PRK04922433 tolB translocation protein TolB; Provisional 99.49
KOG3881412 consensus Uncharacterized conserved protein [Funct 99.48
PRK05137435 tolB translocation protein TolB; Provisional 99.48
KOG2394636 consensus WD40 protein DMR-N9 [General function pr 99.46
KOG1409404 consensus Uncharacterized conserved protein, conta 99.46
KOG2314698 consensus Translation initiation factor 3, subunit 99.44
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.43
KOG0974967 consensus WD-repeat protein WDR6, WD repeat superf 99.43
KOG1354433 consensus Serine/threonine protein phosphatase 2A, 99.42
PRK00178430 tolB translocation protein TolB; Provisional 99.39
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.39
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 99.39
PRK04792448 tolB translocation protein TolB; Provisional 99.37
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 99.34
PRK01029428 tolB translocation protein TolB; Provisional 99.34
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 99.33
PRK01029428 tolB translocation protein TolB; Provisional 99.33
PRK00178430 tolB translocation protein TolB; Provisional 99.33
KOG4547541 consensus WD40 repeat-containing protein [General 99.33
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 99.32
KOG2321703 consensus WD40 repeat protein [General function pr 99.31
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 99.31
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 99.28
KOG0280339 consensus Uncharacterized conserved protein [Amino 99.28
KOG0280339 consensus Uncharacterized conserved protein [Amino 99.27
PRK04792448 tolB translocation protein TolB; Provisional 99.27
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 99.26
KOG0974967 consensus WD-repeat protein WDR6, WD repeat superf 99.26
KOG10642439 consensus RAVE (regulator of V-ATPase assembly) co 99.25
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 99.25
KOG4547541 consensus WD40 repeat-containing protein [General 99.23
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 99.22
KOG3616 1636 consensus Selective LIM binding factor [Transcript 99.21
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 99.19
COG4946668 Uncharacterized protein related to the periplasmic 99.18
KOG1409404 consensus Uncharacterized conserved protein, conta 99.16
KOG10642439 consensus RAVE (regulator of V-ATPase assembly) co 99.13
PLN029191057 haloacid dehalogenase-like hydrolase family protei 99.1
COG5170460 CDC55 Serine/threonine protein phosphatase 2A, reg 99.08
KOG4532344 consensus WD40-like repeat containing protein [Gen 99.07
COG5170460 CDC55 Serine/threonine protein phosphatase 2A, reg 99.06
KOG0309 1081 consensus Conserved WD40 repeat-containing protein 99.05
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 99.03
PRK04043419 tolB translocation protein TolB; Provisional 99.02
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 99.0
KOG41901034 consensus Uncharacterized conserved protein [Funct 99.0
PRK04043419 tolB translocation protein TolB; Provisional 99.0
KOG03091081 consensus Conserved WD40 repeat-containing protein 98.99
KOG4649354 consensus PQQ (pyrrolo-quinoline quinone) repeat p 98.98
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 98.98
KOG41901034 consensus Uncharacterized conserved protein [Funct 98.98
KOG3914390 consensus WD repeat protein WDR4 [Function unknown 98.97
PLN029191057 haloacid dehalogenase-like hydrolase family protei 98.96
KOG4714319 consensus Nucleoporin [Nuclear structure] 98.95
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 98.94
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 98.93
KOG4532344 consensus WD40-like repeat containing protein [Gen 98.93
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 98.92
KOG18321516 consensus HIV-1 Vpr-binding protein [Cell cycle co 98.9
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 98.9
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 98.86
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 98.85
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 98.84
KOG4714319 consensus Nucleoporin [Nuclear structure] 98.82
KOG18321516 consensus HIV-1 Vpr-binding protein [Cell cycle co 98.82
KOG3914390 consensus WD repeat protein WDR4 [Function unknown 98.8
KOG3621726 consensus WD40 repeat-containing protein [General 98.75
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 98.73
KOG0882558 consensus Cyclophilin-related peptidyl-prolyl cis- 98.73
KOG1275 1118 consensus PAB-dependent poly(A) ribonuclease, subu 98.72
KOG4649354 consensus PQQ (pyrrolo-quinoline quinone) repeat p 98.67
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 98.65
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 98.65
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 98.64
KOG12751118 consensus PAB-dependent poly(A) ribonuclease, subu 98.61
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 98.59
KOG2695425 consensus WD40 repeat protein [General function pr 98.59
KOG2695425 consensus WD40 repeat protein [General function pr 98.57
KOG2066846 consensus Vacuolar assembly/sorting protein VPS41 98.57
COG5290 1243 IkappaB kinase complex, IKAP component [Transcript 98.48
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 98.47
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 98.46
KOG1645463 consensus RING-finger-containing E3 ubiquitin liga 98.44
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 98.42
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 98.38
KOG2066846 consensus Vacuolar assembly/sorting protein VPS41 98.37
KOG1645463 consensus RING-finger-containing E3 ubiquitin liga 98.36
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 98.36
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 98.36
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 98.31
KOG0882558 consensus Cyclophilin-related peptidyl-prolyl cis- 98.3
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 98.29
PF08596395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 98.24
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 98.22
KOG1008783 consensus Uncharacterized conserved protein, conta 98.19
PRK02888635 nitrous-oxide reductase; Validated 98.16
PF04841410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 98.11
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 98.1
COG0823425 TolB Periplasmic component of the Tol biopolymer t 98.1
PF08596395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 98.07
PF11768545 DUF3312: Protein of unknown function (DUF3312); In 98.07
KOG3621726 consensus WD40 repeat-containing protein [General 98.05
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 98.05
COG0823425 TolB Periplasmic component of the Tol biopolymer t 98.04
PF11768545 DUF3312: Protein of unknown function (DUF3312); In 98.03
PF04841410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 98.03
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 97.93
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 97.92
PRK02888635 nitrous-oxide reductase; Validated 97.9
COG3391381 Uncharacterized conserved protein [Function unknow 97.89
KOG1008783 consensus Uncharacterized conserved protein, conta 97.86
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 97.82
TIGR03075527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 97.82
COG3391381 Uncharacterized conserved protein [Function unknow 97.78
TIGR03075527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 97.74
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 97.69
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 97.66
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 97.62
KOG4640665 consensus Anaphase-promoting complex (APC), subuni 97.6
KOG4640665 consensus Anaphase-promoting complex (APC), subuni 97.59
KOG2280 829 consensus Vacuolar assembly/sorting protein VPS16 97.58
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 97.54
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 97.54
PF14655415 RAB3GAP2_N: Rab3 GTPase-activating protein regulat 97.53
COG3386307 Gluconolactonase [Carbohydrate transport and metab 97.52
KOG18971096 consensus Damage-specific DNA binding complex, sub 97.52
KOG18971096 consensus Damage-specific DNA binding complex, sub 97.49
PRK13616591 lipoprotein LpqB; Provisional 97.41
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 97.35
PF15390671 DUF4613: Domain of unknown function (DUF4613) 97.27
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 97.21
COG3204316 Uncharacterized protein conserved in bacteria [Fun 97.19
KOG4499310 consensus Ca2+-binding protein Regucalcin/SMP30 [I 97.19
KOG2079 1206 consensus Vacuolar assembly/sorting protein VPS8 [ 97.17
KOG2395644 consensus Protein involved in vacuole import and d 97.14
PRK13616591 lipoprotein LpqB; Provisional 97.14
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 97.13
PHA02713557 hypothetical protein; Provisional 97.12
PRK10115686 protease 2; Provisional 97.11
COG3386307 Gluconolactonase [Carbohydrate transport and metab 97.07
COG3490366 Uncharacterized protein conserved in bacteria [Fun 97.0
COG3204316 Uncharacterized protein conserved in bacteria [Fun 96.97
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 96.97
PF05694461 SBP56: 56kDa selenium binding protein (SBP56); Int 96.92
smart0032040 WD40 WD40 repeats. Note that these repeats are per 96.91
KOG2079 1206 consensus Vacuolar assembly/sorting protein VPS8 [ 96.9
PRK13684334 Ycf48-like protein; Provisional 96.9
COG3490366 Uncharacterized protein conserved in bacteria [Fun 96.89
PF14727418 PHTB1_N: PTHB1 N-terminus 96.88
smart0032040 WD40 WD40 repeats. Note that these repeats are per 96.87
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 96.81
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 96.81
KOG2444238 consensus WD40 repeat protein [General function pr 96.8
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 96.77
KOG4499310 consensus Ca2+-binding protein Regucalcin/SMP30 [I 96.69
PF15390671 DUF4613: Domain of unknown function (DUF4613) 96.67
PF14727418 PHTB1_N: PTHB1 N-terminus 96.67
TIGR03074764 PQQ_membr_DH membrane-bound PQQ-dependent dehydrog 96.66
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 96.65
PRK10115686 protease 2; Provisional 96.64
KOG18981205 consensus Splicing factor 3b, subunit 3 [RNA proce 96.63
PF14655415 RAB3GAP2_N: Rab3 GTPase-activating protein regulat 96.59
COG3292671 Predicted periplasmic ligand-binding sensor domain 96.52
PHA02713557 hypothetical protein; Provisional 96.45
KOG2444238 consensus WD40 repeat protein [General function pr 96.44
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 96.44
PF07995331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 96.4
KOG2247615 consensus WD40 repeat-containing protein [General 96.38
PF05694461 SBP56: 56kDa selenium binding protein (SBP56); Int 96.34
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 96.32
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 96.31
KOG2395644 consensus Protein involved in vacuole import and d 96.26
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 96.21
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 96.15
KOG2247 615 consensus WD40 repeat-containing protein [General 96.11
PRK13684334 Ycf48-like protein; Provisional 96.08
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 96.04
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 96.0
KOG3630 1405 consensus Nuclear pore complex, Nup214/CAN compone 95.96
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 95.86
TIGR03118336 PEPCTERM_chp_1 conserved hypothetical protein TIGR 95.83
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 95.82
KOG2076 895 consensus RNA polymerase III transcription factor 95.59
PHA03098534 kelch-like protein; Provisional 95.45
PHA03098534 kelch-like protein; Provisional 95.36
PLN03218 1060 maturation of RBCL 1; Provisional 95.33
PLN03218 1060 maturation of RBCL 1; Provisional 95.26
PLN03077 857 Protein ECB2; Provisional 95.22
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 95.16
COG1520370 FOG: WD40-like repeat [Function unknown] 95.15
TIGR03074764 PQQ_membr_DH membrane-bound PQQ-dependent dehydrog 95.1
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 95.06
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 94.91
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 94.9
TIGR03118336 PEPCTERM_chp_1 conserved hypothetical protein TIGR 94.74
PF10168717 Nup88: Nuclear pore component; InterPro: IPR019321 94.58
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 94.58
PHA02790480 Kelch-like protein; Provisional 94.53
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 94.51
PHA02790480 Kelch-like protein; Provisional 94.44
KOG2003840 consensus TPR repeat-containing protein [General f 94.36
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 94.36
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 94.35
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 94.35
KOG3630 1405 consensus Nuclear pore complex, Nup214/CAN compone 94.16
KOG2076 895 consensus RNA polymerase III transcription factor 94.16
PF10168717 Nup88: Nuclear pore component; InterPro: IPR019321 94.12
PRK10370198 formate-dependent nitrite reductase complex subuni 94.11
PLN03077857 Protein ECB2; Provisional 94.04
TIGR02604367 Piru_Ver_Nterm putative membrane-bound dehydrogena 93.97
KOG1916 1283 consensus Nuclear protein, contains WD40 repeats [ 93.91
PRK11788389 tetratricopeptide repeat protein; Provisional 93.74
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 93.72
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 93.71
PRK11788389 tetratricopeptide repeat protein; Provisional 93.65
KOG1983993 consensus Tomosyn and related SNARE-interacting pr 93.64
TIGR02604367 Piru_Ver_Nterm putative membrane-bound dehydrogena 93.59
COG3292671 Predicted periplasmic ligand-binding sensor domain 93.58
KOG2377657 consensus Uncharacterized conserved protein [Funct 93.5
smart00036302 CNH Domain found in NIK1-like kinases, mouse citro 93.44
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 93.42
PF12234631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 93.33
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 93.33
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 93.31
KOG2377657 consensus Uncharacterized conserved protein [Funct 93.26
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 93.21
COG3823262 Glutamine cyclotransferase [Posttranslational modi 93.19
PF07995331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 93.09
PRK15359144 type III secretion system chaperone protein SscB; 93.03
PF14781136 BBS2_N: Ciliary BBSome complex subunit 2, N-termin 93.01
KOG3060289 consensus Uncharacterized conserved protein [Funct 92.88
COG5276370 Uncharacterized conserved protein [Function unknow 92.78
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 92.52
PF12234631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 92.42
PF10433504 MMS1_N: Mono-functional DNA-alkylating methyl meth 92.26
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 92.1
KOG18981205 consensus Splicing factor 3b, subunit 3 [RNA proce 92.04
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 91.9
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 91.9
KOG0553304 consensus TPR repeat-containing protein [General f 91.85
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 91.77
PF1031343 DUF2415: Uncharacterised protein domain (DUF2415); 91.73
PRK10747398 putative protoheme IX biogenesis protein; Provisio 91.69
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 91.47
PRK15359144 type III secretion system chaperone protein SscB; 91.32
PRK15331165 chaperone protein SicA; Provisional 91.3
KOG2047 835 consensus mRNA splicing factor [RNA processing and 91.28
PF11725 1774 AvrE: Pathogenicity factor; InterPro: IPR021085 Th 91.26
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 91.11
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 91.11
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 91.1
PRK11189296 lipoprotein NlpI; Provisional 91.09
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 90.9
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information 
Probab=100.00  E-value=3.7e-148  Score=1125.11  Aligned_cols=793  Identities=67%  Similarity=1.169  Sum_probs=781.6

Q ss_pred             CcchhhhhcccCCCCEEEEEEcCCCCEEEEEecCCcEEEEeCCCCceeEEeeecCCCeEEEEEecCCCEEEEEECCCEEE
Q 002511            3 LRLEIKRKLAQRSERVKSVDLHPSEPWILASLYSGTVCIWNYQSQTMAKSFEVTELPVRSAKFVARKQWVVAGADDMFIR   82 (914)
Q Consensus         3 ~~~~~~~~l~~h~~~v~~~~~sp~~~~la~~~~~g~v~iwd~~~~~~~~~~~~~~~~v~~~~~s~~~~~l~~g~~dg~i~   82 (914)
                      +++++++++..|+++|.+++|||..+|++++.++|.|.|||++++.++++|...+.||++..|.+..+|+++|++|+.|+
T Consensus         1 ~~l~~krk~~~rSdRVKsVd~HPtePw~la~LynG~V~IWnyetqtmVksfeV~~~PvRa~kfiaRknWiv~GsDD~~Ir   80 (794)
T KOG0276|consen    1 MKLDFKRKFQSRSDRVKSVDFHPTEPWILAALYNGDVQIWNYETQTMVKSFEVSEVPVRAAKFIARKNWIVTGSDDMQIR   80 (794)
T ss_pred             CcchhhhHhhccCCceeeeecCCCCceEEEeeecCeeEEEecccceeeeeeeecccchhhheeeeccceEEEecCCceEE
Confidence            45678899999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEECCCCeeeEEEecCCCCEEEEEEeCCCCEEEEEEcCCeEEEEECCCCceEEEEeecCcccEEEEEEccCCCCEEEEEe
Q 002511           83 VYNYNTMDKVKVFEAHTDYIRCVAVHPTLPYVLSSSDDMLIKLWDWEKGWMCTQIFEGHSHYVMQVTFNPKDTNTFASAS  162 (914)
Q Consensus        83 vwd~~t~~~~~~~~~~~~~i~~~~~s~~~~~l~~~~~dg~i~iwd~~~~~~~~~~~~~~~~~i~~~~~~p~~~~~l~~~~  162 (914)
                      ||+++|+++++.|.+|++.|+|++.||..++++++|+|.+|++||++.++.+.+++.+|.+.|++++|+|+|.+.|++++
T Consensus        81 Vfnynt~ekV~~FeAH~DyIR~iavHPt~P~vLtsSDDm~iKlW~we~~wa~~qtfeGH~HyVMqv~fnPkD~ntFaS~s  160 (794)
T KOG0276|consen   81 VFNYNTGEKVKTFEAHSDYIRSIAVHPTLPYVLTSSDDMTIKLWDWENEWACEQTFEGHEHYVMQVAFNPKDPNTFASAS  160 (794)
T ss_pred             EEecccceeeEEeeccccceeeeeecCCCCeEEecCCccEEEEeeccCceeeeeEEcCcceEEEEEEecCCCccceeeee
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCcEEEEECCCCCCcEEEecCCCCeeEEEEeeCCCcCEEEEEEcCCeEEEEECCCCceEEEecCcccceEEEEEeCCCC
Q 002511          163 LDRTIKIWNLGSPDPNFTLDAHQKGVNCVDYFTGGDKPYLITGSDDHTAKVWDYQTKSCVQTLEGHTHNVSAVCFHPELP  242 (914)
Q Consensus       163 ~dg~i~vwd~~~~~~~~~~~~~~~~v~~~~~~~~~~~~~l~~~~~dg~i~iwd~~~~~~~~~~~~~~~~v~~i~~~~~~~  242 (914)
                      .|++|++|.+.+..+.+++.+|..+|+|+++.+.|++|||++|++|.+++|||+++..|++++.+|..+|+.++|+|.-+
T Consensus       161 LDrTVKVWslgs~~~nfTl~gHekGVN~Vdyy~~gdkpylIsgaDD~tiKvWDyQtk~CV~TLeGHt~Nvs~v~fhp~lp  240 (794)
T KOG0276|consen  161 LDRTVKVWSLGSPHPNFTLEGHEKGVNCVDYYTGGDKPYLISGADDLTIKVWDYQTKSCVQTLEGHTNNVSFVFFHPELP  240 (794)
T ss_pred             ccccEEEEEcCCCCCceeeeccccCcceEEeccCCCcceEEecCCCceEEEeecchHHHHHHhhcccccceEEEecCCCc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEEEEECCCeEEEEeCCCceeEEEeecCCccEEEEEEecCCCEEEEEecCCeEEEEcCCCcceeEEcCCCcEEEEeeCcE
Q 002511          243 IIITGSEDGTVRIWHATTYRLENTLNYGLERVWAIGYMKSSRRIVIGYDEGTIMVKIGREEPVASMDNSGKIIWAKHNEI  322 (914)
Q Consensus       243 ~l~~~~~dg~v~iwd~~~~~~~~~~~~~~~~v~~i~~~~~~~~l~~~~~dg~i~i~~~~~~~~~~~~~~g~~~~~~~~~~  322 (914)
                      ++++|++||+|+||+..|+++..++....+++|+++-.+.++.+++|.++|.+.+.++++.|.++|+.+|+++|+.++++
T Consensus       241 iiisgsEDGTvriWhs~Ty~lE~tLn~gleRvW~I~~~k~~~~i~vG~Deg~i~v~lgreeP~vsMd~~gKIiwa~~~ei  320 (794)
T KOG0276|consen  241 IIISGSEDGTVRIWNSKTYKLEKTLNYGLERVWCIAAHKGDGKIAVGFDEGSVTVKLGREEPAVSMDSNGKIIWAVHSEI  320 (794)
T ss_pred             EEEEecCCccEEEecCcceehhhhhhcCCceEEEEeecCCCCeEEEeccCCcEEEEccCCCCceeecCCccEEEEcCcee
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEEEeeecccceeccCCceeeeeeeecCCcccCCceEEECCCCCEEEEEcCCcEEEEEeecccccccCceeEEEEecC-C
Q 002511          323 QTVNIKSVGADYEVTDGERLPLAVKELGTCDLYPQSLKHNPNGRFVVVCGDGEYIIYTALAWRNRSFGSALEFVWSSD-G  401 (914)
Q Consensus       323 ~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~l~~s~~g~~lav~~~~~~~i~~~~~~~~~~~~~~~~~~~s~~-~  401 (914)
                      +..++++.....++.||+++++..++++.++.+|+.+++||+|+++++|+||+++||+...||++.+|....++|++| +
T Consensus       321 ~~~~~ks~~~~~ev~DgErL~LsvKeLgs~eiyPq~L~hsPNGrfV~VcgdGEyiIyTala~RnK~fG~~~eFvw~~dsn  400 (794)
T KOG0276|consen  321 QAVNLKSVGAQKEVTDGERLPLSVKELGSVEIYPQTLAHSPNGRFVVVCGDGEYIIYTALALRNKAFGSGLEFVWAADSN  400 (794)
T ss_pred             eeeeceeccCcccccCCccccchhhhccccccchHHhccCCCCcEEEEecCccEEEEEeeehhhcccccceeEEEcCCCC
Confidence            999999998888899999999999999999999999999999999999999999999999999999999999999999 6


Q ss_pred             cEEEEecCCeEEEeccCcccceeeecCcccceeecCcEEEEEeCCeEEEEeccCCcEEEEEEcceeEEEEcCCCCEEEEE
Q 002511          402 EYAVRESSSKIKIFSKNFQEKRSVRPTFSAERIYGGTLLAMCSNDFICFYDWAECRLIRRIDVTVKNLYWADSGDLVAIA  481 (914)
Q Consensus       402 ~~l~~~~~~~i~v~~~~~~~~~~~~~~~s~~~i~~g~~La~~~~~~i~~~d~~~~~~i~~~~~~i~~v~~s~dg~~la~~  481 (914)
                      .|++..+++.|+++ .+|++++++++.++.+.|+||.+|++.+++.++||||++++++++++...++++|+.+|.+|+++
T Consensus       401 e~avRes~~~vki~-knfke~ksi~~~~~~e~i~gg~Llg~~ss~~~~fydW~~~~lVrrI~v~~k~v~w~d~g~lVai~  479 (794)
T KOG0276|consen  401 EFAVRESNGNVKIF-KNFKEHKSIRPDMSAEGIFGGPLLGVRSSDFLCFYDWESGELVRRIEVTSKHVYWSDNGELVAIA  479 (794)
T ss_pred             eEEEEecCCceEEE-ecceeccccccccceeeecCCceEEEEeCCeEEEEEcccceEEEEEeeccceeEEecCCCEEEEE
Confidence            88999899999999 99999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eCCeEEEEEecHHHHHHhhhCCCCCCccccccceeEeeeeeeEEEeeEEecCEEEEEccCCeEEEEECCEEeEEEecccc
Q 002511          482 SDTSFYILKYNRDVVSAYLDSGKPVDEQGVEDAFELLHETNERVRTGLWVGDCFIYNNSSWRLNYCVGGEVTTMFHLDRP  561 (914)
Q Consensus       482 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~f~~~~~~~~~i~~~~w~~~~~i~~~~~~~l~~~~~~~~~~~~~~~~~  561 (914)
                      +++..+++.+|++.+....+.+..++++|.+++|+.+.+..+.++++.|.+|||||+|..++++|+++++..++.+++.+
T Consensus       480 ~d~Sfyil~~n~d~v~~a~e~g~~v~eeGiedAfevLgE~sE~v~tg~WvgD~fiytts~nrlnY~vgGe~~~v~h~~~~  559 (794)
T KOG0276|consen  480 GDDSFYILKFNADAVANAVEQGIEVTEEGIEDAFEVLGEVSESVKTGKWVGDCFIYTTSNNRLNYLVGGETYTVAHLDRI  559 (794)
T ss_pred             ecCceeEEEecHHHHHHHHhcCCCCcchhHHHHHHHHhhhhhheeeceeeeeEEEEeecccceeEEcCCceEEEEEeccc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eEEEEEeecCCEEEEEecCCceEEEEecchhHhHHHHHHccCHHHHhhhcCCCCcchHHHHHHHHHhCCChhhhhhcccC
Q 002511          562 MYLLGYLASQSRVYLIDKEFNVMGYTLLLSLIEYKTLVMRGDLERANEILPSIPKEHHNSVARFLESRGMIEEAIEVATD  641 (914)
Q Consensus       562 ~~~~~~~~~~~~l~~~d~~~~~~~~~l~~~~~~~~~~~~~~~~~~a~~~l~~i~~~~~~~~~~~~~~~~~~~~a~~~~~~  641 (914)
                      +|+++|+++++|+|+.|++.++.+|.+.+++++||+++|++|++.|.++|++|+..+++++++|++++|++++||++++|
T Consensus       560 mylLgy~~~~~rvYL~Dke~nVi~y~l~l~vleyqt~vmrrd~~~a~~vLp~I~k~~rt~va~Fle~~g~~e~AL~~s~D  639 (794)
T KOG0276|consen  560 MYLLGYVANDNRVYLHDKELNVISYKILLEVLEYQTLVLRRDLEVADGVLPTIPKEIRTKVAHFLESQGMKEQALELSTD  639 (794)
T ss_pred             hhheeeeecCCEEEEeecccceEeEeeehHHHHHHHHhhhccccccccccccCchhhhhhHHhHhhhccchHhhhhcCCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cccceeeecccCCHHHHHHHHHHcCChHHHHHHHHHHHHcCChhhHHHHHHHcCCcchhHHHHHhcCCHHHHHHHHHHHH
Q 002511          642 PDYRFELAIQLGRLEVAQEIATEVQSESKWKQLGELAMSTGKLEMAEGCMKQAMDLSGLLLLYSSLGDAEGISKLASLAK  721 (914)
Q Consensus       642 ~~~~f~~~l~l~~~~~A~~~a~~~~~~~~w~~la~~al~~~~~~~A~~~y~~~~d~~~l~~l~~~~g~~~~~~~~a~~a~  721 (914)
                      |+++|++++++|+++.|+++|.+.+++.+|++||++|++.+++.+|.+||.+++|+.+|+++|+..|+.+++..++..+.
T Consensus       640 ~d~rFelal~lgrl~iA~~la~e~~s~~Kw~~Lg~~al~~~~l~lA~EC~~~a~d~~~LlLl~t~~g~~~~l~~la~~~~  719 (794)
T KOG0276|consen  640 PDQRFELALKLGRLDIAFDLAVEANSEVKWRQLGDAALSAGELPLASECFLRARDLGSLLLLYTSSGNAEGLAVLASLAK  719 (794)
T ss_pred             hhhhhhhhhhcCcHHHHHHHHHhhcchHHHHHHHHHHhhcccchhHHHHHHhhcchhhhhhhhhhcCChhHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HcCCchHHHHHHHHcCCHHHHHHHHHHCCCchHHHHHHHhcCCChHHHHHHHHHHhhhhcChhhhhhcCCCccCC
Q 002511          722 EQGKNNVAFLCLFMLGKLEDCLQLLVESNRIPEAALMARSYLPSKVSEIVAIWRKDLQKVNPKAAESLADPEEYS  796 (914)
Q Consensus       722 ~~~~~~~a~~~~~~~g~~~~a~~l~~~~~~~~~A~~~a~~~~~~~~~~~~~~~~~~L~~~~~~~a~~l~~~~~~~  796 (914)
                      .+|++|.||.|+++.|++++|++++++++|++||++|||+|+|+++++++.+|++.|.+.++|+|++|+||++|+
T Consensus       720 ~~g~~N~AF~~~~l~g~~~~C~~lLi~t~r~peAal~ArtYlps~vs~iv~~wk~~l~k~~~k~~~sladp~~~~  794 (794)
T KOG0276|consen  720 KQGKNNLAFLAYFLSGDYEECLELLISTQRLPEAALFARTYLPSQVSRIVELWKEDLSKVSEKAAESLADPEEYS  794 (794)
T ss_pred             hhcccchHHHHHHHcCCHHHHHHHHHhcCcCcHHHHHHhhhChHHHHHHHHHHHHHhhhhhhhhhhhccCccccC
Confidence            999999999999999999999999999999999999999999999999999999999999999999999999874

>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only] Back     alignment and domain information
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] Back     alignment and domain information
>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>KOG0645 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] Back     alignment and domain information
>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0645 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1408 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] Back     alignment and domain information
>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>KOG1408 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0294 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0300 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0641 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0641 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2096 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0300 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0294 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2096 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4328 consensus WD40 protein [Function unknown] Back     alignment and domain information
>KOG1273 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0269 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0269 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG1273 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG0270 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only] Back     alignment and domain information
>KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4328 consensus WD40 protein [Function unknown] Back     alignment and domain information
>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0302 consensus Ribosome Assembly protein [General function prediction only] Back     alignment and domain information
>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0302 consensus Ribosome Assembly protein [General function prediction only] Back     alignment and domain information
>KOG0270 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only] Back     alignment and domain information
>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription] Back     alignment and domain information
>KOG1963 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown] Back     alignment and domain information
>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair] Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG1188 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0642 consensus Cell-cycle nuclear protein, contains WD-40 repeats [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair] Back     alignment and domain information
>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1963 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown] Back     alignment and domain information
>KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription] Back     alignment and domain information
>KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only] Back     alignment and domain information
>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown] Back     alignment and domain information
>KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown] Back     alignment and domain information
>KOG4227 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] Back     alignment and domain information
>KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton] Back     alignment and domain information
>KOG0322 consensus G-protein beta subunit-like protein GNB1L, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG0649 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only] Back     alignment and domain information
>KOG0642 consensus Cell-cycle nuclear protein, contains WD-40 repeats [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG1912 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown] Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0649 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton] Back     alignment and domain information
>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>KOG1188 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1334 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton] Back     alignment and domain information
>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton] Back     alignment and domain information
>KOG4227 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown] Back     alignment and domain information
>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton] Back     alignment and domain information
>KOG1272 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG2139 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG0322 consensus G-protein beta subunit-like protein GNB1L, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only] Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG1272 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>KOG1354 consensus Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>KOG3881 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2139 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1334 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only] Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1912 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG3881 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only] Back     alignment and domain information
>KOG1409 consensus Uncharacterized conserved protein, contains WD40 repeats and FYVE domains [Function unknown] Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>KOG1354 consensus Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG4547 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>KOG0280 consensus Uncharacterized conserved protein [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0280 consensus Uncharacterized conserved protein [Amino acid transport and metabolism] Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>KOG1064 consensus RAVE (regulator of V-ATPase assembly) complex subunit RAV1/DMX protein, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>KOG4547 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>KOG1409 consensus Uncharacterized conserved protein, contains WD40 repeats and FYVE domains [Function unknown] Back     alignment and domain information
>KOG1064 consensus RAVE (regulator of V-ATPase assembly) complex subunit RAV1/DMX protein, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG4532 consensus WD40-like repeat containing protein [General function prediction only] Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>KOG4190 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG4649 consensus PQQ (pyrrolo-quinoline quinone) repeat protein [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG4190 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3914 consensus WD repeat protein WDR4 [Function unknown] Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>KOG4714 consensus Nucleoporin [Nuclear structure] Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG4532 consensus WD40-like repeat containing protein [General function prediction only] Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>KOG4714 consensus Nucleoporin [Nuclear structure] Back     alignment and domain information
>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG3914 consensus WD repeat protein WDR4 [Function unknown] Back     alignment and domain information
>KOG3621 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1275 consensus PAB-dependent poly(A) ribonuclease, subunit PAN2 [Replication, recombination and repair] Back     alignment and domain information
>KOG4649 consensus PQQ (pyrrolo-quinoline quinone) repeat protein [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG1275 consensus PAB-dependent poly(A) ribonuclease, subunit PAN2 [Replication, recombination and repair] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2695 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2695 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5290 IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>KOG1008 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>KOG3621 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1008 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>KOG4640 consensus Anaphase-promoting complex (APC), subunit 4 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4640 consensus Anaphase-promoting complex (APC), subunit 4 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1897 consensus Damage-specific DNA binding complex, subunit DDB1 [Replication, recombination and repair] Back     alignment and domain information
>KOG1897 consensus Damage-specific DNA binding complex, subunit DDB1 [Replication, recombination and repair] Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>PF15390 DUF4613: Domain of unknown function (DUF4613) Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG4499 consensus Ca2+-binding protein Regucalcin/SMP30 [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG2079 consensus Vacuolar assembly/sorting protein VPS8 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2395 consensus Protein involved in vacuole import and degradation [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>KOG2079 consensus Vacuolar assembly/sorting protein VPS8 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF14727 PHTB1_N: PTHB1 N-terminus Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2444 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>KOG4499 consensus Ca2+-binding protein Regucalcin/SMP30 [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PF15390 DUF4613: Domain of unknown function (DUF4613) Back     alignment and domain information
>PF14727 PHTB1_N: PTHB1 N-terminus Back     alignment and domain information
>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>KOG1898 consensus Splicing factor 3b, subunit 3 [RNA processing and modification] Back     alignment and domain information
>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus Back     alignment and domain information
>COG3292 Predicted periplasmic ligand-binding sensor domain [Signal transduction mechanisms] Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>KOG2444 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>KOG2247 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>KOG2395 consensus Protein involved in vacuole import and degradation [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>KOG2247 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>KOG3630 consensus Nuclear pore complex, Nup214/CAN component [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>TIGR03118 PEPCTERM_chp_1 conserved hypothetical protein TIGR03118 Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>COG1520 FOG: WD40-like repeat [Function unknown] Back     alignment and domain information
>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>TIGR03118 PEPCTERM_chp_1 conserved hypothetical protein TIGR03118 Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG3630 consensus Nuclear pore complex, Nup214/CAN component [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>KOG1916 consensus Nuclear protein, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG1983 consensus Tomosyn and related SNARE-interacting proteins [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>COG3292 Predicted periplasmic ligand-binding sensor domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG2377 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00036 CNH Domain found in NIK1-like kinases, mouse citron and yeast ROM1, ROM2 Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>KOG2377 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>COG3823 Glutamine cyclotransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PF14781 BBS2_N: Ciliary BBSome complex subunit 2, N-terminal Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5276 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>PF10433 MMS1_N: Mono-functional DNA-alkylating methyl methanesulfonate N-term; PDB: 2B5M_A 4A0K_C 4A0B_C 3I7L_A 2B5N_C 3I8E_A 4A09_A 4A0A_A 3EI4_C 2B5L_A Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>KOG1898 consensus Splicing factor 3b, subunit 3 [RNA processing and modification] Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PF11725 AvrE: Pathogenicity factor; InterPro: IPR021085 This family is secreted by Gram-negative Gammaproteobacteria such as Pseudomonas syringae of tomato and Erwinia amylovora (Fire blight bacteria), amongst others Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query914
3mkq_A814 Crystal Structure Of Yeast AlphaBETAPRIME-Cop Subco 0.0
2ynp_A604 Yeast Betaprime Cop 1-604 With Ktktn Motif Length = 0.0
2yno_A310 Yeast Betaprime Cop 1-304h6 Length = 310 1e-109
2ynn_A304 Yeast Betaprime Cop 1-304 With Ktktn Motif Length = 1e-109
1vyh_C410 Paf-Ah Holoenzyme: Lis1ALFA2 Length = 410 1e-29
1vyh_C410 Paf-Ah Holoenzyme: Lis1ALFA2 Length = 410 1e-18
2ymu_A577 Structure Of A Highly Repetitive Propeller Structur 2e-27
2ymu_A577 Structure Of A Highly Repetitive Propeller Structur 5e-23
3mxx_A315 Crystal Structure Of Wdr5 Mutant (S62a) Length = 31 3e-22
3mxx_A315 Crystal Structure Of Wdr5 Mutant (S62a) Length = 31 9e-17
3mxx_A315 Crystal Structure Of Wdr5 Mutant (S62a) Length = 31 3e-06
2cnx_A315 Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2. 5e-22
2cnx_A315 Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2. 1e-16
3n0e_A315 Crystal Structure Of Wdr5 Mutant (W330y) Length = 3 6e-22
3n0e_A315 Crystal Structure Of Wdr5 Mutant (W330y) Length = 3 4e-17
3n0e_A315 Crystal Structure Of Wdr5 Mutant (W330y) Length = 3 2e-06
3n0d_A315 Crystal Structure Of Wdr5 Mutant (W330f) Length = 3 6e-22
3n0d_A315 Crystal Structure Of Wdr5 Mutant (W330f) Length = 3 4e-17
3n0d_A315 Crystal Structure Of Wdr5 Mutant (W330f) Length = 3 2e-06
3emh_A318 Structural Basis Of Wdr5-Mll Interaction Length = 3 1e-21
3emh_A318 Structural Basis Of Wdr5-Mll Interaction Length = 3 5e-17
3emh_A318 Structural Basis Of Wdr5-Mll Interaction Length = 3 9e-07
2h9l_A329 Wdr5delta23 Length = 329 1e-21
2h9l_A329 Wdr5delta23 Length = 329 6e-17
2h9l_A329 Wdr5delta23 Length = 329 2e-06
2h13_A317 Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length 1e-21
2h13_A317 Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length 5e-17
2h13_A317 Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length 2e-06
2gnq_A336 Structure Of Wdr5 Length = 336 1e-21
2gnq_A336 Structure Of Wdr5 Length = 336 5e-17
3psl_A318 Fine-Tuning The Stimulation Of Mll1 Methyltransfera 1e-21
3psl_A318 Fine-Tuning The Stimulation Of Mll1 Methyltransfera 5e-17
3psl_A318 Fine-Tuning The Stimulation Of Mll1 Methyltransfera 1e-06
4a7j_A318 Symmetric Dimethylation Of H3 Arginine 2 Is A Novel 1e-21
4a7j_A318 Symmetric Dimethylation Of H3 Arginine 2 Is A Novel 6e-17
4a7j_A318 Symmetric Dimethylation Of H3 Arginine 2 Is A Novel 2e-06
2g9a_A311 Structural Basis For The Specific Recognition Of Me 1e-21
2g9a_A311 Structural Basis For The Specific Recognition Of Me 6e-17
2g9a_A311 Structural Basis For The Specific Recognition Of Me 2e-06
2xl2_A334 Wdr5 In Complex With An Rbbp5 Peptide Recruited To 1e-21
2xl2_A334 Wdr5 In Complex With An Rbbp5 Peptide Recruited To 4e-17
2g99_A308 Structural Basis For The Specific Recognition Of Me 1e-21
2g99_A308 Structural Basis For The Specific Recognition Of Me 5e-17
2g99_A308 Structural Basis For The Specific Recognition Of Me 1e-06
2h68_A312 Histone H3 Recognition And Presentation By The Wdr5 1e-21
2h68_A312 Histone H3 Recognition And Presentation By The Wdr5 5e-17
2h68_A312 Histone H3 Recognition And Presentation By The Wdr5 1e-06
2h9m_A313 Wdr5 In Complex With Unmodified H3k4 Peptide Length 1e-21
2h9m_A313 Wdr5 In Complex With Unmodified H3k4 Peptide Length 6e-17
2h9m_A313 Wdr5 In Complex With Unmodified H3k4 Peptide Length 2e-06
3smr_A312 Crystal Structure Of Human Wd Repeat Domain 5 With 2e-21
3smr_A312 Crystal Structure Of Human Wd Repeat Domain 5 With 7e-17
3smr_A312 Crystal Structure Of Human Wd Repeat Domain 5 With 2e-06
2co0_A315 Wdr5 And Unmodified Histone H3 Complex At 2.25 Angs 2e-21
2co0_A315 Wdr5 And Unmodified Histone H3 Complex At 2.25 Angs 1e-16
2co0_A315 Wdr5 And Unmodified Histone H3 Complex At 2.25 Angs 3e-06
2ovp_B445 Structure Of The Skp1-Fbw7 Complex Length = 445 5e-21
2ovp_B445 Structure Of The Skp1-Fbw7 Complex Length = 445 4e-20
3zey_7318 High-resolution Cryo-electron Microscopy Structure 1e-18
1p22_A435 Structure Of A Beta-Trcp1-Skp1-Beta-Catenin Complex 2e-18
1p22_A435 Structure Of A Beta-Trcp1-Skp1-Beta-Catenin Complex 1e-10
3dm0_A694 Maltose Binding Protein Fusion With Rack1 From A. T 1e-17
3dm0_A694 Maltose Binding Protein Fusion With Rack1 From A. T 9e-06
2pbi_B354 The Multifunctional Nature Of Gbeta5RGS9 REVEALED F 1e-16
2pbi_B354 The Multifunctional Nature Of Gbeta5RGS9 REVEALED F 2e-10
3iza_B1263 Structure Of An Apoptosome-Procaspase-9 Card Comple 2e-16
3sfz_A1249 Crystal Structure Of Full-Length Murine Apaf-1 Leng 6e-16
3shf_A1256 Crystal Structure Of The R265s Mutant Of Full-Lengt 6e-16
3iz6_a380 Localization Of The Small Subunit Ribosomal Protein 7e-16
1erj_A393 Crystal Structure Of The C-Terminal Wd40 Domain Of 9e-16
1erj_A393 Crystal Structure Of The C-Terminal Wd40 Domain Of 3e-15
2bcj_B340 Crystal Structure Of G Protein-coupled Receptor Kin 2e-14
1gg2_B340 G Protein Heterotrimer Mutant Gi_alpha_1(G203a) Bet 2e-14
3sn6_B351 Crystal Structure Of The Beta2 Adrenergic Receptor- 3e-14
4aow_A340 Crystal Structure Of The Human Rack1 Protein At A R 5e-14
1got_B340 Heterotrimeric Complex Of A Gt-AlphaGI-Alpha Chimer 5e-14
3ow8_A321 Crystal Structure Of The Wd Repeat-Containing Prote 5e-14
3ow8_A321 Crystal Structure Of The Wd Repeat-Containing Prote 7e-05
1a0r_B340 Heterotrimeric Complex Of PhosducinTRANSDUCIN BETA- 5e-14
2zkq_a317 Structure Of A Mammalian Ribosomal 40s Subunit With 6e-14
1nex_B464 Crystal Structure Of Scskp1-Sccdc4-Cpd Peptide Comp 1e-13
3mks_B464 Crystal Structure Of Yeast Cdc4SKP1 IN COMPLEX WITH 2e-13
3fm0_A345 Crystal Structure Of Wd40 Protein Ciao1 Length = 34 2e-11
3fm0_A345 Crystal Structure Of Wd40 Protein Ciao1 Length = 34 3e-06
3frx_A319 Crystal Structure Of The Yeast Orthologue Of Rack1, 1e-10
4gga_A420 Structural Analysis Of Human Cdc20 Supports Multi-S 1e-10
3rfg_A319 Crystal Structure Of The Yeast Rack1 Dimer In Space 2e-10
3izb_a319 Localization Of The Small Subunit Ribosomal Protein 2e-10
1trj_A314 Homology Model Of Yeast Rack1 Protein Fitted Into 1 2e-10
4ggd_A431 Structural Analysis Of Human Cdc20 Supports Multisi 2e-10
3rfh_A319 Crystal Structure Of The Yeast Rack1 Dimer In Space 2e-10
3jyv_R313 Structure Of The 40s Rrna And Proteins And PE TRNA 2e-10
4ggc_A318 Structural Analysis Of Human Cdc20 Supports Multi-S 3e-10
2hes_X330 Cytosolic Iron-sulphur Assembly Protein- 1 Length = 5e-10
3c99_A432 Structural Basis Of Histone H4 Recognition By P55 L 2e-09
2xyi_A430 Crystal Structure Of Nurf55 In Complex With A H4 Pe 2e-09
2yba_A422 Crystal Structure Of Nurf55 In Complex With Histone 2e-09
2xzm_R343 Crystal Structure Of The Eukaryotic 40s Ribosomal S 2e-09
2xzm_R343 Crystal Structure Of The Eukaryotic 40s Ribosomal S 6e-07
3cfv_B414 Structural Basis Of The Interaction Of Rbap46RBAP48 5e-09
4g56_B357 Crystal Structure Of Full Length Prmt5/mep50 Comple 5e-09
3cfs_B414 Structural Basis Of The Interaction Of Rbap46RBAP48 5e-09
3odt_A313 Crystal Structure Of Wd40 Beta Propeller Domain Of 1e-08
3gfc_A425 Crystal Structure Of Histone-Binding Protein Rbbp4 2e-08
4gqb_B344 Crystal Structure Of The Human Prmt5:mep50 Complex 1e-07
4a11_B408 Structure Of The Hsddb1-Hscsa Complex Length = 408 1e-06
3acp_A417 Crystal Structure Of Yeast Rpn14, A Chaperone Of Th 2e-06
3acp_A417 Crystal Structure Of Yeast Rpn14, A Chaperone Of Th 5e-04
3vl1_A420 Crystal Structure Of Yeast Rpn14 Length = 420 2e-06
3vl1_A420 Crystal Structure Of Yeast Rpn14 Length = 420 6e-04
1nr0_A611 Two Seven-Bladed Beta-Propeller Domains Revealed By 5e-06
1gxr_A337 Wd40 Region Of Human Groucho/tle1 Length = 337 6e-06
3mmy_A368 Structural And Functional Analysis Of The Interacti 9e-06
2aq5_A402 Crystal Structure Of Murine Coronin-1 Length = 402 2e-05
1pi6_A615 Yeast Actin Interacting Protein 1 (Aip1), Orthorhom 2e-05
2b4e_A402 Crystal Structure Of Murine Coronin-1: Monoclinic F 5e-05
1pgu_A615 Yeast Actin Interacting Protein 1 (aip1), Se-met Pr 1e-04
3ei4_B436 Structure Of The Hsddb1-Hsddb2 Complex Length = 436 2e-04
4e54_B435 Damaged Dna Induced Uv-Damaged Dna-Binding Protein 2e-04
4e5z_B436 Damaged Dna Induced Uv-Damaged Dna-Binding Protein 2e-04
4aez_A401 Crystal Structure Of Mitotic Checkpoint Complex Len 2e-04
3jro_A753 Nup84-Nup145c-Sec13 Edge Element Of The Npc Lattice 5e-04
3gre_A437 Crystal Structure Of Saccharomyces Cerevisiae Vps15 8e-04
2qxv_A361 Structural Basis Of Ezh2 Recognition By Eed Length 8e-04
3jzn_A366 Structure Of Eed In Apo Form Length = 366 8e-04
3iiw_A365 Crystal Structure Of Eed In Complex With A Trimethy 9e-04
3iiy_A365 Crystal Structure Of Eed In Complex With A Trimethy 9e-04
>pdb|3MKQ|A Chain A, Crystal Structure Of Yeast AlphaBETAPRIME-Cop Subcomplex Of The Copi Vesicular Coat Length = 814 Back     alignment and structure 
Iteration: 1

 Score =  743 bits (1919), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/793 (45%), Positives = 520/793 (65%), Gaps = 17/793 (2%)
Query: 3   LRLEIKRKLAQRSERVKSVDLHPSEPWILASLYSGTVCIWNYQSQTMAKSFEVTELPVRS 62
           ++L+IK+  + RS+RVK +D HP+EPW+L +LYSG V IWNY++Q   +S +VTE PVR+
Sbjct: 1   MKLDIKKTFSNRSDRVKGIDFHPTEPWVLTTLYSGRVEIWNYETQVEVRSIQVTETPVRA 60
Query: 63  AKFVARKQWVVAGADDMFIRVYNYNTMDKVKVFEAHTDYIRCVAVHPTLPYVLSSSDDML 122
            KF+ARK W++ G+DD  IRV+NYNT +KV  FEAH DYIR +AVHPT PYVLS SDD+ 
Sbjct: 61  GKFIARKNWIIVGSDDFRIRVFNYNTGEKVVDFEAHPDYIRSIAVHPTKPYVLSGSDDLT 120
Query: 123 IKLWDWEKGWMCTQIFEGHSHYVMQVTFNPKDTNTFASASLDRTIKIWNLGSPDPNFTLD 182
           +KLW+WE  W   Q FEGH H+VM V FNPKD +TFAS  LDRT+K+W+LG   PNFTL 
Sbjct: 121 VKLWNWENNWALEQTFEGHEHFVMCVAFNPKDPSTFASGCLDRTVKVWSLGQSTPNFTLT 180
Query: 183 AHQ-KGVNCVDYFTGGDKPYLITGSDDHTAKVWDYQTKSCVQTLEGHTHNVSAVCFHPEL 241
             Q +GVN VDY+   DKPY+IT SDD T K+WDYQTKSCV TLEGH  NVS   FHP L
Sbjct: 181 TGQERGVNYVDYYPLPDKPYMITASDDLTIKIWDYQTKSCVATLEGHMSNVSFAVFHPTL 240
Query: 242 PIIITGSEDGTVRIWHATTYRLENTLNYGLERVWAIGYMKSSRR--IVIGYDEGTIMVKI 299
           PIII+GSEDGT++IW+++TY++E TLN GLER W I    + R+  I  G+D G  ++ +
Sbjct: 241 PIIISGSEDGTLKIWNSSTYKVEKTLNVGLERSWCIATHPTGRKNYIASGFDNGFTVLSL 300
Query: 300 GREEPVASMDNSGKIIWA--KHNEIQTVNIKSVGADYEVTDGERLPLAVKELGTCDLYPQ 357
           G +EP  S+D  GK++W+  K+     +    +  + EV   E L L  KELG+ D++PQ
Sbjct: 301 GNDEPTLSLDPVGKLVWSGGKNAAASDIFTAVIRGNEEVEQDEPLSLQTKELGSVDVFPQ 360
Query: 358 SLKHNPNGRFVVVCGDGEYIIYTALAWRNRSFGSALEFVWSSDGEYAVREXXXXXXXXXX 417
           SL H+PNGRFV V GDGEY+IYTALAWRN++FG   +FVW  D                 
Sbjct: 361 SLAHSPNGRFVTVVGDGEYVIYTALAWRNKAFGKCQDFVWGPDSNSYALIDETGQIKYYK 420
Query: 418 NFQEKRSVR-PTFSA-ERIYGGTLLAMCSNDFICFYDWAECRLIRRIDVTVKNLYWADSG 475
           NF+E  S   P  SA +R++ G LL + S+ F+ F+DW    L+RRIDV  K++ W+D+G
Sbjct: 421 NFKEVTSWSVPMHSAIDRLFSGALLGVKSDGFVYFFDWDNGTLVRRIDVNAKDVIWSDNG 480
Query: 476 DLVAIAS------DTSFYILKYNRDVVSAYLDSGKPVDEQGVEDAFELLHETNERVRTGL 529
           +LV I +      + S Y L +N+D      ++G   D +GV++AF++L+E +E + +G 
Sbjct: 481 ELVMIVNTNSNGDEASGYTLLFNKDAYLEAANNGNIDDSEGVDEAFDVLYELSESITSGK 540
Query: 530 WVGDCFIYNNSSWRLNYCVGGEVTTMFHLDRPMYLLGYLASQSRVYLIDKEFNVMGYTLL 589
           WVGD FI+  ++ RLNY VGG+   + H  + MYLLGYLA  ++VYL D+E +V GY + 
Sbjct: 541 WVGDVFIFTTATNRLNYFVGGKTYNLAHYTKEMYLLGYLARDNKVYLADREVHVYGYEIS 600
Query: 590 LSLIEYKTLVMRGDLERANE-ILPSIP-KEHHNSVARFLESRGMIEEAIEVATDPDYRFE 647
           L ++E++TL +RG++E A E +LP++  K+    +ARFLE +   EEA+ ++ D D +FE
Sbjct: 601 LEVLEFQTLTLRGEIEEAIENVLPNVEGKDSLTKIARFLEGQEYYEEALNISPDQDQKFE 660
Query: 648 LAIQLGRLEVAQEIATEVQSESKWKQLGELAMSTGKLEMAEGCMKQAMDXXXXXXXXXXX 707
           LA+++G+L +A+++ T+  +E KW+ LG+ ++     ++A      A D           
Sbjct: 661 LALKVGQLTLARDLLTDESAEMKWRALGDASLQRFNFKLAIEAFTNAHDLESLFLLHSSF 720
Query: 708 XDAEGISKLASLAKEQGKNNVAFLCLFMLGKLEDCLQLLVESNRIPEAALMARSY--LPS 765
            + EG+  LA  A+  GK N+AF   ++ G ++    LL++S R  EAA +  +Y    +
Sbjct: 721 NNKEGLVTLAKDAETTGKFNLAFNAYWIAGDIQGAKDLLIKSQRFSEAAFLGSTYGLGDN 780
Query: 766 KVSEIVAIWRKDL 778
           +V++IV  W+++L
Sbjct: 781 EVNDIVTKWKENL 793
>pdb|2YNP|A Chain A, Yeast Betaprime Cop 1-604 With Ktktn Motif Length = 604 Back     alignment and structure
>pdb|2YNO|A Chain A, Yeast Betaprime Cop 1-304h6 Length = 310 Back     alignment and structure
>pdb|2YNN|A Chain A, Yeast Betaprime Cop 1-304 With Ktktn Motif Length = 304 Back     alignment and structure
>pdb|1VYH|C Chain C, Paf-Ah Holoenzyme: Lis1ALFA2 Length = 410 Back     alignment and structure
>pdb|1VYH|C Chain C, Paf-Ah Holoenzyme: Lis1ALFA2 Length = 410 Back     alignment and structure
>pdb|2YMU|A Chain A, Structure Of A Highly Repetitive Propeller Structure Length = 577 Back     alignment and structure
>pdb|2YMU|A Chain A, Structure Of A Highly Repetitive Propeller Structure Length = 577 Back     alignment and structure
>pdb|3MXX|A Chain A, Crystal Structure Of Wdr5 Mutant (S62a) Length = 315 Back     alignment and structure
>pdb|3MXX|A Chain A, Crystal Structure Of Wdr5 Mutant (S62a) Length = 315 Back     alignment and structure
>pdb|3MXX|A Chain A, Crystal Structure Of Wdr5 Mutant (S62a) Length = 315 Back     alignment and structure
>pdb|2CNX|A Chain A, Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2.1 Angstrom Length = 315 Back     alignment and structure
>pdb|2CNX|A Chain A, Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2.1 Angstrom Length = 315 Back     alignment and structure
>pdb|3N0E|A Chain A, Crystal Structure Of Wdr5 Mutant (W330y) Length = 315 Back     alignment and structure
>pdb|3N0E|A Chain A, Crystal Structure Of Wdr5 Mutant (W330y) Length = 315 Back     alignment and structure
>pdb|3N0E|A Chain A, Crystal Structure Of Wdr5 Mutant (W330y) Length = 315 Back     alignment and structure
>pdb|3N0D|A Chain A, Crystal Structure Of Wdr5 Mutant (W330f) Length = 315 Back     alignment and structure
>pdb|3N0D|A Chain A, Crystal Structure Of Wdr5 Mutant (W330f) Length = 315 Back     alignment and structure
>pdb|3N0D|A Chain A, Crystal Structure Of Wdr5 Mutant (W330f) Length = 315 Back     alignment and structure
>pdb|3EMH|A Chain A, Structural Basis Of Wdr5-Mll Interaction Length = 318 Back     alignment and structure
>pdb|3EMH|A Chain A, Structural Basis Of Wdr5-Mll Interaction Length = 318 Back     alignment and structure
>pdb|3EMH|A Chain A, Structural Basis Of Wdr5-Mll Interaction Length = 318 Back     alignment and structure
>pdb|2H9L|A Chain A, Wdr5delta23 Length = 329 Back     alignment and structure
>pdb|2H9L|A Chain A, Wdr5delta23 Length = 329 Back     alignment and structure
>pdb|2H9L|A Chain A, Wdr5delta23 Length = 329 Back     alignment and structure
>pdb|2H13|A Chain A, Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length = 317 Back     alignment and structure
>pdb|2H13|A Chain A, Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length = 317 Back     alignment and structure
>pdb|2H13|A Chain A, Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length = 317 Back     alignment and structure
>pdb|2GNQ|A Chain A, Structure Of Wdr5 Length = 336 Back     alignment and structure
>pdb|2GNQ|A Chain A, Structure Of Wdr5 Length = 336 Back     alignment and structure
>pdb|3PSL|A Chain A, Fine-Tuning The Stimulation Of Mll1 Methyltransferase Activity By A Histone H3 Based Peptide Mimetic Length = 318 Back     alignment and structure
>pdb|3PSL|A Chain A, Fine-Tuning The Stimulation Of Mll1 Methyltransferase Activity By A Histone H3 Based Peptide Mimetic Length = 318 Back     alignment and structure
>pdb|3PSL|A Chain A, Fine-Tuning The Stimulation Of Mll1 Methyltransferase Activity By A Histone H3 Based Peptide Mimetic Length = 318 Back     alignment and structure
>pdb|4A7J|A Chain A, Symmetric Dimethylation Of H3 Arginine 2 Is A Novel Histone Mark That Supports Euchromatin Maintenance Length = 318 Back     alignment and structure
>pdb|4A7J|A Chain A, Symmetric Dimethylation Of H3 Arginine 2 Is A Novel Histone Mark That Supports Euchromatin Maintenance Length = 318 Back     alignment and structure
>pdb|4A7J|A Chain A, Symmetric Dimethylation Of H3 Arginine 2 Is A Novel Histone Mark That Supports Euchromatin Maintenance Length = 318 Back     alignment and structure
>pdb|2G9A|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 311 Back     alignment and structure
>pdb|2G9A|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 311 Back     alignment and structure
>pdb|2G9A|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 311 Back     alignment and structure
>pdb|2XL2|A Chain A, Wdr5 In Complex With An Rbbp5 Peptide Recruited To Novel Site Length = 334 Back     alignment and structure
>pdb|2XL2|A Chain A, Wdr5 In Complex With An Rbbp5 Peptide Recruited To Novel Site Length = 334 Back     alignment and structure
>pdb|2G99|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 308 Back     alignment and structure
>pdb|2G99|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 308 Back     alignment and structure
>pdb|2G99|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 308 Back     alignment and structure
>pdb|2H68|A Chain A, Histone H3 Recognition And Presentation By The Wdr5 Module Of The Mll1 Complex Length = 312 Back     alignment and structure
>pdb|2H68|A Chain A, Histone H3 Recognition And Presentation By The Wdr5 Module Of The Mll1 Complex Length = 312 Back     alignment and structure
>pdb|2H68|A Chain A, Histone H3 Recognition And Presentation By The Wdr5 Module Of The Mll1 Complex Length = 312 Back     alignment and structure
>pdb|2H9M|A Chain A, Wdr5 In Complex With Unmodified H3k4 Peptide Length = 313 Back     alignment and structure
>pdb|2H9M|A Chain A, Wdr5 In Complex With Unmodified H3k4 Peptide Length = 313 Back     alignment and structure
>pdb|2H9M|A Chain A, Wdr5 In Complex With Unmodified H3k4 Peptide Length = 313 Back     alignment and structure
>pdb|3SMR|A Chain A, Crystal Structure Of Human Wd Repeat Domain 5 With Compound Length = 312 Back     alignment and structure
>pdb|3SMR|A Chain A, Crystal Structure Of Human Wd Repeat Domain 5 With Compound Length = 312 Back     alignment and structure
>pdb|3SMR|A Chain A, Crystal Structure Of Human Wd Repeat Domain 5 With Compound Length = 312 Back     alignment and structure
>pdb|2CO0|A Chain A, Wdr5 And Unmodified Histone H3 Complex At 2.25 Angstrom Length = 315 Back     alignment and structure
>pdb|2CO0|A Chain A, Wdr5 And Unmodified Histone H3 Complex At 2.25 Angstrom Length = 315 Back     alignment and structure
>pdb|2CO0|A Chain A, Wdr5 And Unmodified Histone H3 Complex At 2.25 Angstrom Length = 315 Back     alignment and structure
>pdb|2OVP|B Chain B, Structure Of The Skp1-Fbw7 Complex Length = 445 Back     alignment and structure
>pdb|2OVP|B Chain B, Structure Of The Skp1-Fbw7 Complex Length = 445 Back     alignment and structure
>pdb|3ZEY|7 Chain 7, High-resolution Cryo-electron Microscopy Structure Of The Trypanosoma Brucei Ribosome Length = 318 Back     alignment and structure
>pdb|1P22|A Chain A, Structure Of A Beta-Trcp1-Skp1-Beta-Catenin Complex: Destruction Motif Binding And Lysine Specificity On The Scfbeta-Trcp1 Ubiquitin Ligase Length = 435 Back     alignment and structure
>pdb|1P22|A Chain A, Structure Of A Beta-Trcp1-Skp1-Beta-Catenin Complex: Destruction Motif Binding And Lysine Specificity On The Scfbeta-Trcp1 Ubiquitin Ligase Length = 435 Back     alignment and structure
>pdb|3DM0|A Chain A, Maltose Binding Protein Fusion With Rack1 From A. Thaliana Length = 694 Back     alignment and structure
>pdb|3DM0|A Chain A, Maltose Binding Protein Fusion With Rack1 From A. Thaliana Length = 694 Back     alignment and structure
>pdb|2PBI|B Chain B, The Multifunctional Nature Of Gbeta5RGS9 REVEALED FROM ITS CRYSTAL Structure Length = 354 Back     alignment and structure
>pdb|2PBI|B Chain B, The Multifunctional Nature Of Gbeta5RGS9 REVEALED FROM ITS CRYSTAL Structure Length = 354 Back     alignment and structure
>pdb|3SFZ|A Chain A, Crystal Structure Of Full-Length Murine Apaf-1 Length = 1249 Back     alignment and structure
>pdb|3SHF|A Chain A, Crystal Structure Of The R265s Mutant Of Full-Length Murine Apaf-1 Length = 1256 Back     alignment and structure
>pdb|3IZ6|AA Chain a, Localization Of The Small Subunit Ribosomal Proteins Into A 5.5 A Cryo-Em Map Of Triticum Aestivum Translating 80s Ribosome Length = 380 Back     alignment and structure
>pdb|1ERJ|A Chain A, Crystal Structure Of The C-Terminal Wd40 Domain Of Tup1 Length = 393 Back     alignment and structure
>pdb|1ERJ|A Chain A, Crystal Structure Of The C-Terminal Wd40 Domain Of Tup1 Length = 393 Back     alignment and structure
>pdb|2BCJ|B Chain B, Crystal Structure Of G Protein-coupled Receptor Kinase 2 In Complex With Galpha-q And Gbetagamma Subunits Length = 340 Back     alignment and structure
>pdb|1GG2|B Chain B, G Protein Heterotrimer Mutant Gi_alpha_1(G203a) Beta_1 Gamma_2 With Gdp Bound Length = 340 Back     alignment and structure
>pdb|3SN6|B Chain B, Crystal Structure Of The Beta2 Adrenergic Receptor-Gs Protein Complex Length = 351 Back     alignment and structure
>pdb|4AOW|A Chain A, Crystal Structure Of The Human Rack1 Protein At A Resolution Of 2.45 Angstrom Length = 340 Back     alignment and structure
>pdb|1GOT|B Chain B, Heterotrimeric Complex Of A Gt-AlphaGI-Alpha Chimera And The Gt-Beta-Gamma Subunits Length = 340 Back     alignment and structure
>pdb|3OW8|A Chain A, Crystal Structure Of The Wd Repeat-Containing Protein 61 Length = 321 Back     alignment and structure
>pdb|3OW8|A Chain A, Crystal Structure Of The Wd Repeat-Containing Protein 61 Length = 321 Back     alignment and structure
>pdb|1A0R|B Chain B, Heterotrimeric Complex Of PhosducinTRANSDUCIN BETA-Gamma Length = 340 Back     alignment and structure
>pdb|2ZKQ|AA Chain a, Structure Of A Mammalian Ribosomal 40s Subunit Within An 80s Complex Obtained By Docking Homology Models Of The Rna And Proteins Into An 8.7 A Cryo-Em Map Length = 317 Back     alignment and structure
>pdb|1NEX|B Chain B, Crystal Structure Of Scskp1-Sccdc4-Cpd Peptide Complex Length = 464 Back     alignment and structure
>pdb|3MKS|B Chain B, Crystal Structure Of Yeast Cdc4SKP1 IN COMPLEX WITH AN ALLOSTERIC Inhibitor Scf-I2 Length = 464 Back     alignment and structure
>pdb|3FM0|A Chain A, Crystal Structure Of Wd40 Protein Ciao1 Length = 345 Back     alignment and structure
>pdb|3FM0|A Chain A, Crystal Structure Of Wd40 Protein Ciao1 Length = 345 Back     alignment and structure
>pdb|3FRX|A Chain A, Crystal Structure Of The Yeast Orthologue Of Rack1, Asc1. Length = 319 Back     alignment and structure
>pdb|4GGA|A Chain A, Structural Analysis Of Human Cdc20 Supports Multi-Site Degron Recognition By ApcC Length = 420 Back     alignment and structure
>pdb|3RFG|A Chain A, Crystal Structure Of The Yeast Rack1 Dimer In Space Group P63 Length = 319 Back     alignment and structure
>pdb|3IZB|AA Chain a, Localization Of The Small Subunit Ribosomal Proteins Into A 6.1 A Cryo-Em Map Of Saccharomyces Cerevisiae Translating 80s Ribosome Length = 319 Back     alignment and structure
>pdb|1TRJ|A Chain A, Homology Model Of Yeast Rack1 Protein Fitted Into 11.7a Cryo-em Map Of Yeast 80s Ribosome Length = 314 Back     alignment and structure
>pdb|4GGD|A Chain A, Structural Analysis Of Human Cdc20 Supports Multisite Degron Recognition By ApcC. Length = 431 Back     alignment and structure
>pdb|3RFH|A Chain A, Crystal Structure Of The Yeast Rack1 Dimer In Space Group P21 Length = 319 Back     alignment and structure
>pdb|3JYV|R Chain R, Structure Of The 40s Rrna And Proteins And PE TRNA FOR EUKARYOTIC Ribosome Based On Cryo-Em Map Of Thermomyces Lanuginosus Ribosome At 8.9a Resolution Length = 313 Back     alignment and structure
>pdb|4GGC|A Chain A, Structural Analysis Of Human Cdc20 Supports Multi-Site Degron Recognition By ApcC Length = 318 Back     alignment and structure
>pdb|2HES|X Chain X, Cytosolic Iron-sulphur Assembly Protein- 1 Length = 330 Back     alignment and structure
>pdb|3C99|A Chain A, Structural Basis Of Histone H4 Recognition By P55 Length = 432 Back     alignment and structure
>pdb|2XYI|A Chain A, Crystal Structure Of Nurf55 In Complex With A H4 Peptide Length = 430 Back     alignment and structure
>pdb|2YBA|A Chain A, Crystal Structure Of Nurf55 In Complex With Histone H3 Length = 422 Back     alignment and structure
>pdb|2XZM|R Chain R, Crystal Structure Of The Eukaryotic 40s Ribosomal Subunit In Complex With Initiation Factor 1. This File Contains The 40s Subunit And Initiation Factor For Molecule 1 Length = 343 Back     alignment and structure
>pdb|2XZM|R Chain R, Crystal Structure Of The Eukaryotic 40s Ribosomal Subunit In Complex With Initiation Factor 1. This File Contains The 40s Subunit And Initiation Factor For Molecule 1 Length = 343 Back     alignment and structure
>pdb|3CFV|B Chain B, Structural Basis Of The Interaction Of Rbap46RBAP48 WITH Histone H4 Length = 414 Back     alignment and structure
>pdb|4G56|B Chain B, Crystal Structure Of Full Length Prmt5/mep50 Complexes From Xenopus Laevis Length = 357 Back     alignment and structure
>pdb|3CFS|B Chain B, Structural Basis Of The Interaction Of Rbap46RBAP48 WITH Histone H4 Length = 414 Back     alignment and structure
>pdb|3ODT|A Chain A, Crystal Structure Of Wd40 Beta Propeller Domain Of Doa1 Length = 313 Back     alignment and structure
>pdb|3GFC|A Chain A, Crystal Structure Of Histone-Binding Protein Rbbp4 Length = 425 Back     alignment and structure
>pdb|4GQB|B Chain B, Crystal Structure Of The Human Prmt5:mep50 Complex Length = 344 Back     alignment and structure
>pdb|4A11|B Chain B, Structure Of The Hsddb1-Hscsa Complex Length = 408 Back     alignment and structure
>pdb|3ACP|A Chain A, Crystal Structure Of Yeast Rpn14, A Chaperone Of The 19s Reg Particle Of The Proteasome Length = 417 Back     alignment and structure
>pdb|3ACP|A Chain A, Crystal Structure Of Yeast Rpn14, A Chaperone Of The 19s Reg Particle Of The Proteasome Length = 417 Back     alignment and structure
>pdb|3VL1|A Chain A, Crystal Structure Of Yeast Rpn14 Length = 420 Back     alignment and structure
>pdb|3VL1|A Chain A, Crystal Structure Of Yeast Rpn14 Length = 420 Back     alignment and structure
>pdb|1NR0|A Chain A, Two Seven-Bladed Beta-Propeller Domains Revealed By The Structure Of A C. Elegans Homologue Of Yeast Actin Interacting Protein 1 (Aip1). Length = 611 Back     alignment and structure
>pdb|1GXR|A Chain A, Wd40 Region Of Human Groucho/tle1 Length = 337 Back     alignment and structure
>pdb|3MMY|A Chain A, Structural And Functional Analysis Of The Interaction Between The Nucleoporin Nup98 And The Mrna Export Factor Rae1 Length = 368 Back     alignment and structure
>pdb|2AQ5|A Chain A, Crystal Structure Of Murine Coronin-1 Length = 402 Back     alignment and structure
>pdb|1PI6|A Chain A, Yeast Actin Interacting Protein 1 (Aip1), Orthorhombic Crystal Form Length = 615 Back     alignment and structure
>pdb|2B4E|A Chain A, Crystal Structure Of Murine Coronin-1: Monoclinic Form Length = 402 Back     alignment and structure
>pdb|1PGU|A Chain A, Yeast Actin Interacting Protein 1 (aip1), Se-met Protein, Monoclinic Crystal Form Length = 615 Back     alignment and structure
>pdb|3EI4|B Chain B, Structure Of The Hsddb1-Hsddb2 Complex Length = 436 Back     alignment and structure
>pdb|4E54|B Chain B, Damaged Dna Induced Uv-Damaged Dna-Binding Protein (Uv-Ddb) Dimerization And Its Roles In Chromatinized Dna Repair Length = 435 Back     alignment and structure
>pdb|4E5Z|B Chain B, Damaged Dna Induced Uv-Damaged Dna-Binding Protein (Uv-Ddb) Dimerization And Its Roles In Chromatinized Dna Repair Length = 436 Back     alignment and structure
>pdb|4AEZ|A Chain A, Crystal Structure Of Mitotic Checkpoint Complex Length = 401 Back     alignment and structure
>pdb|3JRO|A Chain A, Nup84-Nup145c-Sec13 Edge Element Of The Npc Lattice Length = 753 Back     alignment and structure
>pdb|3GRE|A Chain A, Crystal Structure Of Saccharomyces Cerevisiae Vps15 Wd Repeat Domain Length = 437 Back     alignment and structure
>pdb|2QXV|A Chain A, Structural Basis Of Ezh2 Recognition By Eed Length = 361 Back     alignment and structure
>pdb|3JZN|A Chain A, Structure Of Eed In Apo Form Length = 366 Back     alignment and structure
>pdb|3IIW|A Chain A, Crystal Structure Of Eed In Complex With A Trimethylated Histone H3k27 Peptide Length = 365 Back     alignment and structure
>pdb|3IIY|A Chain A, Crystal Structure Of Eed In Complex With A Trimethylated Histone H1k26 Peptide Length = 365 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

No hit with probability above 80.00

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 914
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 5e-46
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 2e-28
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 5e-27
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 4e-18
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 5e-38
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 4e-32
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 1e-25
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 2e-25
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 2e-15
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 1e-24
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 3e-23
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 1e-15
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 7e-08
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 3e-24
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 6e-17
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 2e-10
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 2e-09
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 4e-21
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 1e-16
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 2e-16
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 8e-15
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 6e-09
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 9e-21
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 1e-17
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 8e-13
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 2e-12
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 2e-11
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 1e-09
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 2e-08
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 2e-20
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 8e-19
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 4e-12
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 5e-12
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 7e-19
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 2e-16
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 1e-09
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 3e-18
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 1e-14
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 1e-09
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 3e-09
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 1e-17
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 8e-13
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 3e-12
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 7e-10
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 7e-17
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 7e-10
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 3e-16
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 2e-14
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 9e-14
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 1e-11
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 4e-06
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 3e-15
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 4e-09
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 7e-09
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 2e-08
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 9e-15
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 1e-09
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 2e-07
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 1e-14
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 1e-11
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 7e-11
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 2e-10
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 4e-10
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 5e-09
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 2e-08
d1pbyb_337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 3e-14
d1pbyb_337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 2e-11
d1pbyb_337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 1e-08
d1pbyb_337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 3e-05
d2bbkh_355 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 2e-12
d2bbkh_355 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 9e-10
d1mdah_368 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 2e-11
d1mdah_368 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 0.001
d1l0qa2301 b.69.2.3 (A:1-301) Surface layer protein {Archaeon 2e-11
d1l0qa2301 b.69.2.3 (A:1-301) Surface layer protein {Archaeon 1e-06
d1l0qa2301 b.69.2.3 (A:1-301) Surface layer protein {Archaeon 0.002
d1hzua2426 b.70.2.1 (A:118-543) C-terminal (heme d1) domain o 6e-08
d1hzua2426 b.70.2.1 (A:118-543) C-terminal (heme d1) domain o 2e-07
d1hzua2426 b.70.2.1 (A:118-543) C-terminal (heme d1) domain o 2e-07
d1ri6a_333 b.69.11.1 (A:) Putative isomerase YbhE {Escherichi 8e-08
d1qksa2432 b.70.2.1 (A:136-567) C-terminal (heme d1) domain o 4e-06
d1qnia2441 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-ter 2e-04
d1qnia2441 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-ter 5e-04
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure

class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Platelet-activating factor acetylhydrolase IB subunit alpha
species: Mouse (Mus musculus) [TaxId: 10090]

 Score =  165 bits (418), Expect = 5e-46
 Identities = 77/312 (24%), Positives = 146/312 (46%), Gaps = 20/312 (6%)

Query: 4   RLEIKRKLAQRSERVKSVDLHPSEPWILASLYSGTVCIWNYQSQTMAKSFEVTELPVRSA 63
           R   K  L+     V  V  HP    ++++    T+ +W+Y++    ++ +     V+  
Sbjct: 6   RPPEKYALSGHRSPVTRVIFHPVFSVMVSASEDATIKVWDYETGDFERTLKGHTDSVQDI 65

Query: 64  KFVARKQWVVAGADDMFIRVYNYNTMDKVKVFEAHTDYIRCVAVHPTLPYVLSSSDDMLI 123
            F    + + + + DM I+++++   + ++    H   +  V++ P   +++S+S D  I
Sbjct: 66  SFDHSGKLLASCSADMTIKLWDFQGFECIRTMHGHDHNVSSVSIMPNGDHIVSASRDKTI 125

Query: 124 KLWDWEKGWMCTQIFEGHSHYVMQVTFNPKDTNTFASASLDRTIKIWNLGSPDPNFTLDA 183
           K+W+ +    C + F GH  +V  V  N  D    AS S D+T+++W + + +    L  
Sbjct: 126 KMWEVQT-GYCVKTFTGHREWVRMVRPNQ-DGTLIASCSNDQTVRVWVVATKECKAELRE 183

Query: 184 HQKGVNCVDYF------------------TGGDKPYLITGSDDHTAKVWDYQTKSCVQTL 225
           H+  V C+ +                   +G   P+L++GS D T K+WD  T  C+ TL
Sbjct: 184 HRHVVECISWAPESSYSSISEATGSETKKSGKPGPFLLSGSRDKTIKMWDVSTGMCLMTL 243

Query: 226 EGHTHNVSAVCFHPELPIIITGSEDGTVRIWHATTYRLENTLNYGLERVWAIGYMKSSRR 285
            GH + V  V FH     I++ ++D T+R+W     R   TLN     V ++ + K++  
Sbjct: 244 VGHDNWVRGVLFHSGGKFILSCADDKTLRVWDYKNKRCMKTLNAHEHFVTSLDFHKTAPY 303

Query: 286 IVIGYDEGTIMV 297
           +V G  + T+ V
Sbjct: 304 VVTGSVDQTVKV 315
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 355 Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 355 Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 368 Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 368 Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Length = 301 Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Length = 301 Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Length = 301 Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Length = 426 Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Length = 426 Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Length = 426 Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Length = 333 Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Length = 432 Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Length = 441 Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Length = 441 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query914
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 100.0
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 100.0
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 100.0
d1tbga_340 beta1-subunit of the signal-transducing G protein 100.0
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 100.0
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 100.0
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 100.0
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 100.0
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1tbga_340 beta1-subunit of the signal-transducing G protein 100.0
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 100.0
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 100.0
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 100.0
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 100.0
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 100.0
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 100.0
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 100.0
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 100.0
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 100.0
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 100.0
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 100.0
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.98
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.98
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.97
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.97
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.97
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.97
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.97
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.96
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.96
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.95
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.95
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.93
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.92
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.91
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.9
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.89
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.86
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.86
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.85
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.85
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.83
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.82
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.77
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.72
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.7
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.67
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 99.6
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 99.48
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 99.47
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 99.45
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 99.4
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 99.4
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 99.37
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 99.36
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 99.35
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 99.35
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 99.33
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 99.25
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 99.24
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 99.24
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 99.23
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 99.18
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 99.0
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 98.97
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 98.94
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 98.58
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 98.56
d1utca2327 Clathrin heavy-chain terminal domain {Rat (Rattus 98.38
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 98.08
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 98.08
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 97.95
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 97.88
d1utca2327 Clathrin heavy-chain terminal domain {Rat (Rattus 97.83
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 97.81
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 97.8
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 97.76
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 97.65
d1w6sa_596 Methanol dehydrogenase, heavy chain {Methylobacter 97.62
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 97.56
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 97.54
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 97.42
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 97.4
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 97.35
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 97.27
d1flga_582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 97.22
d1qfma1430 Prolyl oligopeptidase, N-terminal domain {Pig (Sus 96.78
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 96.74
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 96.63
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 95.83
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 95.51
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 95.48
d1w6sa_596 Methanol dehydrogenase, heavy chain {Methylobacter 95.34
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 94.78
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 94.63
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 94.05
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 93.99
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 93.86
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 93.23
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 93.15
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 92.63
d1flga_582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 91.95
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 91.84
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 90.97
d1qfma1430 Prolyl oligopeptidase, N-terminal domain {Pig (Sus 90.93
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 90.86
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 89.69
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 86.43
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 85.77
d1xipa_381 Nucleoporin NUP159 {Baker's yeast (Saccharomyces c 85.72
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 84.96
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 84.84
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 83.58
d2hu7a1313 Acylamino-acid-releasing enzyme, N-terminal donain 81.27
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Platelet-activating factor acetylhydrolase IB subunit alpha
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=100.00  E-value=1.1e-43  Score=292.49  Aligned_cols=294  Identities=26%  Similarity=0.485  Sum_probs=276.0

Q ss_pred             CCHHHHHCCCCCCCEEEEEECCCCCEEEEEECCCCEEEEECCCCCEEEEEEECCCCEEEEEEECCCCEEEEEECCCEEEE
Q ss_conf             20342342458888899999689997999966991999958999344796405988679999659999999978977999
Q 002511            4 RLEIKRKLAQRSERVKSVDLHPSEPWILASLYSGTVCIWNYQSQTMAKSFEVTELPVRSAKFVARKQWVVAGADDMFIRV   83 (914)
Q Consensus         4 ~~~~~~~l~~h~~~v~~i~~sp~~~~la~~~~~g~v~iwd~~~~~~~~~~~~~~~~v~~i~~s~~~~~l~~g~~dg~i~i   83 (914)
                      +...+..|.||.+.|++++|+|++++|++|+.||.|+|||+.+++.+.++..|..+|.++.|+|++..++++..++.+.+
T Consensus         6 ~~~~~~~L~GH~~~I~~l~~sp~~~~l~s~s~Dg~i~iWd~~~~~~~~~~~~h~~~V~~~~~~~~~~~~~~~~~~~~~~~   85 (317)
T d1vyhc1           6 RPPEKYALSGHRSPVTRVIFHPVFSVMVSASEDATIKVWDYETGDFERTLKGHTDSVQDISFDHSGKLLASCSADMTIKL   85 (317)
T ss_dssp             CSSCSCEEECCSSCEEEEEECSSSSEEEEEESSSCEEEEETTTCCCCEEECCCSSCEEEEEECTTSSEEEEEETTSCCCE
T ss_pred             CCCCCEEECCCCCCEEEEEECCCCCEEEEEECCCEEEEEECCCCCEEEEEECCCCCEEEEEEECCCCCCCCCCCCCCCCC
T ss_conf             89844898588887689999389899999938992999989999799999578886777763011110111111111011


Q ss_pred             EECCCCEEEEEEECCCCCEEEEEEECCCCEEEEEECCCEEEEEECCCCCEEEEEEECCCCCEEEEEECCCCCCEEEEEEC
Q ss_conf             98899906699815898779999908999999998699299998799924899840586227999990699999999968
Q 002511           84 YNYNTMDKVKVFEAHTDYIRCVAVHPTLPYVLSSSDDMLIKLWDWEKGWMCTQIFEGHSHYVMQVTFNPKDTNTFASASL  163 (914)
Q Consensus        84 wd~~t~~~~~~~~~h~~~i~~i~~~~~~~~l~~~~~dg~i~iwd~~~~~~~~~~~~~~~~~i~~i~~~p~~~~~l~~~~~  163 (914)
                      |+....+....+..|...+.++.|++++..+++++.|+.+.+|+++++ .....+.+|...+.++.|+| ++.++++++.
T Consensus        86 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~-~~~~l~~~~~  163 (317)
T d1vyhc1          86 WDFQGFECIRTMHGHDHNVSSVSIMPNGDHIVSASRDKTIKMWEVQTG-YCVKTFTGHREWVRMVRPNQ-DGTLIASCSN  163 (317)
T ss_dssp             EETTSSCEEECCCCCSSCEEEEEECSSSSEEEEEETTSEEEEEETTTC-CEEEEEECCSSCEEEEEECT-TSSEEEEEET
T ss_pred             CCCCCCCCCCCCCCCCCCCEEEECCCCCCEEEEECCCCCEEEEECCCC-EEEEEECCCCCCCEEEECCC-CCCEEEEEEC
T ss_conf             100111111110000000000001699855776526752357511443-03468716777630000166-7999999927


Q ss_pred             CCCEEEEECCCCCCCEEEECCCCCEEEEEEEECCC------------------CCEEEEEECCCEEEEEECCCCCEEEEE
Q ss_conf             99299998999997179806898746999966799------------------589999986993999978999468984
Q 002511          164 DRTIKIWNLGSPDPNFTLDAHQKGVNCVDYFTGGD------------------KPYLITGSDDHTAKVWDYQTKSCVQTL  225 (914)
Q Consensus       164 dg~i~iwd~~~~~~~~~~~~~~~~v~~i~~~~~~~------------------~~~l~~~~~dg~i~iwd~~~~~~~~~~  225 (914)
                      |+.|++|+..+......+..+...+.++.+++...                  ..++++++.|+.|++|+.+++.++.++
T Consensus       164 d~~v~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~i~~~~~~~~~~~~~~  243 (317)
T d1vyhc1         164 DQTVRVWVVATKECKAELREHRHVVECISWAPESSYSSISEATGSETKKSGKPGPFLLSGSRDKTIKMWDVSTGMCLMTL  243 (317)
T ss_dssp             TSCEEEEETTTCCEEEEECCCSSCEEEEEECCSCGGGGGGGCCSCC-------CCEEEEEETTSEEEEEETTTTEEEEEE
T ss_pred             CCEEEEEEECCCEEEEEEECCCCCCEEEEEEECCCCCEEECCCCCEEEEECCCCCEEEECCCCCEEEEEECCCCCEEEEE
T ss_conf             98299975125403478824778733799863256411103456303430258861475169978999888999688999


Q ss_pred             CCCCCCEEEEEEECCCCEEEEEECCCEEEEEECCCCEEEEEEECCCCCEEEEEEECCCCEEEEEECCCEEEEEC
Q ss_conf             27533669999908999899998799099996998615777503884489999954999799996289089981
Q 002511          226 EGHTHNVSAVCFHPELPIIITGSEDGTVRIWHATTYRLENTLNYGLERVWAIGYMKSSRRIVIGYDEGTIMVKI  299 (914)
Q Consensus       226 ~~~~~~i~~i~~~~~~~~l~~~~~dg~i~iwd~~~~~~~~~~~~~~~~v~~i~~~~~~~~l~~~~~dg~i~i~~  299 (914)
                      .+|...|.+++++|++++|++++.||.|++||+.+++++.++..|...|++++|+|++++|++++.||.|++|.
T Consensus       244 ~~~~~~v~~~~~~~~~~~l~s~~~dg~i~iwd~~~~~~~~~~~~h~~~V~~~~~s~~~~~l~s~s~Dg~i~iWd  317 (317)
T d1vyhc1         244 VGHDNWVRGVLFHSGGKFILSCADDKTLRVWDYKNKRCMKTLNAHEHFVTSLDFHKTAPYVVTGSVDQTVKVWE  317 (317)
T ss_dssp             ECCSSCEEEEEECSSSSCEEEEETTTEEEEECCTTSCCCEEEECCSSCEEEEEECSSSSCEEEEETTSEEEEEC
T ss_pred             ECCCCCEEEEEECCCCCEEEEEECCCEEEEEECCCCCEEEEECCCCCCEEEEEECCCCCEEEEEECCCEEEEEC
T ss_conf             68899879999879999999997989499999999919999928999889999949999999992899499829
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1xipa_ b.69.14.1 (A:) Nucleoporin NUP159 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hu7a1 b.69.7.2 (A:9-321) Acylamino-acid-releasing enzyme, N-terminal donain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure