Citrus Sinensis ID: 002514
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 913 | ||||||
| 225464712 | 1021 | PREDICTED: receptor-like protein 12-like | 0.928 | 0.830 | 0.486 | 0.0 | |
| 359490572 | 975 | PREDICTED: probable LRR receptor-like se | 0.938 | 0.878 | 0.469 | 0.0 | |
| 359490576 | 972 | PREDICTED: LRR receptor-like serine/thre | 0.940 | 0.883 | 0.443 | 0.0 | |
| 147807651 | 971 | hypothetical protein VITISV_018647 [Viti | 0.922 | 0.867 | 0.445 | 0.0 | |
| 224105895 | 963 | predicted protein [Populus trichocarpa] | 0.944 | 0.895 | 0.464 | 0.0 | |
| 225462661 | 1485 | PREDICTED: LRR receptor-like serine/thre | 0.924 | 0.568 | 0.454 | 0.0 | |
| 359490560 | 1010 | PREDICTED: LRR receptor-like serine/thre | 0.934 | 0.844 | 0.425 | 0.0 | |
| 225466147 | 1024 | PREDICTED: LRR receptor-like serine/thre | 0.939 | 0.837 | 0.443 | 0.0 | |
| 224125666 | 938 | predicted protein [Populus trichocarpa] | 0.897 | 0.873 | 0.444 | 0.0 | |
| 224115848 | 884 | predicted protein [Populus trichocarpa] | 0.901 | 0.930 | 0.426 | 0.0 |
| >gi|225464712|ref|XP_002276171.1| PREDICTED: receptor-like protein 12-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 779 bits (2012), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 478/983 (48%), Positives = 598/983 (60%), Gaps = 135/983 (13%)
Query: 37 CIDEEREALLSFKQSLVDEHGFLSSWGSEDNKSDCCEWIGVYCRNKTHHVYALDLQ---- 92
C+++ER+ALL FKQ LVD+ G LSSWG+E+++ DCC+W GV C N+T HV LDL
Sbjct: 52 CVEKERQALLDFKQGLVDDFGILSSWGNEEDRRDCCKWRGVQCSNRTSHVIMLDLHALPT 111
Query: 93 DGSLK---LKGTILSPSLRKLQHLTYLDLSDNDFSGIPIADFIGSLSSKLRHLDLGWAGF 149
D K L+G I S SL +LQHL +LDLS NDF G + +FIG L SKLR+L+L A
Sbjct: 112 DTVHKYQSLRGRI-SSSLLELQHLNHLDLSLNDFQGSYVPEFIG-LFSKLRYLNLSEARL 169
Query: 150 AGSVPPQLGNLSNLQYLNLGYNDLLSVGNLLHWLYHLSSLRYLHLGHNNLSNSNDWPLVV 209
AG +P LGNLSNL +L+L N +S L WL LSSLR+L L NL + W V+
Sbjct: 170 AGMIPSHLGNLSNLHFLDLSRNYGMS-SETLEWLSRLSSLRHLDLSGLNLDKAIYWEHVI 228
Query: 210 YKLSSLTTLILEGCDLPPFF-PSADDPLHLNSSKSLEFLDLSENNLTSSVYPWLFNVSSN 268
+L SLT L+L LP PSA + NSSKSL LDLS N L+SSVYPWLFN+SS+
Sbjct: 229 NRLPSLTDLLLHDSALPQIITPSALS--YTNSSKSLVVLDLSWNFLSSSVYPWLFNLSSS 286
Query: 269 LVELGLSSNLLQG----------------------------------------------- 281
LV L LS N +QG
Sbjct: 287 LVHLDLSINQIQGLIPDTFGEMVSLEYLDLFFNQLEGEIPQSLTSTSLVHLDLSVNHLHG 346
Query: 282 SIPDAFEHMVSLQTLFLYSNELEGGIPKFFGNMCCLNELVLCSNQLTGQLFEFIQNLSCG 341
SIPD F HM SL L L N+LEGGIPK F N+C L ++L SN LT QL EF+QN S
Sbjct: 347 SIPDTFGHMTSLSYLDLSLNQLEGGIPKSFKNLCSLQMVMLLSNSLTAQLPEFVQN-SLS 405
Query: 342 CAKNSLESLDLSANAVTGPIPELGGLSSLKSLYLGGNRLNGTINQSLGRMYKLEKLSLGG 401
C+K++LE L LS N TG P G S L LY+ NRLNGT + +G++ +LE L + G
Sbjct: 406 CSKDTLEVLVLSWNQFTGSFPNFTGFSVLGHLYIDHNRLNGTFPEHIGQLSQLEVLEISG 465
Query: 402 NSLTGVISE------------DFFSNTSNLKNQIDW------------------------ 425
NSL G I+E D SN+ L+ +W
Sbjct: 466 NSLHGNITEAHLSSLSKLYWLDLSSNSLALELSPEWTPPFQVGYLGLLSCKMGPNFPGWL 525
Query: 426 --------LDISNTGISDTIPDWFWDLSRKKLSFLNLSNNQIKGKLPDLSLRFDT---YD 474
LDISN+ ISD IP WFW+L+ K + L ++NNQI+G++P SLR +T D
Sbjct: 526 QTQKDLFSLDISNSSISDVIPSWFWNLTSKLIK-LRIANNQIRGRVP--SLRMETAAVID 582
Query: 475 ISSNHFEGPIPPLPSNASVLNLSKNKFSGSISFLCSISGHKLMYLDLSNNLLSGRLPDCW 534
+S N FEGPIP LPS VL+LSKN FSGSIS LC+I L YLDLS+NLLSG LPDCW
Sbjct: 583 LSLNRFEGPIPSLPSGVRVLSLSKNLFSGSISLLCTIVDGALSYLDLSDNLLSGALPDCW 642
Query: 535 LLF-DRLGILDLANNNFSGKIPDSMGSLPNIQILSLHNNRLTGELPSTLQNCLLLKLMDL 593
+ D+L IL+LANNNFSGK+P S+GSL +Q L L+NN GELPS+L NC L+L+D+
Sbjct: 643 QQWRDQLQILNLANNNFSGKLPYSLGSLAALQTLHLYNNGFLGELPSSLMNCTKLRLVDM 702
Query: 594 GRNALSGEIPTWIGESLPKLIVLSLMSNKFHGIIPFQLCHLPFIQILDLSSNNIPGIIPK 653
G+N SGEIPTWIGE L L+VLSL SN+FHG I +C L +QILD S NNI G IP+
Sbjct: 703 GKNRFSGEIPTWIGERLSDLVVLSLRSNEFHGSISSDICLLKELQILDFSRNNISGTIPR 762
Query: 654 CFNNFTAMAQEK------------------SSVLSVTSNYSFISDGGFPLVWYDNSYFGQ 695
C NNFTAMAQ+ + L +T +++ S G F + Y
Sbjct: 763 CLNNFTAMAQKMIYSVIAHDYLALSIVPRGRNNLGITPRWAY-SSGSFDTI---ARYVDS 818
Query: 696 AELTWKGSQYKYQNTLGLVKMLDLSSNKLGGEVPEEIMDLVGLIAMNLSRNNLTGQITPK 755
A + WKG +++Y+N LGLV+ +DLSSNKL GE+P+EI L+ LI++NLSRN+L GQI
Sbjct: 819 ALIPWKGGEFEYKNILGLVRSIDLSSNKLSGEIPKEITKLMELISLNLSRNHLNGQIPSM 878
Query: 756 ISQLKSLDFLDLSRNRFFGGIPSSLSQLSGLSVMDLSYNNLSGKIPSGTQLQSFNASTYA 815
I QLKSLD LDLS+N+ G IPSSLSQ+ LSV+DLS NNLSG+IPSGTQLQ F AS+Y
Sbjct: 879 IGQLKSLDVLDLSKNQLDGKIPSSLSQIDRLSVLDLSSNNLSGQIPSGTQLQGFEASSYM 938
Query: 816 GN-ELCGLPLPNKCPDEDLAPRPGKDDANTPEEEDQFITLGFYVSLILGFFVGFWGFCGT 874
GN ELCG PL KC +++ A D N + +D FYVS+ LGF VGFWG GT
Sbjct: 939 GNPELCGSPLKTKCQEDETAQTSPTSDGNEDDLQDDEFDPWFYVSIALGFLVGFWGVWGT 998
Query: 875 LLVKSSWRHRYYNFLTGIENWFY 897
L++KSSW Y+ FL I++WF+
Sbjct: 999 LVLKSSWSEAYFRFLNKIKDWFF 1021
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|359490572|ref|XP_003634116.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g36180-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359490576|ref|XP_003634117.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO1-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|147807651|emb|CAN64389.1| hypothetical protein VITISV_018647 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224105895|ref|XP_002333753.1| predicted protein [Populus trichocarpa] gi|222838401|gb|EEE76766.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|225462661|ref|XP_002266475.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO2-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359490560|ref|XP_002266431.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO2-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|225466147|ref|XP_002270042.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO1-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224125666|ref|XP_002329688.1| predicted protein [Populus trichocarpa] gi|222870596|gb|EEF07727.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224115848|ref|XP_002332072.1| predicted protein [Populus trichocarpa] gi|222831958|gb|EEE70435.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 913 | ||||||
| TAIR|locus:2173777 | 792 | RLP54 "receptor like protein 5 | 0.675 | 0.779 | 0.308 | 2e-79 | |
| TAIR|locus:2129246 | 891 | RLP50 "receptor like protein 5 | 0.868 | 0.890 | 0.310 | 3e-78 | |
| TAIR|locus:2825762 | 994 | RLP6 "AT1G45616" [Arabidopsis | 0.802 | 0.737 | 0.285 | 1.3e-76 | |
| TAIR|locus:2155909 | 908 | RLP56 "AT5G49290" [Arabidopsis | 0.825 | 0.830 | 0.295 | 6.5e-76 | |
| TAIR|locus:2046357 | 890 | RLP23 "receptor like protein 2 | 0.663 | 0.680 | 0.308 | 2e-75 | |
| TAIR|locus:2046600 | 800 | RLP26 "receptor like protein 2 | 0.661 | 0.755 | 0.319 | 4.1e-75 | |
| TAIR|locus:2120362 | 1249 | GSO1 "GASSHO1" [Arabidopsis th | 0.822 | 0.601 | 0.327 | 3.6e-73 | |
| TAIR|locus:2044767 | 905 | AT2G34930 "AT2G34930" [Arabido | 0.805 | 0.812 | 0.310 | 4.1e-72 | |
| TAIR|locus:2086974 | 881 | RLP41 "AT3G25010" [Arabidopsis | 0.831 | 0.861 | 0.308 | 8.6e-72 | |
| TAIR|locus:2087253 | 884 | RLP39 "AT3G24900" [Arabidopsis | 0.835 | 0.863 | 0.306 | 7.7e-71 |
| TAIR|locus:2173777 RLP54 "receptor like protein 54" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 658 (236.7 bits), Expect = 2.0e-79, Sum P(2) = 2.0e-79
Identities = 207/672 (30%), Positives = 326/672 (48%)
Query: 229 FPSADDPLHLNSSKSLEFLDLSENNLTSSVYPWLFNVSSNLVELGLSSNLLQGSIPDAFE 288
F S+ P LE LDLS+N V + N+S L L LS N L G IP+
Sbjct: 126 FDSSPIPSGFGRLTYLESLDLSKNGFIGEVPSSISNLS-RLTNLDLSYNKLTGGIPN-LH 183
Query: 289 HMVSLQTLFLYSNELEGGIPKFFGNMCCLNELVLCSNQLTGQLFEFIQNLSCGCAKNSLE 348
+ L+ + L N+ G IP + M L L L N L+ L +N++ A + L
Sbjct: 184 SLTLLENIDLSYNKFSGAIPSYLFTMPFLVSLNLRQNHLSDPL----ENINYS-ATSKLL 238
Query: 349 SLDLSANAVTGPIPE-XXXXXXXXXXXXXXNRLNGTINQSLGRMYKLEKLSLGGNSLT-- 405
LD++ N ++ I E + T N L +L L GNS++
Sbjct: 239 ILDMAYNLMSHRILEPISKLANLIQIDLSFQKTPYTFNFDFLLFKSLVRLDLSGNSVSVV 298
Query: 406 GVISE-----DFFS-NTSN----LKN--QIDWLDISNTGISDTIPDWFWDLSRKKLSFLN 453
G SE D S N + +K+ ++ WLDISN I +P+ W L + +N
Sbjct: 299 GTGSENLTHLDLSSCNITEFPMFIKDLQRLWWLDISNNRIKGKVPELLWTLP--SMLHVN 356
Query: 454 LSNNQ---IKGKLPDLSLR--FDTYDISSNHFEGPIPPLPSNASVLNLSKNKFSGSISFL 508
LS N ++G P + L D+SSN F+G P +P +++ S N F+G I +
Sbjct: 357 LSRNSFDSLEGT-PKIILNSSISELDLSSNAFKGSFPIIPPYVNIMAASNNYFTGGIPLI 415
Query: 509 -CSISGHKLMYLDLSNNLLSGRLPDCWLLFDRLGI--LDLANNNFSGKIPDSMGSLPNIQ 565
C ++L LDLSNN SG +P C L LG+ L L+NN+ +G++PD L
Sbjct: 416 FCK--RYRLSLLDLSNNNFSGTIPRC-LTNVSLGLEALKLSNNSLTGRLPDIEDRLV--- 469
Query: 566 ILSLHNNRLTGELPSTLQNCLLLKLMDLGRNALSGEIPTWIGESLPKLIVLSLMSNKFHG 625
+L + +N+++G+LP +L NC LK +++ N ++ P W+ ++L +L ++ L SN+FHG
Sbjct: 470 LLDVGHNQISGKLPRSLVNCTTLKFLNVEGNHINDTFPFWL-KALTRLEIIVLRSNRFHG 528
Query: 626 IIPFQLCHLPF--IQILDLSSNNIPGIIPKCFNNFTAMAQEKSSVLSVTSNYSFISDGGF 683
I L F ++I+D+S N+ G +P+ N F A + +++ Y + G
Sbjct: 529 PISSPEVSLSFTALRIIDISRNSFNGSLPQ--NYF---ANWSAPLVNTPQGYRWPEYTGD 583
Query: 684 PLVWYDNSYFG--QAELTWKGSQYKYQNTLGLVKMLDLSSNKLGGEVPEEIMDLVGLIAM 741
Y+ + L KG + +D S N G++PE I DL LI +
Sbjct: 584 EHSKYETPLWSYPSIHLRIKGRSIELGKIPDTYTSIDFSGNSFEGQIPESIGDLKSLIVL 643
Query: 742 NLSRNNLTGQITPKISQLKSLDFLDLSRNRFFGGIPSSLSQLSGLSVMDLSYNNLSGKIP 801
+LS N+ TG+I +++LK L+ LDLS+NR G IP L +L+ L +++S+N L+G+IP
Sbjct: 644 DLSNNSFTGRIPSSLAKLKQLESLDLSQNRISGNIPQELRELTFLGYVNMSHNRLTGQIP 703
Query: 802 SGTQLQSFNASTYAGN-ELCGLPLPNKCPDEDLAPR-PGKDDANTPEEEDQF----ITLG 855
TQ+ S++ GN LCGLPL C + P P + P++E +G
Sbjct: 704 QSTQVGGQPKSSFEGNINLCGLPLQESCLRGNGVPSTPHTQEQELPKQEHALNWKAAAIG 763
Query: 856 FYVSLILGFFVG 867
+ ++ G +G
Sbjct: 764 YGPGVLFGLAIG 775
|
|
| TAIR|locus:2129246 RLP50 "receptor like protein 50" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2825762 RLP6 "AT1G45616" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2155909 RLP56 "AT5G49290" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2046357 RLP23 "receptor like protein 23" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2046600 RLP26 "receptor like protein 26" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2120362 GSO1 "GASSHO1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2044767 AT2G34930 "AT2G34930" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2086974 RLP41 "AT3G25010" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2087253 RLP39 "AT3G24900" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 913 | |||
| PLN00113 | 968 | PLN00113, PLN00113, leucine-rich repeat receptor-l | 1e-69 | |
| PLN00113 | 968 | PLN00113, PLN00113, leucine-rich repeat receptor-l | 1e-68 | |
| PLN00113 | 968 | PLN00113, PLN00113, leucine-rich repeat receptor-l | 2e-54 | |
| PLN00113 | 968 | PLN00113, PLN00113, leucine-rich repeat receptor-l | 4e-52 | |
| PLN03150 | 623 | PLN03150, PLN03150, hypothetical protein; Provisio | 1e-16 | |
| PLN03150 | 623 | PLN03150, PLN03150, hypothetical protein; Provisio | 2e-12 | |
| PLN03150 | 623 | PLN03150, PLN03150, hypothetical protein; Provisio | 3e-10 | |
| PLN03150 | 623 | PLN03150, PLN03150, hypothetical protein; Provisio | 5e-10 | |
| PLN03150 | 623 | PLN03150, PLN03150, hypothetical protein; Provisio | 6e-09 | |
| PLN03150 | 623 | PLN03150, PLN03150, hypothetical protein; Provisio | 1e-08 | |
| PLN03150 | 623 | PLN03150, PLN03150, hypothetical protein; Provisio | 9e-08 | |
| pfam08263 | 42 | pfam08263, LRRNT_2, Leucine rich repeat N-terminal | 1e-07 | |
| cd00116 | 319 | cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo | 1e-07 | |
| PLN03150 | 623 | PLN03150, PLN03150, hypothetical protein; Provisio | 4e-07 | |
| COG4886 | 394 | COG4886, COG4886, Leucine-rich repeat (LRR) protei | 2e-06 | |
| COG4886 | 394 | COG4886, COG4886, Leucine-rich repeat (LRR) protei | 6e-06 | |
| PRK15370 | 754 | PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl | 6e-06 | |
| COG4886 | 394 | COG4886, COG4886, Leucine-rich repeat (LRR) protei | 9e-06 | |
| pfam13855 | 60 | pfam13855, LRR_8, Leucine rich repeat | 5e-05 | |
| PLN03150 | 623 | PLN03150, PLN03150, hypothetical protein; Provisio | 6e-05 | |
| pfam13855 | 60 | pfam13855, LRR_8, Leucine rich repeat | 6e-05 | |
| cd00116 | 319 | cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo | 8e-05 | |
| pfam13855 | 60 | pfam13855, LRR_8, Leucine rich repeat | 8e-05 | |
| PLN03150 | 623 | PLN03150, PLN03150, hypothetical protein; Provisio | 9e-05 | |
| pfam13855 | 60 | pfam13855, LRR_8, Leucine rich repeat | 2e-04 | |
| COG5238 | 388 | COG5238, RNA1, Ran GTPase-activating protein (RanG | 2e-04 | |
| COG4886 | 394 | COG4886, COG4886, Leucine-rich repeat (LRR) protei | 3e-04 | |
| pfam13855 | 60 | pfam13855, LRR_8, Leucine rich repeat | 4e-04 | |
| PLN03150 | 623 | PLN03150, PLN03150, hypothetical protein; Provisio | 5e-04 | |
| cd00116 | 319 | cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo | 5e-04 | |
| pfam13855 | 60 | pfam13855, LRR_8, Leucine rich repeat | 0.001 | |
| pfam13855 | 60 | pfam13855, LRR_8, Leucine rich repeat | 0.001 |
| >gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
Score = 249 bits (638), Expect = 1e-69
Identities = 205/592 (34%), Positives = 297/592 (50%), Gaps = 80/592 (13%)
Query: 40 EEREALLSFKQSLVDEHGFLSSWGSEDNKSDCCEWIGVYCRNKTH--------------- 84
EE E LLSFK S+ D +LS+W S +D C W G+ C N +
Sbjct: 29 EELELLLSFKSSINDPLKYLSNWNS---SADVCLWQGITCNNSSRVVSIDLSGKNISGKI 85
Query: 85 --------HVYALDLQDGSL--KLKGTI--LSPSLRKLQ----------------HLTYL 116
++ ++L + L + I S SLR L +L L
Sbjct: 86 SSAIFRLPYIQTINLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPRGSIPNLETL 145
Query: 117 DLSDNDFSGIPIADFIGSLSSKLRHLDLGWAGFAGSVPPQLGNLSNLQYLNLGYNDLLSV 176
DLS+N SG I + IGS SS L+ LDLG G +P L NL++L++L L N L V
Sbjct: 146 DLSNNMLSG-EIPNDIGSFSS-LKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQL--V 201
Query: 177 GNLLHWLYHLSSLRYLHLGHNNLSNSNDWPLVVYKLSSLTTLILEGCDLPPFFPSADDPL 236
G + L + SL++++LG+NNLS + P + L+SL L L +L PS+
Sbjct: 202 GQIPRELGQMKSLKWIYLGYNNLSG--EIPYEIGGLTSLNHLDLVYNNLTGPIPSS---- 255
Query: 237 HLNSSKSLEFLDLSENNLTSSVYPWLFNVSSNLVELGLSSNLLQGSIPDAFEHMVSLQTL 296
L + K+L++L L +N L+ + P +F++ L+ L LS N L G IP+ + +L+ L
Sbjct: 256 -LGNLKNLQYLFLYQNKLSGPIPPSIFSLQ-KLISLDLSDNSLSGEIPELVIQLQNLEIL 313
Query: 297 FLYSNELEGGIPKFFGNMCCLNELVLCSNQLTGQLFEFIQNLSCGCAKNSLESLDLSANA 356
L+SN G IP ++ L L L SN+ +G E +NL N+L LDLS N
Sbjct: 314 HLFSNNFTGKIPVALTSLPRLQVLQLWSNKFSG---EIPKNLG---KHNNLTVLDLSTNN 367
Query: 357 VTGPIPE-LGGLSSLKSLYLGGNRLNGTINQSLGRMYKLEKLSLGGNSLTGVISEDFFSN 415
+TG IPE L +L L L N L G I +SLG L ++ L NS +G + +F
Sbjct: 368 LTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFSGELPSEF--- 424
Query: 416 TSNLKNQ-IDWLDISNTGISDTIPDWFWDLSRKKLSFLNLSNNQIKGKLPDL--SLRFDT 472
K + +LDISN + I WD+ L L+L+ N+ G LPD S R +
Sbjct: 425 ---TKLPLVYFLDISNNNLQGRINSRKWDMP--SLQMLSLARNKFFGGLPDSFGSKRLEN 479
Query: 473 YDISSNHFEGPIPPLPSNASV---LNLSKNKFSGSISFLCSISGHKLMYLDLSNNLLSGR 529
D+S N F G +P + S L LS+NK SG I S S KL+ LDLS+N LSG+
Sbjct: 480 LDLSRNQFSGAVPRKLGSLSELMQLKLSENKLSGEIPDELS-SCKKLVSLDLSHNQLSGQ 538
Query: 530 LPDCWLLFDRLGILDLANNNFSGKIPDSMGSLPNIQILSLHNNRLTGELPST 581
+P + L LDL+ N SG+IP ++G++ ++ +++ +N L G LPST
Sbjct: 539 IPASFSEMPVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHLHGSLPST 590
|
Length = 968 |
| >gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219766 pfam08263, LRRNT_2, Leucine rich repeat N-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat | Back alignment and domain information |
|---|
| >gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat | Back alignment and domain information |
|---|
| >gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat | Back alignment and domain information |
|---|
| >gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat | Back alignment and domain information |
|---|
| >gnl|CDD|227563 COG5238, RNA1, Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat | Back alignment and domain information |
|---|
| >gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat | Back alignment and domain information |
|---|
| >gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 913 | |||
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 100.0 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 100.0 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 100.0 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 100.0 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 100.0 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 100.0 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 99.98 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 99.97 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 99.97 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 99.96 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 99.88 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 99.87 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 99.87 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 99.87 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 99.87 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 99.82 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 99.79 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 99.78 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 99.7 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 99.68 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 99.64 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 99.61 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 99.57 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 99.36 | |
| KOG0532 | 722 | consensus Leucine-rich repeat (LRR) protein, conta | 99.26 | |
| KOG0532 | 722 | consensus Leucine-rich repeat (LRR) protein, conta | 99.25 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 99.2 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 99.18 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 99.17 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 99.05 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 99.05 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 98.98 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 98.96 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 98.96 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 98.91 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 98.81 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 98.73 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 98.73 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 98.71 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 98.71 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 98.7 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 98.7 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 98.68 | |
| PF08263 | 43 | LRRNT_2: Leucine rich repeat N-terminal domain; In | 98.62 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 98.44 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 98.37 | |
| KOG4579 | 177 | consensus Leucine-rich repeat (LRR) protein associ | 98.34 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 98.18 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 98.12 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 98.11 | |
| KOG4579 | 177 | consensus Leucine-rich repeat (LRR) protein associ | 98.08 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 98.03 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 97.96 | |
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 97.83 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 97.8 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 97.78 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 97.77 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 97.63 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 97.59 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 97.51 | |
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 97.4 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 97.34 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 97.34 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 97.16 | |
| PF13306 | 129 | LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ | 96.81 | |
| PF13306 | 129 | LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ | 96.8 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 96.65 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 96.28 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 95.83 | |
| PF00560 | 22 | LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le | 95.56 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 95.4 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 95.39 | |
| KOG4308 | 478 | consensus LRR-containing protein [Function unknown | 95.28 | |
| PF00560 | 22 | LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le | 95.14 | |
| KOG4308 | 478 | consensus LRR-containing protein [Function unknown | 92.94 | |
| PF13504 | 17 | LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO | 90.69 | |
| KOG0473 | 326 | consensus Leucine-rich repeat protein [Function un | 89.77 | |
| KOG0473 | 326 | consensus Leucine-rich repeat protein [Function un | 87.52 | |
| smart00369 | 26 | LRR_TYP Leucine-rich repeats, typical (most popula | 86.85 | |
| smart00370 | 26 | LRR Leucine-rich repeats, outliers. | 86.85 | |
| smart00370 | 26 | LRR Leucine-rich repeats, outliers. | 83.55 | |
| smart00369 | 26 | LRR_TYP Leucine-rich repeats, typical (most popula | 83.55 | |
| PF13516 | 24 | LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI | 82.3 |
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
Probab=100.00 E-value=7.8e-70 Score=680.76 Aligned_cols=582 Identities=37% Similarity=0.540 Sum_probs=433.1
Q ss_pred CHHHHHHHHHhhhcCcCCCCCCCCCCCCCCCCCCCcccceeecCCCCcEEEEEcCCCCCCCcceecCccccCCCCCCEEe
Q 002514 38 IDEEREALLSFKQSLVDEHGFLSSWGSEDNKSDCCEWIGVYCRNKTHHVYALDLQDGSLKLKGTILSPSLRKLQHLTYLD 117 (913)
Q Consensus 38 ~~~~~~~ll~~k~~~~~~~~~~~~w~~~~~~~~~c~w~gv~c~~~~~~v~~L~L~~~~~~l~g~~~~~~l~~l~~L~~L~ 117 (913)
.++|++||++||+++.+|.+.+.+|. .+.+||.|.||+|+. .++|+.|||++ ..+.|.+ ++.+..+++|++|+
T Consensus 27 ~~~~~~~l~~~~~~~~~~~~~~~~w~---~~~~~c~w~gv~c~~-~~~v~~L~L~~--~~i~~~~-~~~~~~l~~L~~L~ 99 (968)
T PLN00113 27 HAEELELLLSFKSSINDPLKYLSNWN---SSADVCLWQGITCNN-SSRVVSIDLSG--KNISGKI-SSAIFRLPYIQTIN 99 (968)
T ss_pred CHHHHHHHHHHHHhCCCCcccCCCCC---CCCCCCcCcceecCC-CCcEEEEEecC--CCccccC-ChHHhCCCCCCEEE
Confidence 45899999999999988888889997 467899999999975 57999999998 4455666 78899999999999
Q ss_pred CCCCCCCCCCccchHH-hhhccCcEEECCCCCCCCCCCccCCCCCCCCEEECCCCcCcccCCChhhhccCCCCcEEEcCC
Q 002514 118 LSDNDFSGIPIADFIG-SLSSKLRHLDLGWAGFAGSVPPQLGNLSNLQYLNLGYNDLLSVGNLLHWLYHLSSLRYLHLGH 196 (913)
Q Consensus 118 Ls~n~i~~~~~~~~~~-~l~~~L~~L~Ls~n~~~~~~p~~l~~l~~L~~L~Ls~n~l~~l~~~~~~l~~l~~L~~L~Ls~ 196 (913)
|++|.+.+. +|..+. .+++ |++|+|++|.+.+.+|. +.+++|++|+|++|.+..
T Consensus 100 Ls~n~~~~~-ip~~~~~~l~~-L~~L~Ls~n~l~~~~p~--~~l~~L~~L~Ls~n~~~~--------------------- 154 (968)
T PLN00113 100 LSNNQLSGP-IPDDIFTTSSS-LRYLNLSNNNFTGSIPR--GSIPNLETLDLSNNMLSG--------------------- 154 (968)
T ss_pred CCCCccCCc-CChHHhccCCC-CCEEECcCCccccccCc--cccCCCCEEECcCCcccc---------------------
Confidence 999998864 666555 6777 99999999988887775 457777777777776641
Q ss_pred ccCCCCCChhHhhcCCCCCCEEEccCCCCCCCCCCCCccccccCCCcccEEECCCCCCCCCcchhHHhccCCCcEEEccC
Q 002514 197 NNLSNSNDWPLVVYKLSSLTTLILEGCDLPPFFPSADDPLHLNSSKSLEFLDLSENNLTSSVYPWLFNVSSNLVELGLSS 276 (913)
Q Consensus 197 n~l~~~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~l~~~~~~L~~L~L~~ 276 (913)
.++..++++++|++|++++|.+.+..|. .+.+ +++|++|++++|.+.+.+|..+..+.. |++|++++
T Consensus 155 -------~~p~~~~~l~~L~~L~L~~n~l~~~~p~----~~~~-l~~L~~L~L~~n~l~~~~p~~l~~l~~-L~~L~L~~ 221 (968)
T PLN00113 155 -------EIPNDIGSFSSLKVLDLGGNVLVGKIPN----SLTN-LTSLEFLTLASNQLVGQIPRELGQMKS-LKWIYLGY 221 (968)
T ss_pred -------cCChHHhcCCCCCEEECccCcccccCCh----hhhh-CcCCCeeeccCCCCcCcCChHHcCcCC-ccEEECcC
Confidence 1223333444444444444443333321 1122 255555555555555555554444433 55566665
Q ss_pred CccccccchhhcCCCCCcEEEccCCcCCCcccccccCCcccceeEccCCCCCCchhHhhhhccCCCCCCCccEEEccCCc
Q 002514 277 NLLQGSIPDAFEHMVSLQTLFLYSNELEGGIPKFFGNMCCLNELVLCSNQLTGQLFEFIQNLSCGCAKNSLESLDLSANA 356 (913)
Q Consensus 277 n~l~~~~~~~l~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~~~~l~~l~~~~~~~~L~~L~Ls~n~ 356 (913)
|.+.+.+|..++++++|++|++++|.+.+.+|..++++++|++|++++|.+.+..|..+..+. +|++|++++|.
T Consensus 222 n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~------~L~~L~Ls~n~ 295 (968)
T PLN00113 222 NNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIPPSIFSLQ------KLISLDLSDNS 295 (968)
T ss_pred CccCCcCChhHhcCCCCCEEECcCceeccccChhHhCCCCCCEEECcCCeeeccCchhHhhcc------CcCEEECcCCe
Confidence 555555555566666666666666666555565566666666666666665555555555554 55555555555
Q ss_pred CccCCCC-CCCCCCCCEEEccCCcCCccchhhhcCCCCCcEEEeeCCCCccccChhhhhccccccccccEEEcccccCCC
Q 002514 357 VTGPIPE-LGGLSSLKSLYLGGNRLNGTINQSLGRMYKLEKLSLGGNSLTGVISEDFFSNTSNLKNQIDWLDISNTGISD 435 (913)
Q Consensus 357 l~~~~~~-l~~l~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~~~~~l~~L~~~L~~L~Ls~n~i~~ 435 (913)
+.+.+|. +..+++|+.|++++|.+.+.+|..+..+++|+.|++++|.+.+.+|.
T Consensus 296 l~~~~p~~~~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~L~~n~l~~~~p~------------------------- 350 (968)
T PLN00113 296 LSGEIPELVIQLQNLEILHLFSNNFTGKIPVALTSLPRLQVLQLWSNKFSGEIPK------------------------- 350 (968)
T ss_pred eccCCChhHcCCCCCcEEECCCCccCCcCChhHhcCCCCCEEECcCCCCcCcCCh-------------------------
Confidence 5555554 55555555555555555555555555555555555555544433222
Q ss_pred CCChhhhhcccCCcceEEccCcccccCCCCcccccCeeeccCCccccCCCCCCCCCceeeccCCcCccccchhccccCCc
Q 002514 436 TIPDWFWDLSRKKLSFLNLSNNQIKGKLPDLSLRFDTYDISSNHFEGPIPPLPSNASVLNLSKNKFSGSISFLCSISGHK 515 (913)
Q Consensus 436 ~~~~~~~~~~~~~L~~L~L~~n~l~~~~p~~~~~l~~l~ls~n~l~g~~~~~~~~L~~L~ls~n~l~~~~~~~~~~~~~~ 515 (913)
.+..+ ++
T Consensus 351 ----~l~~~---------------------------------------------------------------------~~ 357 (968)
T PLN00113 351 ----NLGKH---------------------------------------------------------------------NN 357 (968)
T ss_pred ----HHhCC---------------------------------------------------------------------CC
Confidence 11111 45
Q ss_pred eeEEEcCCCcccccCCccccccCCCcEEeCCCCcCCccCCCCCCCCCCCCEEEcccCcccccCChhhhcCCCCCEEECcC
Q 002514 516 LMYLDLSNNLLSGRLPDCWLLFDRLGILDLANNNFSGKIPDSMGSLPNIQILSLHNNRLTGELPSTLQNCLLLKLMDLGR 595 (913)
Q Consensus 516 L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~Ls~ 595 (913)
|+.|++++|.+++.+|..+..+++|+.|++++|.+.+.+|..++.+++|+.|++++|++++.+|..+.+++.|+.|++++
T Consensus 358 L~~L~Ls~n~l~~~~p~~~~~~~~L~~L~l~~n~l~~~~p~~~~~~~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~Ls~ 437 (968)
T PLN00113 358 LTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFSGELPSEFTKLPLVYFLDISN 437 (968)
T ss_pred CcEEECCCCeeEeeCChhHhCcCCCCEEECcCCEecccCCHHHhCCCCCCEEECcCCEeeeECChhHhcCCCCCEEECcC
Confidence 66777777777777777777778888888888888888888888888888888888888888888888888888888888
Q ss_pred CccccccchhHhhcCCCcceEeccCCcccccCCcccCCCCCcCEEeCCCCCCCcccchhhhhhhhhhhcccccccccccc
Q 002514 596 NALSGEIPTWIGESLPKLIVLSLMSNKFHGIIPFQLCHLPFIQILDLSSNNIPGIIPKCFNNFTAMAQEKSSVLSVTSNY 675 (913)
Q Consensus 596 N~l~~~ip~~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~l~~~~~~~~~~~~~~ 675 (913)
|++++.+|..+. .+++|++|++++|++.+.+|..+ ..++|+.|++++|++++.+|..+.++++|
T Consensus 438 N~l~~~~~~~~~-~l~~L~~L~L~~n~~~~~~p~~~-~~~~L~~L~ls~n~l~~~~~~~~~~l~~L-------------- 501 (968)
T PLN00113 438 NNLQGRINSRKW-DMPSLQMLSLARNKFFGGLPDSF-GSKRLENLDLSRNQFSGAVPRKLGSLSEL-------------- 501 (968)
T ss_pred CcccCccChhhc-cCCCCcEEECcCceeeeecCccc-ccccceEEECcCCccCCccChhhhhhhcc--------------
Confidence 888888887776 58889999999999888888765 45889999999999999999888777666
Q ss_pred ccccCCCCCccccCCCccccceeeeecccccccccccceeEEEcccCcCcccchhhhhccccCcEEEccCccccccCCcc
Q 002514 676 SFISDGGFPLVWYDNSYFGQAELTWKGSQYKYQNTLGLVKMLDLSSNKLGGEVPEEIMDLVGLIAMNLSRNNLTGQITPK 755 (913)
Q Consensus 676 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~L~Ls~N~l~~~ip~~l~~l~~L~~L~Ls~N~l~~~ip~~ 755 (913)
+.|+|++|++++.+|..++++++|++|+|++|.++|.+|..
T Consensus 502 ---------------------------------------~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~ 542 (968)
T PLN00113 502 ---------------------------------------MQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPAS 542 (968)
T ss_pred ---------------------------------------CEEECcCCcceeeCChHHcCccCCCEEECCCCcccccCChh
Confidence 88999999999999999999999999999999999999999
Q ss_pred cccCCCCCEeeCcCCcccccCCccccCCCCCCeEECCCCcccccCCCCCCCCccccCCCCCC-CCCCCC
Q 002514 756 ISQLKSLDFLDLSRNRFFGGIPSSLSQLSGLSVMDLSYNNLSGKIPSGTQLQSFNASTYAGN-ELCGLP 823 (913)
Q Consensus 756 l~~l~~L~~LdLs~N~l~~~ip~~l~~l~~L~~L~ls~N~L~g~iP~~~~~~~~~~~~~~gn-~lcg~~ 823 (913)
|+.+++|+.|||++|+++|.+|..+..+++|++||+++|+++|.+|..+++.++...+|.|| .+||.+
T Consensus 543 ~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~l~ls~N~l~~~~p~~~~~~~~~~~~~~~n~~lc~~~ 611 (968)
T PLN00113 543 FSEMPVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHLHGSLPSTGAFLAINASAVAGNIDLCGGD 611 (968)
T ss_pred HhCcccCCEEECCCCcccccCChhHhcCcccCEEeccCCcceeeCCCcchhcccChhhhcCCccccCCc
Confidence 99999999999999999999999999999999999999999999999999999999999999 899865
|
|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A | Back alignment and domain information |
|---|
| >PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4308 consensus LRR-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >KOG4308 consensus LRR-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D | Back alignment and domain information |
|---|
| >KOG0473 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0473 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily | Back alignment and domain information |
|---|
| >smart00370 LRR Leucine-rich repeats, outliers | Back alignment and domain information |
|---|
| >smart00370 LRR Leucine-rich repeats, outliers | Back alignment and domain information |
|---|
| >smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily | Back alignment and domain information |
|---|
| >PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 913 | ||||
| 3riz_A | 772 | Crystal Structure Of The Plant Steroid Receptor Bri | 8e-52 | ||
| 3rgx_A | 768 | Structural Insight Into Brassinosteroid Perception | 8e-52 | ||
| 1ogq_A | 313 | The Crystal Structure Of Pgip (Polygalacturonase In | 2e-19 | ||
| 3j0a_A | 844 | Homology Model Of Human Toll-Like Receptor 5 Fitted | 2e-06 | ||
| 3cig_A | 697 | Crystal Structure Of Mouse Tlr3 Ectodomain Length = | 4e-05 | ||
| 3a79_B | 562 | Crystal Structure Of Tlr2-Tlr6-Pam2csk4 Complex Len | 2e-04 |
| >pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 | Back alignment and structure |
|
| >pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 | Back alignment and structure |
| >pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 | Back alignment and structure |
| >pdb|3J0A|A Chain A, Homology Model Of Human Toll-Like Receptor 5 Fitted Into An Electron Microscopy Single Particle Reconstruction Length = 844 | Back alignment and structure |
| >pdb|3CIG|A Chain A, Crystal Structure Of Mouse Tlr3 Ectodomain Length = 697 | Back alignment and structure |
| >pdb|3A79|B Chain B, Crystal Structure Of Tlr2-Tlr6-Pam2csk4 Complex Length = 562 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 913 | |||
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 0.0 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 1e-91 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 3e-75 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 5e-38 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 3e-73 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 8e-68 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 1e-65 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 3e-60 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 1e-41 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 5e-08 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 3e-72 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 4e-68 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 2e-67 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 1e-47 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 4e-12 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 4e-67 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 4e-61 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 6e-57 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 4e-67 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 5e-65 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 2e-61 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 3e-61 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 2e-44 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 2e-37 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 6e-65 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 1e-54 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 4e-49 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 5e-08 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 4e-61 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 2e-58 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 1e-52 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 2e-27 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 5e-08 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 1e-52 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 9e-46 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 5e-34 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 2e-32 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 1e-21 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 5e-15 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 9e-50 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 2e-40 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 2e-40 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 4e-40 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 8e-29 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 7e-28 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 6e-44 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 1e-41 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 8e-41 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 2e-39 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 5e-25 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 2e-20 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 2e-09 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 6e-42 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 7e-31 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 2e-29 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 3e-22 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 1e-17 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 1e-17 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 6e-39 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 6e-38 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 3e-36 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 9e-35 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 2e-32 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 4e-30 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 1e-28 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 1e-26 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 1e-38 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 3e-28 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 2e-27 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 4e-18 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 2e-36 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 6e-35 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 6e-35 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 1e-21 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 2e-18 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 2e-09 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 2e-32 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 2e-31 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 3e-31 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 8e-31 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 5e-30 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 8e-30 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 8e-29 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 4e-25 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 6e-24 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 4e-17 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 4e-09 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 3e-32 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 5e-32 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 8e-29 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 1e-28 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 9e-23 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 2e-20 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 3e-13 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 1e-12 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 3e-09 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 2e-30 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 3e-29 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 3e-29 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 9e-29 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 7e-28 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 8e-24 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 1e-23 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 4e-29 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 2e-23 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 3e-17 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 2e-16 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 6e-16 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 3e-09 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 1e-28 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 4e-27 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 9e-27 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 8e-25 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 8e-19 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 9e-18 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 2e-13 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 2e-28 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 2e-26 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 2e-24 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 8e-24 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 5e-20 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 3e-19 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 6e-15 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 1e-27 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 5e-24 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 8e-24 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 1e-22 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 4e-19 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 6e-19 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 1e-14 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 6e-08 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 6e-07 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 2e-27 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 3e-27 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 2e-22 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 1e-09 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 2e-05 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 3e-27 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 3e-22 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 3e-15 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 3e-14 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 9e-14 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 4e-09 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 1e-26 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 5e-26 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 2e-25 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 1e-24 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 8e-24 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 6e-19 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 3e-14 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 5e-26 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 9e-25 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 2e-24 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 2e-18 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 6e-18 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 8e-16 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 9e-14 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 2e-24 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 1e-22 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 2e-21 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 6e-19 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 2e-18 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 3e-16 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 1e-14 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 1e-13 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 4e-12 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 3e-24 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 2e-22 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 2e-13 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 9e-24 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 1e-18 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 3e-14 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 2e-13 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 5e-07 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 2e-05 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 5e-23 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 7e-23 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 2e-18 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 1e-17 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 2e-16 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 9e-15 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 4e-22 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 6e-22 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 2e-21 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 4e-17 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 3e-14 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 6e-12 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 9e-09 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 2e-21 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 3e-21 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 1e-19 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 2e-18 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 6e-13 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 5e-21 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 6e-19 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 2e-18 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 8e-18 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 2e-17 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 1e-14 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 4e-20 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 2e-17 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 5e-17 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 1e-14 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 4e-14 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 8e-14 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 7e-10 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 2e-07 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 2e-06 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 1e-04 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 5e-20 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 1e-19 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 6e-19 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 6e-17 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 2e-16 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 3e-13 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 1e-09 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 1e-19 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 7e-18 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 1e-17 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 2e-17 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 2e-17 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 2e-17 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 1e-16 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 2e-12 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 3e-12 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 4e-09 | |
| 3jqh_A | 167 | C-type lectin domain family 4 member M; DC-signr, | 2e-19 | |
| 3jqh_A | 167 | C-type lectin domain family 4 member M; DC-signr, | 2e-17 | |
| 3jqh_A | 167 | C-type lectin domain family 4 member M; DC-signr, | 4e-17 | |
| 3jqh_A | 167 | C-type lectin domain family 4 member M; DC-signr, | 1e-16 | |
| 3jqh_A | 167 | C-type lectin domain family 4 member M; DC-signr, | 2e-15 | |
| 3jqh_A | 167 | C-type lectin domain family 4 member M; DC-signr, | 8e-13 | |
| 3jqh_A | 167 | C-type lectin domain family 4 member M; DC-signr, | 9e-11 | |
| 3jqh_A | 167 | C-type lectin domain family 4 member M; DC-signr, | 2e-08 | |
| 3jqh_A | 167 | C-type lectin domain family 4 member M; DC-signr, | 6e-08 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 1e-18 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 2e-17 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 5e-17 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 6e-07 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 5e-18 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 8e-18 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 9e-16 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 2e-09 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 8e-09 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 2e-08 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 1e-06 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 4e-04 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 2e-16 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 1e-12 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 1e-11 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 1e-04 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 5e-04 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 3e-16 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 1e-15 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 6e-15 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 9e-15 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 2e-12 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 4e-11 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 7e-07 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 8e-16 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 1e-15 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 8e-15 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 2e-12 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 7e-12 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 3e-11 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 1e-08 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 3e-07 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 3e-07 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 1e-04 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 8e-15 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 1e-14 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 2e-14 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 3e-12 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 1e-09 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 3e-06 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 8e-06 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 9e-05 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 2e-14 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 4e-11 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 8e-11 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 5e-08 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 6e-08 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 8e-08 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 4e-07 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 6e-06 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 2e-04 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 2e-04 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 8e-04 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 2e-14 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 8e-04 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 3e-14 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 1e-12 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 1e-11 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 2e-09 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 2e-09 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 1e-08 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 3e-04 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 1e-13 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 2e-13 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 8e-12 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 1e-11 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 3e-10 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 8e-08 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 2e-06 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 2e-13 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 4e-12 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 3e-10 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 5e-09 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 1e-05 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 4e-13 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 1e-09 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 3e-07 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 4e-06 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 6e-06 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 1e-11 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 4e-11 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 6e-09 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 6e-07 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 5e-11 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 1e-10 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 2e-06 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 6e-11 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 3e-09 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 1e-08 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 7e-08 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 8e-07 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 2e-06 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 3e-05 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 8e-11 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 1e-07 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 1e-07 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 2e-06 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 1e-04 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 3e-10 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 6e-06 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 1e-09 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 3e-09 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 1e-05 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 1e-04 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-09 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-06 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-05 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 4e-05 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 5e-04 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 4e-09 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 4e-09 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 5e-09 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 5e-06 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 6e-04 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 8e-09 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 7e-06 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 4e-05 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 4e-08 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 3e-07 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 2e-06 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 7e-08 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 2e-06 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 2e-06 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 2e-05 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 4e-05 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 4e-05 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 5e-05 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 3e-07 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 1e-06 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 1e-04 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 3e-04 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 6e-04 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 3e-07 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 5e-07 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 1e-06 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 4e-06 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 9e-06 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 1e-05 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 1e-05 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 2e-05 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 5e-05 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 1e-04 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 2e-04 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 4e-07 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 7e-07 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 4e-04 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 7e-07 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 2e-06 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 7e-04 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 1e-06 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 4e-06 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 4e-06 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 4e-06 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 5e-06 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 1e-05 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 2e-05 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 3e-05 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 3e-05 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 4e-05 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 2e-06 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 3e-06 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 7e-06 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 1e-05 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 5e-05 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 7e-05 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 1e-04 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 1e-04 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 4e-04 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 8e-04 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 3e-06 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 4e-06 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 2e-05 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 8e-05 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 2e-04 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 7e-04 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 9e-06 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 1e-05 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 1e-05 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 4e-05 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 5e-05 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 5e-05 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 1e-04 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 3e-04 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 1e-05 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 2e-05 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 3e-04 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 6e-04 |
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
Score = 588 bits (1517), Expect = 0.0
Identities = 228/826 (27%), Positives = 351/826 (42%), Gaps = 89/826 (10%)
Query: 33 TTIRCIDEEREALLSFKQSLVDEHGFLSSWGSEDNKSDCCEWIGVYCRNKTHHVYALDLQ 92
+ + + E L+SFK L D L W + + C + GV CR+ V ++DL
Sbjct: 5 SPSQSLYREIHQLISFKDVLPD-KNLLPDW---SSNKNPCTFDGVTCRD--DKVTSIDLS 58
Query: 93 DGSLKLKGTILSPSLRKLQHLTYLDLSDNDFSG-IPIADFIGSLSSKLRHLDLGWAGFAG 151
L + + +S SL L L L LS++ +G + +S L LDL +G
Sbjct: 59 SKPLNVGFSAVSSSLLSLTGLESLFLSNSHINGSVS---GFKCSAS-LTSLDLSRNSLSG 114
Query: 152 SVPP--QLGNLSNLQYLNLGYNDLLSVGNLLHWLYHLSSLRYLHLGHNNLSNSNDWPLVV 209
V LG+ S L++LN+ N L G + L+SL L L N++S +N V+
Sbjct: 115 PVTTLTSLGSCSGLKFLNVSSNTLDFPGKV-SGGLKLNSLEVLDLSANSISGANVVGWVL 173
Query: 210 Y-KLSSLTTLILEGCDLPPFFPSADDPLHLNSSKSLEFLDLSENNLTSSVYPWLFNVSSN 268
L L + G + ++ +LEFLD+S NN ++ + P+L + S
Sbjct: 174 SDGCGELKHLAISGNKISGDVD-------VSRCVNLEFLDVSSNNFSTGI-PFLGD-CSA 224
Query: 269 LVELGLSSNLLQGSIPDAFEHMVSLQTLFLYSNELEGGIPKFFGNMCCLNELVLCSNQLT 328
L L +S N L G A L+ L + SN+ G IP + L L L N+ T
Sbjct: 225 LQHLDISGNKLSGDFSRAISTCTELKLLNISSNQFVGPIPPL--PLKSLQYLSLAENKFT 282
Query: 329 GQL-FEFIQNLSCGCAKNSLESLDLSANAVTGPIP-ELGGLSSLKSLYLGGNRLNGTI-N 385
G++ +L LDLS N G +P G S L+SL L N +G +
Sbjct: 283 GEIPDFLSGACD------TLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGELPM 336
Query: 386 QSLGRMYKLEKLSLGGNSLTGVISEDFFSNTSNLKNQIDWLDISNTGISDTIPDWFWDLS 445
+L +M L+ L L N +G + E + +++L LD+S+ S I
Sbjct: 337 DTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLL----TLDLSSNNFSGPILPNLCQNP 392
Query: 446 RKKLSFLNLSNNQIKGKLPDL-----SLRFDTYDISSNHFEGPIPPLPSNAS---VLNLS 497
+ L L L NN GK+P L +S N+ G IP + S L L
Sbjct: 393 KNTLQELYLQNNGFTGKIPPTLSNCSELVS--LHLSFNYLSGTIPSSLGSLSKLRDLKLW 450
Query: 498 KNKFSGSI-SFLCSISGHKLMYLDLSNNLLSGRLPDCWLLFDRLGILDLANNNFSGKIPD 556
N G I L + L L L N L+G +P L + L+NN +G+IP
Sbjct: 451 LNMLEGEIPQELMYVK--TLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPK 508
Query: 557 SMGSLPNIQILSLHNNRLTGELPSTLQNCLLLKLMDLGRNALSGEIPTWIGESLPKLIVL 616
+G L N+ IL L NN +G +P+ L +C L +DL N +G IP + +
Sbjct: 509 WIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQS-----G 563
Query: 617 SLMSNKFHGIIPFQLCHLPFIQILDLSSN--NIPGIIPKCFNNFTAMAQEKSSVLSVTSN 674
+ +N G + + + + N GI + N + + ++TS
Sbjct: 564 KIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTR-----NPCNITSR 618
Query: 675 YSFISDGGFPLVWYDNSYFGQAELTWKGSQYKYQNTLGLVKMLDLSSNKLGGEVPEEIMD 734
+ G + G + LD+S N L G +P+EI
Sbjct: 619 V------------------------YGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGS 654
Query: 735 LVGLIAMNLSRNNLTGQITPKISQLKSLDFLDLSRNRFFGGIPSSLSQLSGLSVMDLSYN 794
+ L +NL N+++G I ++ L+ L+ LDLS N+ G IP ++S L+ L+ +DLS N
Sbjct: 655 MPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNN 714
Query: 795 NLSGKIPSGTQLQSFNASTYAGN-ELCGLPLPNKCPDEDLAPRPGK 839
NLSG IP Q ++F + + N LCG PLP P +
Sbjct: 715 NLSGPIPEMGQFETFPPAKFLNNPGLCGYPLPRCDPSNADGYAHHQ 760
|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
No hit with probability above 80.00
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 913 | ||||
| d1ogqa_ | 313 | c.10.2.8 (A:) Polygalacturonase inhibiting protein | 5e-19 | |
| d1ogqa_ | 313 | c.10.2.8 (A:) Polygalacturonase inhibiting protein | 9e-19 | |
| d1ogqa_ | 313 | c.10.2.8 (A:) Polygalacturonase inhibiting protein | 5e-08 | |
| d1ogqa_ | 313 | c.10.2.8 (A:) Polygalacturonase inhibiting protein | 5e-04 | |
| d1xkua_ | 305 | c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 | 3e-18 | |
| d1xkua_ | 305 | c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 | 5e-14 | |
| d1xkua_ | 305 | c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 | 2e-12 | |
| d1xkua_ | 305 | c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 | 3e-12 | |
| d1xkua_ | 305 | c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 | 6e-12 | |
| d1xkua_ | 305 | c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 | 8e-10 | |
| d2omza2 | 384 | c.10.2.1 (A:33-416) Internalin A {Listeria monocyt | 1e-15 | |
| d2omza2 | 384 | c.10.2.1 (A:33-416) Internalin A {Listeria monocyt | 1e-15 | |
| d2omza2 | 384 | c.10.2.1 (A:33-416) Internalin A {Listeria monocyt | 6e-15 | |
| d2omza2 | 384 | c.10.2.1 (A:33-416) Internalin A {Listeria monocyt | 5e-14 | |
| d2omza2 | 384 | c.10.2.1 (A:33-416) Internalin A {Listeria monocyt | 2e-10 | |
| d1ozna_ | 284 | c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept | 9e-12 | |
| d1ozna_ | 284 | c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept | 3e-11 | |
| d1ozna_ | 284 | c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept | 4e-11 | |
| d1ozna_ | 284 | c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept | 9e-11 | |
| d1ozna_ | 284 | c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept | 1e-09 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 2e-10 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 6e-09 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 1e-04 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 2e-04 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 3e-04 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 8e-04 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 0.002 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 0.003 | |
| d2astb2 | 284 | c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 | 4e-08 | |
| d2astb2 | 284 | c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 | 1e-07 | |
| d2astb2 | 284 | c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 | 4e-06 | |
| d2astb2 | 284 | c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 | 1e-05 | |
| d2astb2 | 284 | c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 | 2e-05 | |
| d2astb2 | 284 | c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 | 7e-05 | |
| d2astb2 | 284 | c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 | 2e-04 | |
| d1w8aa_ | 192 | c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga | 1e-07 | |
| d1p9ag_ | 266 | c.10.2.7 (G:) von Willebrand factor binding domain | 1e-06 | |
| d1p9ag_ | 266 | c.10.2.7 (G:) von Willebrand factor binding domain | 8e-06 | |
| d1p9ag_ | 266 | c.10.2.7 (G:) von Willebrand factor binding domain | 1e-05 | |
| d1p9ag_ | 266 | c.10.2.7 (G:) von Willebrand factor binding domain | 3e-05 | |
| d1p9ag_ | 266 | c.10.2.7 (G:) von Willebrand factor binding domain | 1e-04 | |
| d1p9ag_ | 266 | c.10.2.7 (G:) von Willebrand factor binding domain | 4e-04 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 2e-06 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 5e-06 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 1e-05 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 3e-05 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 1e-04 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 1e-04 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 3e-04 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 0.001 | |
| d1dcea3 | 124 | c.10.2.2 (A:444-567) Rab geranylgeranyltransferase | 3e-06 | |
| d1dcea3 | 124 | c.10.2.2 (A:444-567) Rab geranylgeranyltransferase | 7e-06 | |
| d1dcea3 | 124 | c.10.2.2 (A:444-567) Rab geranylgeranyltransferase | 1e-05 | |
| d1dcea3 | 124 | c.10.2.2 (A:444-567) Rab geranylgeranyltransferase | 3e-05 | |
| d1dcea3 | 124 | c.10.2.2 (A:444-567) Rab geranylgeranyltransferase | 5e-05 | |
| d1dcea3 | 124 | c.10.2.2 (A:444-567) Rab geranylgeranyltransferase | 1e-04 | |
| d1dcea3 | 124 | c.10.2.2 (A:444-567) Rab geranylgeranyltransferase | 0.001 | |
| d1dcea3 | 124 | c.10.2.2 (A:444-567) Rab geranylgeranyltransferase | 0.002 | |
| d1dcea3 | 124 | c.10.2.2 (A:444-567) Rab geranylgeranyltransferase | 0.002 | |
| d2ca6a1 | 344 | c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom | 5e-06 | |
| d2ca6a1 | 344 | c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom | 4e-05 | |
| d2ca6a1 | 344 | c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom | 9e-05 | |
| d2ca6a1 | 344 | c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom | 0.002 | |
| d2ca6a1 | 344 | c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom | 0.003 | |
| d1koha1 | 162 | c.10.2.3 (A:201-362) mRNA export factor tap {Human | 6e-05 | |
| d1koha1 | 162 | c.10.2.3 (A:201-362) mRNA export factor tap {Human | 3e-04 | |
| d1xwdc1 | 242 | c.10.2.7 (C:18-259) Follicle-stimulating hormone r | 9e-05 | |
| d1xwdc1 | 242 | c.10.2.7 (C:18-259) Follicle-stimulating hormone r | 2e-04 | |
| d1xwdc1 | 242 | c.10.2.7 (C:18-259) Follicle-stimulating hormone r | 0.001 | |
| d1h6ta2 | 210 | c.10.2.1 (A:31-240) Internalin B {Listeria monocyt | 1e-04 | |
| d1h6ta2 | 210 | c.10.2.1 (A:31-240) Internalin B {Listeria monocyt | 2e-04 | |
| d1h6ta2 | 210 | c.10.2.1 (A:31-240) Internalin B {Listeria monocyt | 6e-04 | |
| d1a9na_ | 162 | c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom | 1e-04 | |
| d1a9na_ | 162 | c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom | 0.001 | |
| d1a9na_ | 162 | c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom | 0.001 | |
| d1h6ua2 | 227 | c.10.2.1 (A:36-262) Internalin H {Listeria monocyt | 2e-04 | |
| d1h6ua2 | 227 | c.10.2.1 (A:36-262) Internalin H {Listeria monocyt | 0.001 |
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) superfamily: L domain-like family: Polygalacturonase inhibiting protein PGIP domain: Polygalacturonase inhibiting protein PGIP species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Score = 86.7 bits (213), Expect = 5e-19
Identities = 70/347 (20%), Positives = 118/347 (34%), Gaps = 49/347 (14%)
Query: 37 CIDEEREALLSFKQSLVDEHGFLSSWGSEDNKSDCCE--WIGVYCRNKTHHVYALDLQDG 94
C ++++ALL K+ L + LSSW +DCC W+GV C T
Sbjct: 3 CNPQDKQALLQIKKDLGN-PTTLSSW---LPTTDCCNRTWLGVLCDTDTQTY-------- 50
Query: 95 SLKLKGTILSPSLRKLQHLTYLDLSDNDFSG-IPIADFIGSLSSKLRHLDLGWAGFAGSV 153
+ LDLS + PI + +L G G +
Sbjct: 51 -----------------RVNNLDLSGLNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPI 93
Query: 154 PPQLGNLSNLQYLNLGYNDLLSVGNLLHWLYHLSSLRYLHLGHNNLSNSNDWPLVVYKLS 213
PP + L+ L YL + + ++ +L + +L L +N S P + L
Sbjct: 94 PPAIAKLTQLHYLYITHTNVSGAIP--DFLSQIKTLVTLDFSYNA--LSGTLPPSISSLP 149
Query: 214 SLTTLILEGCDLPPFFPSADDPLHLNSSKSLEFLDLSENNLTSSVYPWLFNVSSNLVELG 273
+L + +G + P + + + SK + +S N LT ++ +
Sbjct: 150 NLVGITFDGNRISGAIPDS----YGSFSKLFTSMTISRNRLT---GKIPPTFANLNLAFV 202
Query: 274 LSSNLLQGSIPDAFEHMVSLQTLFLYSNELEGGIPKFFGNMCCLNELVLCSNQLTGQLFE 333
S + + G LN L L +N++ G L +
Sbjct: 203 DLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFDLGKVGLSKNLNGLDLRNNRIYGTLPQ 262
Query: 334 FIQNLSCGCAKNSLESLDLSANAVTGPIPELGGLSSLKSLYLGGNRL 380
+ L L SL++S N + G IP+ G L N+
Sbjct: 263 GLTQLK------FLHSLNVSFNNLCGEIPQGGNLQRFDVSAYANNKC 303
|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 913 | |||
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 100.0 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 100.0 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 100.0 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 100.0 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 100.0 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 100.0 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 100.0 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 100.0 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 100.0 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 99.98 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 99.98 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 99.96 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 99.95 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 99.94 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 99.94 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 99.94 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 99.93 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 99.92 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.92 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.91 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.9 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.9 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 99.9 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 99.9 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 99.89 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 99.79 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 99.75 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 99.74 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 99.71 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 99.67 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 99.65 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 99.11 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 98.67 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 98.2 |
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) superfamily: L domain-like family: Polygalacturonase inhibiting protein PGIP domain: Polygalacturonase inhibiting protein PGIP species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=100.00 E-value=0 Score=279.03 Aligned_cols=296 Identities=30% Similarity=0.437 Sum_probs=161.7
Q ss_pred CCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCC--CCCEEECCCC--CCEEEEECCCCCCCCCCEECCCCCCCCC
Q ss_conf 89889899999954219689999889999999999875--5632432999--9689999499998985100585522899
Q 002514 36 RCIDEEREALLSFKQSLVDEHGFLSSWGSEDNKSDCCE--WIGVYCRNKT--HHVYALDLQDGSLKLKGTILSPSLRKLQ 111 (913)
Q Consensus 36 ~~~~~~~~~ll~~k~~~~~~~~~~~~W~~~~~~~~~c~--w~~v~c~~~~--~~v~~L~L~~~~~~~~g~~~~~~l~~l~ 111 (913)
-|.++|++||++||+++.+|. .+++|. .++|||. |.||+|+... +||+.|+|+++...-...+ |+.+++++
T Consensus 2 ~c~~~e~~aLl~~k~~~~~~~-~l~sW~---~~~d~C~~~w~gv~C~~~~~~~~v~~L~L~~~~l~g~~~l-p~~l~~L~ 76 (313)
T d1ogqa_ 2 LCNPQDKQALLQIKKDLGNPT-TLSSWL---PTTDCCNRTWLGVLCDTDTQTYRVNNLDLSGLNLPKPYPI-PSSLANLP 76 (313)
T ss_dssp CSCHHHHHHHHHHHHHTTCCG-GGTTCC---TTSCTTTTCSTTEEECCSSSCCCEEEEEEECCCCSSCEEC-CGGGGGCT
T ss_pred CCCHHHHHHHHHHHHHCCCCC-CCCCCC---CCCCCCCCCCCCEEEECCCCCEEEEEEECCCCCCCCCCCC-CHHHHCCC
T ss_conf 989899999999999779998-677889---9999988948896974899947988998989988888879-84784675
Q ss_pred CCCEEECCC-CCCCCCCCCCHHHHHHCCCCEEECCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCCCCCHHHHCCCCCCC
Q ss_conf 889883999-9999997310587632149689888989998899568899999899889976835678724330699986
Q 002514 112 HLTYLDLSD-NDFSGIPIADFIGSLSSKLRHLDLGWAGFAGSVPPQLGNLSNLQYLNLGYNDLLSVGNLLHWLYHLSSLR 190 (913)
Q Consensus 112 ~L~~L~Ls~-n~i~~~~~~~~~~~l~~~L~~L~Ls~n~~~~~~p~~l~~l~~L~~L~Ls~n~~~~l~~~~~~l~~l~~L~ 190 (913)
+|++|+|++ |.+.+. +|..++++++ |++|++++|.+.+..+..+..+.+|+++++++|.+.
T Consensus 77 ~L~~L~Ls~~N~l~g~-iP~~i~~L~~-L~~L~Ls~N~l~~~~~~~~~~~~~L~~l~l~~N~~~---------------- 138 (313)
T d1ogqa_ 77 YLNFLYIGGINNLVGP-IPPAIAKLTQ-LHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALS---------------- 138 (313)
T ss_dssp TCSEEEEEEETTEESC-CCGGGGGCTT-CSEEEEEEECCEEECCGGGGGCTTCCEEECCSSEEE----------------
T ss_pred CCCCCCCCCCCCCCCC-CCCCCCCCCC-CCHHHHCCCCCCCCCCCCCCCHHHHCCCCCCCCCCC----------------
T ss_conf 3352020265433300-2431145420-011020356434433222220111001111224555----------------
Q ss_pred EEECCCCCCCCCCCHHHHHCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCCCCHHHHHCCCCCC
Q ss_conf 99857846999997247621899888998569999999999984111258776149987899899996025773169975
Q 002514 191 YLHLGHNNLSNSNDWPLVVYKLSSLTTLILEGCDLPPFFPSADDPLHLNSSKSLEFLDLSENNLTSSVYPWLFNVSSNLV 270 (913)
Q Consensus 191 ~L~Ls~n~l~~~~~~~~~l~~l~~L~~L~ls~n~~~~~~~~~~~~~~~~~~~~L~~L~Ls~n~l~~~~~~~l~~~~~~L~ 270 (913)
. .++..+.+++.++.+++++|.+.+..| ..+......++.++++.|.+++..+..+... . ..
T Consensus 139 ----------~--~~p~~l~~l~~L~~l~l~~n~l~~~ip----~~~~~l~~l~~~l~~~~n~l~~~~~~~~~~l-~-~~ 200 (313)
T d1ogqa_ 139 ----------G--TLPPSISSLPNLVGITFDGNRISGAIP----DSYGSFSKLFTSMTISRNRLTGKIPPTFANL-N-LA 200 (313)
T ss_dssp ----------S--CCCGGGGGCTTCCEEECCSSCCEEECC----GGGGCCCTTCCEEECCSSEEEEECCGGGGGC-C-CS
T ss_pred ----------C--CCCHHHCCCCCCCEEECCCCCCCCCCC----CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-C-CC
T ss_conf ----------5--685122067400000023553356203----1214431123231022464353324332222-2-22
Q ss_pred EEECCCCCCCCCCCHHHCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCCHHHHHHHCCCCCCCCCCCEE
Q ss_conf 99843873654453101089988599844774777655012387666566743788987315765202678789984699
Q 002514 271 ELGLSSNLLQGSIPDAFEHMVSLQTLFLYSNELEGGIPKFFGNMCCLNELVLCSNQLTGQLFEFIQNLSCGCAKNSLESL 350 (913)
Q Consensus 271 ~L~L~~n~l~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~l~~l~~~~~~~~L~~L 350 (913)
.+++..+...+.++..+..++.++.++++++.+.+.++ .+..+++|+.|++++|++++.+|..+..++ +|++|
T Consensus 201 ~l~l~~~~~~~~~~~~~~~~~~l~~l~~~~~~l~~~~~-~~~~~~~L~~L~Ls~N~l~g~iP~~l~~L~------~L~~L 273 (313)
T d1ogqa_ 201 FVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFDLG-KVGLSKNLNGLDLRNNRIYGTLPQGLTQLK------FLHSL 273 (313)
T ss_dssp EEECCSSEEEECCGGGCCTTSCCSEEECCSSEECCBGG-GCCCCTTCCEEECCSSCCEECCCGGGGGCT------TCCEE
T ss_pred CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCEECCCCCHHHHCCC------CCCEE
T ss_conf 33333343322222222222221112222222222222-222455444444765706660876884799------99989
Q ss_pred ECCCCCCCCCCCCCCCCCCCCEEECCCCC
Q ss_conf 82288585579998999988799843876
Q 002514 351 DLSANAVTGPIPELGGLSSLKSLYLGGNR 379 (913)
Q Consensus 351 ~Ls~n~l~~~~~~l~~l~~L~~L~L~~n~ 379 (913)
++++|++++.+|.+..+.+|+.+++.+|+
T Consensus 274 ~Ls~N~l~g~iP~~~~L~~L~~l~l~~N~ 302 (313)
T d1ogqa_ 274 NVSFNNLCGEIPQGGNLQRFDVSAYANNK 302 (313)
T ss_dssp ECCSSEEEEECCCSTTGGGSCGGGTCSSS
T ss_pred ECCCCCCCCCCCCCCCCCCCCHHHHCCCC
T ss_conf 79588351668986667998978868895
|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|