Citrus Sinensis ID: 002574


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900------
MAACTGFSSDHFKSICTFLILFSLSSYLGSTIKHCLADANVEVLCLDAEREGLLAFKESLTDPSGRLSSWVGQDCCKWNGVYCNNQSGHVTQLNLRNPYQLINGGVGDSTAYKGSCLGGKINPSLLHLKYLDTLDLSLNDFEGAEIPEYFGQLKNLRYLNLSFSSFSGEIPPQLGSLSSLQYLDLYADSFSSNSGSLALHAQNLNWLSGLSSLKLLNLGFVKLDHVGADWLQAVNMLPSLVELRLHYCQLQGIPLSLPFINFTSISVLDLSENSFNSAIPPWLFSLTSLTKLYLRWNFFTGHIPNEFANLKLLEVLDLSNNLDLGGQLPKLFGILRRLKSLDLSANNLNGEVHEFFDGFSGRPNNLEYLDLSSNSLEGELPKSLGNLKNLQYLRLSGNSFWGSIPSSIGNLSSLRKLDLSYNGMNGTIPESFGKLSELVDANLLQNSWEGILQESQFMNLKRLESFRLTTEPTKKFVFNVSYNWVPPFRLKSIQIENCQVGPSFPVWLQVQTELTSVILRNVGISDTIPGDWFSKLSSEITYLILSNNQIKGKLPRQMNSPNLRSIDLSSNHFEGTLPLWSTNADELFLQDNRFSGPLPENIGSLMPRLQRLYLSWNQLSGRIPSSVCNLEDLQILSIRSNKLSGEFPNCWYHSQMFWGIDISNNSLTGSIPSSFGSLRSLSVLLLSNNNLSGGIPCSLQNCTGLTSIDLGGNQLSGSLPLWISENLSSFFMLRLRSNLLSGDIPQRLCNLQNLHIIDLSHNNFSGAIPRCIGNLSALVYGNNSEVFQQLIWRVVKGRNPEYSNIIADVNSIDLSWNNLTGQIPDEIGNLSALHILNLSHNQLSGAIPQSLSSLASLSKLNLSFNNLAGKIPSLPNFNDPSIYEGNPLLCGAPLPTKCPGKHSPLH
ccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHccccccccccccccccccccccEEEccccccEEEEEccccccccccccccccccccccccEEccccccccccccEEEccccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccccccccHHHHccccHHHcccccccEEEccccccccccccHHHHHcccccccEEEccccccccccccccccccccccEEEcccccccccccHHHHccccccEEEcccccccccccHHccccccccEEEccccccccccccccccccccccEEEcccccccccccHHHHHcccccccccEEEcccccccccccccccccccccEEEccccEEEEEccccccccccccEEEcccccccccccccccccccccEEEccccccEEEEcHHHHcccccccEEEccccccccEEEEccccccccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHHHHHcccccEEEccccccccccccccccccccEEEccccccccccccccccccEEEcccccccccccHHHHHccccccEEEccccccEEEccccccccccccEEEcccccccccccccHHccccccEEEccccccEEEccccccccccccEEEccccEEEEcccHHHHccccccEEEcccccccccccHHHHHccccccEEEccccccEEEccccccccccccEEEcccccccccccHHHHHcccccccccccEEEEEEEEEEEEcccccccccccccEEEcccccccccccHHHHccccccccccccccccccccccccccccccEEEccccccEEccccccccccccccccccccccccccccccccccccc
ccHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHcccccccccccccccccccEEEEEEcccccEEEEEEccccccccccccccEEEcccccccccccHHHHccccccEEEccccccccccccHHHcccccccEEEcccccccccccccHccccccEEEEcccccccccccHHHcccccHHHHccccccHHEEccccccccccccccHHHccccccEEEEcccccccccccccccccccccEEEEcccccccccccHHHHccccccEEEcccccccEEccccccccccccEEEccccccccccccccccccccccEEEcccccccccccHHHHHHccccccccEEEccccccEEcccHHHHHcccccEEEccccEEEEEccHHHHccccccEEEcccccccccccHHHHccccccEEEcccccccccccHHHHHHHccccEEEEccccccccEcccccccccccccEEEEcccccccccccHHHHccccccEEEcccccccccccHHHHHHHcccccEEEcccccccccccccccccccEEEEEccccccccccccccccEEEEcccccccccccHHHHccccccEEEEcccccccccccHHHccccccEEEEcccccccccccHHHccccccEEEEcccccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHHccccEEEEcccccccccccHHHccccccEEEEcccccccccccHHHHcHHHHHHHHHcccEEEcccccccccccHHHHHHHHHcEEEcccccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEcccccccccccHHHHccccccccccccccccccccccc
maactgfssdhfKSICTFLILFSLSSYLGSTIKHCLADANVEVLCLDAEREGLLAFKesltdpsgrlsswvgqdcckwngvycnnqsghvtqlnlrnpyqlinggvgdstaykgsclggkinpsllhlkyldtldlslndfegaeipeYFGQLKNLRYLnlsfssfsgeippqlgslsslqyLDLYAdsfssnsgslalHAQNLNWLSGLSSLKLLNLGFVKLDHVGADWLQAVNMLPSLVELRLHYCqlqgiplslpfinftsisvldlsensfnsaippwlfSLTSLTKLYLRwnfftghipnefANLKLLEVLdlsnnldlggqlpKLFGILRRLKSldlsannlngevheffdgfsgrpnnleyldlssnslegelpkslgnlknlqylrlsgnsfwgsipssignlsslrkldlsyngmngtipesfGKLSELVDANLLQNSWEGILQESQFMNLKRLesfrltteptkkFVFNvsynwvppfrlksiqiencqvgpsfpVWLQVQTELTSVILRNvgisdtipgdwfskLSSEITYLILSnnqikgklprqmnspnlrsidlssnhfegtlplwstnadelflqdnrfsgplpenigslmpRLQRLYLSWNqlsgripssvcnledlqILSIRsnklsgefpncwyhsqmfwgidisnnsltgsipssfgsLRSLSVLLLSnnnlsggipcslqnctgltsidlggnqlsgslplwisENLSSFFMLRLRSnllsgdipqrlcnlqnlhiidlshnnfsgaipRCIGNLSALVYGNNSEVFQQLIWRVVkgrnpeysniIADVNSidlswnnltgqipdeigNLSALHILNLShnqlsgaipqSLSSLASLSKLNLSFNnlagkipslpnfndpsiyegnpllcgaplptkcpgkhsplh
maactgfssdhFKSICTFLILFSLSSYLGSTIKHCLADANVEVLCLDAEREGLLAFKesltdpsgrlsSWVGQDCCKWNGVYCNNQSGHVTQLNLRNPYQLINGGVGDSTAYKGSCLGGKINPSLLHLKYLDTLDLSLNDFEGAEIPEYFGQLKNLRYLNLSFSSFSGEIPPQLGSLSSLQYLDLYADSFSSNSGSLALHAQNLNWLSGLSSLKLLNLGFVKLDHVGADWLQAVNMLPSLVELRLHYCQLQGIPLSLPFINFTSISVLDLSENSFNSAIPPWLFSLTSLTKLYLRWNFFTGHIPNEFANLKLLEVLDLSNNLDLGGQLPKLFGILRRLKSLDLSANNLNGEVHEFFDGFSGRPNNLEYLDLSSNSLEGELPKSLGNLKNLQYLRLSGNSFWGSIPSSIGNLSSLRKLDLSYNGMNGTIPESFGKLSELVDANLLQNSWEGILQESQFMNLKRLESFRLTTEPTKKFVFNVSYNWVPPFRLKSIQIENCQVGPSFPVWLQVQTELTSVILRNVGISDTIPGDWFSKLSSEITYLILSNNQIKGKLPRQMNSPNLRSIDLSSNHFEGTLPLWSTNADELFLQDNRFSGPLPENIGSLMPRLQRLYLSWNQLSGRIPSSVCNLEDLQILSIRSNKLSGEFPNCWYHSQMFWGIDISNNSLTGSIPSSFGSLRSLSVLLLSNNNLSGGIPCSLQNCTGLTSIDLGGNQLSGSLPLWISENLSSFFMLRLRSNLLSGDIPQRLCNLQNLHIIDLSHNNFSGAIPRCIGNLSALVYGNNSEVFQQLIWRVVKGRNPEYSNIIADVNSIDLSWNNLTGQIPDEIGNLSALHILNLSHNQLSGAIPQSLSSLASLSKLNLSFNNLAGKIPSLPNFNDPSIYEGNPLLCGAPlptkcpgkhsplh
MAACTGFSSDHFKSICTFLILFSLSSYLGSTIKHCLADANVEVLCLDAEREGLLAFKESLTDPSGRLSSWVGQDCCKWNGVYCNNQSGHVTQLNLRNPYQLINGGVGDSTAYKGSCLGGKINPsllhlkyldtldlslNDFEGAEIPEYFGQLKNLRYLNLSFSSFSGEIPPQLGSLSSLQYLDLYADSFSSNSGSLALHAQnlnwlsglsslkllnlGFVKLDHVGADWLQAVNMLPSLVELRLHYCQLQGIPLSLPFINFTSISVLDLSENSFNSAIPPWLFSLTSLTKLYLRWNFFTGHIPNEFANLKLLEVLDLSNNLDLGGQLPKLFGILRRLKSLDLSANNLNGEVHEFFDGFSGRPNNLEYLDLSSNSLEGELPKSLGNLKNLQYLRLSGNSFWGSIPSSIGNLSSLRKLDLSYNGMNGTIPESFGKLSELVDANLLQNSWEGILQESQFMNLKRLESFRLTTEPTKKFVFNVSYNWVPPFRLKSIQIENCQVGPSFPVWLQVQTELTSVILRNVGISDTIPGDWFSKLSSEITYLILSNNQIKGKLPRQMNSPNLRSIDLSSNHFEGTLPLWSTNADELFLQDNRFSGPLPENIGSLMPRLQRLYLSWNQLSGRIPSSVCNLEDLQILSIRSNKLSGEFPNCWYHSQMFWGIDISNNSLTGSIPssfgslrslsvlllsnnnlsggIPCSLQNCTGLTSIDLGGNQLSGSLPLWISENLSSFFMLRLRSNLLSGDIPQRLCNLQNLHIIDLSHNNFSGAIPRCIGNLSALVYGNNSEVFQQLIWRVVKGRNPEYSNIIADVNSIDLSWNNLTGQIPDEIGNLSALHILNLSHNQLSGAIPQslsslaslsklnlsfnnlAGKIPSLPNFNDPSIYEGNPLLCGAPLPTKCPGKHSPLH
*****GFSSDHFKSICTFLILFSLSSYLGSTIKHCLADANVEVLCLDAEREGLLAFKESLTDPSGRLSSWVGQDCCKWNGVYCNNQSGHVTQLNLRNPYQLINGGVGDSTAYKGSCLGGKINPSLLHLKYLDTLDLSLNDFEGAEIPEYFGQLKNLRYLNLSFSSFSGEIPPQLGSLSSLQYLDLYADSFSSNSGSLALHAQNLNWLSGLSSLKLLNLGFVKLDHVGADWLQAVNMLPSLVELRLHYCQLQGIPLSLPFINFTSISVLDLSENSFNSAIPPWLFSLTSLTKLYLRWNFFTGHIPNEFANLKLLEVLDLSNNLDLGGQLPKLFGILRRLKSLDLSANNLNGEVHEFFDGFSGRPNNLEYLDL************LGNLKNLQYLRLSGNSFWGSIPSSIGNLSSLRKLDLSYNGMNGTIPESFGKLSELVDANLLQNSWEGILQESQFMNLKRLESFRLTTEPTKKFVFNVSYNWVPPFRLKSIQIENCQVGPSFPVWLQVQTELTSVILRNVGISDTIPGDWFSKLSSEITYLILSNNQI********************NHFEGTLPLWSTNADELFLQDNRFSGPLPENIGSLMPRLQRLYLSWNQLSGRIPSSVCNLEDLQILSIRSNKLSGEFPNCWYHSQMFWGIDISNNSLTGSIPSSFGSLRSLSVLLLSNNNLSGGIPCSLQNCTGLTSIDLGGNQLSGSLPLWISENLSSFFMLRLRSNLLSGDIPQRLCNLQNLHIIDLSHNNFSGAIPRCIGNLSALVYGNNSEVFQQLIWRVVKGRNPEYSNIIADVNSIDLSWNNLTGQIPDEIGNLSALHILNLSHNQLSGAIP*****LASLSKLNLSFNNLAGKIPSLPNFNDPSIYEGNPLLCGA**************
************KSICTFLILFSLSSYLGSTIKHCLAD*N****CLDAEREGLLAFKESLTDPSGRLSSWVGQDCCKWNGVYCNNQSGHVTQLNLRNPYQLINGGVGDSTAYKGSCLGGKINPSLLHLKYLDTLDLSLNDFEGAEIPEYFGQLKNLRYLNLSFSSFSGEIPPQLGSLSSLQYLDLYADSFSSNSGSLALHAQNLNWLSGLSSLKLLNLGFVKLDHVGADWLQAVNMLPSLVELRLHYCQLQGIPLSLPFINFTSISVLDLSENSFNSAIPPWLFSLTSLTKLYLRWNFFTGHIPNEFANLKLLEVLDLSNNLDLGGQLPKLFGILRRLKSLDLSANNLNGEVHEFFDGFSGRPNNLEYLDLSSNSLEGELPKSLGNLKNLQYLRLSGNSFWGSIPSSIGNLSSLRKLDLSYNGMNGTIPESFGKLSELVDANLLQNSWEGILQESQFMNLKRLESFRLTTEPTKKFVFNVSYNWVPPFRLKSIQIENCQVGPSFPVWLQVQTELTSVILRNVGISDTIPGDWFSKLSSEITYLILSNNQIKGKLPRQMNSPNLRSIDLSSNHFEGTLPLWSTNADELFLQDNRFSGPLPENIGSLMPRLQRLYLSWNQLSGRIPSSVCNLEDLQILSIRSNKLSGEFPNCWYHSQMFWGIDISNNSLTGSIPSSFGSLRSLSVLLLSNNNLSGGIPCSLQNCTGLTSIDLGGNQLSGSLPLWISENLSSFFMLRLRSNLLSGDIPQRLCNLQNLHIIDLSHNNFSGAIPRCIGNLSALVYGNNSEVFQQLIWRVVKGRNPEYSNIIADVNSIDLSWNNLTGQIPDEIGNLSALHILNLSHNQLSGAIPQSLSSLASLSKLNLSFNNLAGKIPSLPNFNDPSIYEGNPLLCGA**************
********SDHFKSICTFLILFSLSSYLGSTIKHCLADANVEVLCLDAEREGLLAFKESLTDPSGRLSSWVGQDCCKWNGVYCNNQSGHVTQLNLRNPYQLINGGVGDSTAYKGSCLGGKINPSLLHLKYLDTLDLSLNDFEGAEIPEYFGQLKNLRYLNLSFSSFSGEIPPQLGSLSSLQYLDLYADSFSSNSGSLALHAQNLNWLSGLSSLKLLNLGFVKLDHVGADWLQAVNMLPSLVELRLHYCQLQGIPLSLPFINFTSISVLDLSENSFNSAIPPWLFSLTSLTKLYLRWNFFTGHIPNEFANLKLLEVLDLSNNLDLGGQLPKLFGILRRLKSLDLSANNLNGEVHEFFDGFSGRPNNLEYLDLSSNSLEGELPKSLGNLKNLQYLRLSGNSFWGSIPSSIGNLSSLRKLDLSYNGMNGTIPESFGKLSELVDANLLQNSWEGILQESQFMNLKRLESFRLTTEPTKKFVFNVSYNWVPPFRLKSIQIENCQVGPSFPVWLQVQTELTSVILRNVGISDTIPGDWFSKLSSEITYLILSNNQIKGKLPRQMNSPNLRSIDLSSNHFEGTLPLWSTNADELFLQDNRFSGPLPENIGSLMPRLQRLYLSWNQLSGRIPSSVCNLEDLQILSIRSNKLSGEFPNCWYHSQMFWGIDISNNSLTGSIPSSFGSLRSLSVLLLSNNNLSGGIPCSLQNCTGLTSIDLGGNQLSGSLPLWISENLSSFFMLRLRSNLLSGDIPQRLCNLQNLHIIDLSHNNFSGAIPRCIGNLSALVYGNNSEVFQQLIWRVVKGRNPEYSNIIADVNSIDLSWNNLTGQIPDEIGNLSALHILNLSHNQLSGAIPQSLSSLASLSKLNLSFNNLAGKIPSLPNFNDPSIYEGNPLLCGAPLPTKC********
******FSSDHFKSICTFLILFSLSSYLGSTIKHCLADANVEVLCLDAEREGLLAFKESLTDPSGRLSSWVGQDCCKWNGVYCNNQSGHVTQLNLRNPYQLINGGVGDSTAYKGSCLGGKINPSLLHLKYLDTLDLSLNDFEGAEIPEYFGQLKNLRYLNLSFSSFSGEIPPQLGSLSSLQYLDLYADSFSSNSGSLALHAQNLNWLSGLSSLKLLNLGFVKLDHVGADWLQAVNMLPSLVELRLHYCQLQGIPLSLPFINFTSISVLDLSENSFNSAIPPWLFSLTSLTKLYLRWNFFTGHIPNEFANLKLLEVLDLSNNLDLGGQLPKLFGILRRLKSLDLSANNLNGEVHEFFDGFSGRPNNLEYLDLSSNSLEGELPKSLGNLKNLQYLRLSGNSFWGSIPSSIGNLSSLRKLDLSYNGMNGTIPESFGKLSELVDANLLQNSWEGILQESQFMNLKRLESFRLTTEPTKKFVFNVSYNWVPPFRLKSIQIENCQVGPSFPVWLQVQTELTSVILRNVGISDTIPGDWFSKLSSEITYLILSNNQIKGKLPRQMNSPNLRSIDLSSNHFEGTLPLWSTNADELFLQDNRFSGPLPENIGSLMPRLQRLYLSWNQLSGRIPSSVCNLEDLQILSIRSNKLSGEFPNCWYHSQMFWGIDISNNSLTGSIPSSFGSLRSLSVLLLSNNNLSGGIPCSLQNCTGLTSIDLGGNQLSGSLPLWISENLSSFFMLRLRSNLLSGDIPQRLCNLQNLHIIDLSHNNFSGAIPRCIGNLSALVYGNNSEVFQQLIWRVVKGRNPEYSNIIADVNSIDLSWNNLTGQIPDEIGNLSALHILNLSHNQLSGAIPQSLSSLASLSKLNLSFNNLAGKIPSLPNFNDPSIYEGNPLLCGAPLP***********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAACTGFSSDHFKSICTFLILFSLSSYLGSTIKHCLADANVEVLCLDAEREGLLAFKESLTDPSGRLSSWVGQDCCKWNGVYCNNQSGHVTQLNLRNPYQLINGGVGDSTAYKGSCLGGKINPSLLHLKYLDTLDLSLNDFEGAEIPEYFGQLKNLRYLNLSFSSFSGEIPPQLGSLSSLQYLDLYADSFSSNSGSLALHAQNLNWLSGLSSLKLLNLGFVKLDHVGADWLQAVNMLPSLVELRLHYCQLQGIPLSLPFINFTSISVLDLSENSFNSAIPPWLFSLTSLTKLYLRWNFFTGHIPNEFANLKLLEVLDLSNNLDLGGQLPKLFGILRRLKSLDLSANNLNGEVHEFFDGFSGRPNNLEYLDLSSNSLEGELPKSLGNLKNLQYLRLSGNSFWGSIPSSIGNLSSLRKLDLSYNGMNGTIPESFGKLSELVDANLLQNSWEGILQESQFMNLKRLESFRLTTEPTKKFVFNVSYNWVPPFRLKSIQIENCQVGPSFPVWLQVQTELTSVILRNVGISDTIPGDWFSKLSSEITYLILSNNQIKGKLPRQMNSPNLRSIDLSSNHFEGTLPLWSTNADELFLQDNRFSGPLPENIGSLMPRLQRLYLSWNQLSGRIPSSVCNLEDLQILSIRSNKLSGEFPNCWYHSQMFWGIDISNNSLTGSIPSSFGSLRSLSVLLLSNNNLSGGIPCSLQNCTGLTSIDLGGNQLSGSLPLWISENLSSFFMLRLRSNLLSGDIPQRLCNLQNLHIIDLSHNNFSGAIPRCIGNLSALVYGNNSEVFQQLIWRVVKGRNPEYSNIIADVNSIDLSWNNLTGQIPDEIGNLSALHILNLSHNQLSGAIPQSLSSLASLSKLNLSFNNLAGKIPSLPNFNDPSIYEGNPLLCGAPLPTKCPGKHSPLH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query906 2.2.26 [Sep-21-2011]
C0LGQ5 1249 LRR receptor-like serine/ no no 0.876 0.635 0.332 5e-79
Q9FIZ3 1252 LRR receptor-like serine/ no no 0.839 0.607 0.325 2e-76
Q9FL28 1173 LRR receptor-like serine/ no no 0.706 0.545 0.322 2e-73
Q9LP24 1120 Probable leucine-rich rep no no 0.791 0.640 0.317 5e-73
Q9LYN8 1192 Leucine-rich repeat recep no no 0.624 0.474 0.365 7e-71
O49318 1124 Probable leucine-rich rep no no 0.685 0.552 0.320 1e-67
C0LGS2 1136 Probable LRR receptor-lik no no 0.682 0.544 0.319 8e-66
Q9C9H7847 Receptor-like protein 12 no no 0.656 0.702 0.329 1e-62
Q9FZ59 1088 Leucine-rich repeat recep no no 0.643 0.535 0.325 1e-60
Q9SHI2 1101 Leucine-rich repeat recep no no 0.683 0.562 0.305 8e-60
>sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 Back     alignment and function desciption
 Score =  296 bits (758), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 294/885 (33%), Positives = 420/885 (47%), Gaps = 91/885 (10%)

Query: 51  EGLLAFKESL-TDPSGR--LSSWVGQDC--CKWNGVYCNNQS-GHVTQLNLRNPYQLING 104
           + LL  K+SL T+P     L  W   +   C W GV C+N     V  LNL         
Sbjct: 28  QTLLEVKKSLVTNPQEDDPLRQWNSDNINYCSWTGVTCDNTGLFRVIALNLT-------- 79

Query: 105 GVGDSTAYKGSCLGGKINPSLLHLKYLDTLDLSLNDFEGAEIPEYFGQLKNLRYLNLSFS 164
           G+G         L G I+P       L  LDLS N+  G  IP     L +L  L L  +
Sbjct: 80  GLG---------LTGSISPWFGRFDNLIHLDLSSNNLVGP-IPTALSNLTSLESLFLFSN 129

Query: 165 SFSGEIPPQLGSLSSLQYLDLYADSFSSNSGSLALHAQNLNWLSGLSSLKLLNLGFVKLD 224
             +GEIP QLGSL +++ L +         G   L       L  L +L++L L   +L 
Sbjct: 130 QLTGEIPSQLGSLVNIRSLRI---------GDNELVGDIPETLGNLVNLQMLALASCRLT 180

Query: 225 HVGADWLQAVNMLPSLVELRLHYCQLQGIPLSLPFINFTSISVLDLSENSFNSAIPPWLF 284
                 L  +  + SL+ L+ +Y  L+G P+     N + ++V   +EN  N  IP  L 
Sbjct: 181 GPIPSQLGRLVRVQSLI-LQDNY--LEG-PIPAELGNCSDLTVFTAAENMLNGTIPAELG 236

Query: 285 SLTSLTKLYLRWNFFTGHIPNEFANLKLLEVLDLSNNLDLGGQLPKLFGILRRLKSLDLS 344
            L +L  L L  N  TG IP++   +  L+ L L  N  L G +PK    L  L++LDLS
Sbjct: 237 RLENLEILNLANNSLTGEIPSQLGEMSQLQYLSLMAN-QLQGLIPKSLADLGNLQTLDLS 295

Query: 345 ANNLNGEVHEFFDGFSGRPNNLEYLDLSSNSLEGELPKSL-GNLKNLQYLRLSGNSFWGS 403
           ANNL GE+ E F   S     L  L L++N L G LPKS+  N  NL+ L LSG    G 
Sbjct: 296 ANNLTGEIPEEFWNMS----QLLDLVLANNHLSGSLPKSICSNNTNLEQLVLSGTQLSGE 351

Query: 404 IPSSIGNLSSLRKLDLSYNGMNGTIPESFGKLSELVDANLLQNSWEGILQE--SQFMNLK 461
           IP  +    SL++LDLS N + G+IPE+  +L EL D  L  N+ EG L    S   NL+
Sbjct: 352 IPVELSKCQSLKQLDLSNNSLAGSIPEALFELVELTDLYLHNNTLEGTLSPSISNLTNLQ 411

Query: 462 RLESFRLTTEPTKKFVFNVSYNWVPPFRLKSIQIENCQVGPSFPVWLQVQTELTSVILRN 521
            L  +    E   K    +S       +L+ + +   +     P  +   T L  + +  
Sbjct: 412 WLVLYHNNLE--GKLPKEIS----ALRKLEVLFLYENRFSGEIPQEIGNCTSLKMIDMFG 465

Query: 522 VGISDTIPGDWFSKLSSEITYLILSNNQIKGKLPRQM-NSPNLRSIDLSSNHFEGTLPL- 579
                 IP     +L  E+  L L  N++ G LP  + N   L  +DL+ N   G++P  
Sbjct: 466 NHFEGEIPPS-IGRL-KELNLLHLRQNELVGGLPASLGNCHQLNILDLADNQLSGSIPSS 523

Query: 580 --WSTNADELFLQDNRFSGPLPENIGSLMPRLQRLYLSWNQLSGRIPSSVCNLEDLQILS 637
             +    ++L L +N   G LP+++ SL   L R+ LS N+L+G I   +C         
Sbjct: 524 FGFLKGLEQLMLYNNSLQGNLPDSLISLR-NLTRINLSHNRLNGTI-HPLCGSSSYLSFD 581

Query: 638 IRSNKLSGEFPNCWYHSQMFWGIDISNNSLTGSIPSSFGSLRSLSVLLLSNNNLSGGIPC 697
           + +N    E P    +SQ    + +  N LTG IP + G +R LS+L +S+N L+G IP 
Sbjct: 582 VTNNGFEDEIPLELGNSQNLDRLRLGKNQLTGKIPWTLGKIRELSLLDMSSNALTGTIPL 641

Query: 698 SLQNCTGLTSIDLGGNQLSGSLPLWISE-----------------------NLSSFFMLR 734
            L  C  LT IDL  N LSG +P W+ +                       N +   +L 
Sbjct: 642 QLVLCKKLTHIDLNNNFLSGPIPPWLGKLSQLGELKLSSNQFVESLPTELFNCTKLLVLS 701

Query: 735 LRSNLLSGDIPQRLCNLQNLHIIDLSHNNFSGAIPRCIGNLSALVYGNNSEVFQQLIWRV 794
           L  N L+G IPQ + NL  L++++L  N FSG++P+ +G LS L          +L    
Sbjct: 702 LDGNSLNGSIPQEIGNLGALNVLNLDKNQFSGSLPQAMGKLSKLYE-------LRLSRNS 754

Query: 795 VKGRNPEYSNIIADVNS-IDLSWNNLTGQIPDEIGNLSALHILNLSHNQLSGAIPQSLSS 853
           + G  P     + D+ S +DLS+NN TG IP  IG LS L  L+LSHNQL+G +P S+  
Sbjct: 755 LTGEIPVEIGQLQDLQSALDLSYNNFTGDIPSTIGTLSKLETLDLSHNQLTGEVPGSVGD 814

Query: 854 LASLSKLNLSFNNLAGKIPSLPNFNDPSIYEGNPLLCGAPLPTKC 898
           + SL  LN+SFNNL GK+    +      + GN  LCG+PL ++C
Sbjct: 815 MKSLGYLNVSFNNLGGKLKKQFSRWPADSFLGNTGLCGSPL-SRC 858




Together with GSO2, receptor-like serine/threonine-kinase required during the development of the epidermal surface in embryos and cotyledons.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|Q9FIZ3|GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2 Back     alignment and function description
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function description
>sp|Q9LP24|Y1571_ARATH Probable leucine-rich repeat receptor-like protein kinase At1g35710 OS=Arabidopsis thaliana GN=At1g35710 PE=2 SV=1 Back     alignment and function description
>sp|Q9LYN8|EXS_ARATH Leucine-rich repeat receptor protein kinase EXS OS=Arabidopsis thaliana GN=EXS PE=1 SV=1 Back     alignment and function description
>sp|O49318|Y2317_ARATH Probable leucine-rich repeat receptor-like protein kinase At2g33170 OS=Arabidopsis thaliana GN=At2g33170 PE=2 SV=1 Back     alignment and function description
>sp|C0LGS2|Y4361_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g36180 OS=Arabidopsis thaliana GN=At4g36180 PE=1 SV=1 Back     alignment and function description
>sp|Q9C9H7|RLP12_ARATH Receptor-like protein 12 OS=Arabidopsis thaliana GN=RLP12 PE=2 SV=2 Back     alignment and function description
>sp|Q9FZ59|PEPR2_ARATH Leucine-rich repeat receptor-like protein kinase PEPR2 OS=Arabidopsis thaliana GN=PEPR2 PE=1 SV=1 Back     alignment and function description
>sp|Q9SHI2|Y1723_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230 OS=Arabidopsis thaliana GN=At1g17230 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query906
312282905911 unnamed protein product [Thellungiella h 0.956 0.951 0.573 0.0
297826967912 hypothetical protein ARALYDRAFT_482458 [ 0.930 0.924 0.571 0.0
15226862905 disease resistance-like protein/LRR doma 0.929 0.930 0.565 0.0
359488583958 PREDICTED: LRR receptor-like serine/thre 0.928 0.877 0.512 0.0
359484185990 PREDICTED: LRR receptor-like serine/thre 0.943 0.863 0.510 0.0
359496390 1113 PREDICTED: LRR receptor-like serine/thre 0.969 0.788 0.488 0.0
359488591981 PREDICTED: probable leucine-rich repeat 0.940 0.868 0.486 0.0
225451409 1007 PREDICTED: leucine-rich repeat receptor 0.969 0.871 0.484 0.0
359488633981 PREDICTED: LRR receptor-like serine/thre 0.942 0.870 0.477 0.0
359496717 1014 PREDICTED: brassinosteroid LRR receptor 0.967 0.864 0.48 0.0
>gi|312282905|dbj|BAJ34318.1| unnamed protein product [Thellungiella halophila] Back     alignment and taxonomy information
 Score =  957 bits (2475), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 525/915 (57%), Positives = 643/915 (70%), Gaps = 48/915 (5%)

Query: 12  FKSICTFLILFSLSSYLGSTIKHCLADANVEVLCLDAEREGLLAFKESLTDPSGRLSSWV 71
           F S   F+IL     +         A A     C+  ERE LL FK+SLTD SGRLSSW 
Sbjct: 10  FTSFFVFIILLKNPDF---------ASAATSPRCISTEREALLTFKQSLTDLSGRLSSWS 60

Query: 72  GQDCCKWNGVYCNNQSGHVTQLNLRNPYQLINGGVGDSTAYKGSCLGGKINPSLLHLKYL 131
           G DCCKWNG+ C+ Q+  V +++LRNP Q     V +S  YK SCL GKI+ SL  LK+L
Sbjct: 61  GPDCCKWNGILCDAQTSRVIKIDLRNPSQ-----VANSDEYKRSCLRGKIHSSLTRLKFL 115

Query: 132 DTLDLSLNDFEGAEIPEYFGQLKNLRYLNLSFSSFSGEIPPQLGSLSSLQYLDLYADSFS 191
             LDLS NDF G+EIP+  G +  LRYLNLS SSFSGEIP  LG+LS L+ LDLYA+SFS
Sbjct: 116 SYLDLSSNDFNGSEIPDSIGHIVTLRYLNLSSSSFSGEIPASLGNLSKLESLDLYAESFS 175

Query: 192 SNSGSLALHAQNLNWLSGLSS-LKLLNLGFVKLDHVGADWLQAVNMLPSLVELRLHYCQL 250
            +SG+ AL A NL WLSGLSS L  LN+G+V L   G  WLQ ++ L  L ELRL   QL
Sbjct: 176 -DSGAFALRASNLGWLSGLSSSLAYLNMGYVNLSGAGETWLQDLSRLSKLKELRLFNSQL 234

Query: 251 QGIPLSLPF-INFTSISVLDLSENSFNSAIPPWLFSLTSLTKLYLRWNFFTGHIPNEFAN 309
           + +PLSL    N   + VLDLSENS +S IP WLF LTSL KL+LRW+F  G IP+ F N
Sbjct: 235 KNLPLSLSSSANLKLLEVLDLSENSLSSPIPNWLFGLTSLRKLFLRWDFLQGSIPSGFKN 294

Query: 310 LKLLEVLDLSNNLDLGGQLPKLFGILRRLKSLDLSANNLNGEVHEFFDGFS-GRPNNLEY 368
           LKLLE LDLSNNL L G++P + G L +LK LDLSAN LNG++H F D FS  + N+L +
Sbjct: 295 LKLLETLDLSNNLGLQGEIPSVLGDLPQLKYLDLSANELNGQIHGFLDAFSRNKGNSLVF 354

Query: 369 LDLSSNSLEGELPKSLGNLKNLQYLRLSGNSFWGSIPSSIGNLSSLRKLDLSYNGMNGTI 428
           LDLSSN L G LP+SLG L+NLQ L LS NSF GS+PSSIGN++SL+KLDLS+N MNG I
Sbjct: 355 LDLSSNKLAGTLPESLGALRNLQILDLSSNSFTGSVPSSIGNMASLKKLDLSFNTMNGAI 414

Query: 429 PESFGKLSELVDANLLQNSWEGILQESQFMNLKRLESFRLTTEPTKKFVFNVSYNWVPPF 488
            ES GKL EL D NL+ N+WEG++ +S F+NL+ L+S RLTTEP +  V  +   W+PPF
Sbjct: 415 AESLGKLGELEDLNLMANTWEGVMGKSHFVNLRSLKSIRLTTEPNRSLVLKLPSTWIPPF 474

Query: 489 RLKSIQIENCQVGPSFPVWLQVQTELTSVILRNVGISDTIPGDWFSKLSSEITYLILSNN 548
           RL+ IQIENCQ+GPSFP+WLQVQT+L  V LRN GI+DTIP  WFS +SSE+TYLIL+NN
Sbjct: 475 RLELIQIENCQIGPSFPMWLQVQTKLNFVTLRNTGIADTIPDSWFSGISSEVTYLILANN 534

Query: 549 QIKGKLPRQMNSPNLRSIDLSSNHFEGTLPLWSTNADELFLQDNRFSGPLPENIGSLMPR 608
           +IKG+LP+++  P L +IDLSSN+F+G  PLWSTNA EL L +N FSG LP NI  LMPR
Sbjct: 535 RIKGRLPQKLVFPKLNTIDLSSNNFDGPFPLWSTNATELRLYENNFSGSLPLNIDVLMPR 594

Query: 609 LQRLYLSWNQLSGRIPSSVCNLEDLQILSIRSNKLSGEFPNCWYHSQMFWGIDISNNSLT 668
           ++++YL  N  +G IPSS+C +  LQILS+R+N  SG FP CW+ S M WGID S N+++
Sbjct: 595 MEKIYLFHNSFTGTIPSSLCEVSGLQILSLRNNHFSGSFPKCWHRSFMLWGIDASENNIS 654

Query: 669 GSIPSSFGSLRSLSVLLLSNNNLSGGIPCSLQNCTGLTSIDLGGNQLSGSLPLWISENLS 728
           G IP S G LRSLSVLLL+ N L G IP SLQNC+GLT+IDLGGN+L+G LP W+  NLS
Sbjct: 655 GEIPESLGVLRSLSVLLLNQNALEGEIPESLQNCSGLTNIDLGGNKLTGKLPSWL-RNLS 713

Query: 729 SFFMLRLRSNLLSGDIPQRLCNLQNLHIIDLSHNNFSGAIPRCIGNLSALVYGNNSEVFQ 788
           S FMLRL+SN  +G IP  LC++ NLHI+DLS N  SG IP+CI NL+A+ +G + EVFQ
Sbjct: 714 SLFMLRLQSNSFTGQIPDDLCSVPNLHILDLSGNKISGPIPKCISNLTAIAHGTSFEVFQ 773

Query: 789 QLIWRVVKGRNPEYSNIIADVNSIDLSWNNLTGQIPDEIGNLSALHILN----------- 837
            L++ V + R  EY +I   VNSI+LS NN+TG+ P EI  LS L ILN           
Sbjct: 774 NLVYIVTRAR--EYQDI---VNSINLSGNNITGEFPAEILGLSYLRILNLSRNSMAGSIP 828

Query: 838 -------------LSHNQLSGAIPQSLSSLASLSKLNLSFNNLAGKIPSLPNFNDPSIYE 884
                        LS N+ SGAIPQSL +++SL +LNLSFN L G IP +  F DPSIY 
Sbjct: 829 GKISELSRLETLDLSRNRFSGAIPQSLGAISSLQRLNLSFNKLEGSIPKVLKFEDPSIYI 888

Query: 885 GNPLLCGAPLPTKCP 899
           GN LLCG PLP KCP
Sbjct: 889 GNELLCGKPLPKKCP 903




Source: Thellungiella halophila

Species: Eutrema halophilum

Genus: Eutrema

Family: Brassicaceae

Order: Brassicales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|297826967|ref|XP_002881366.1| hypothetical protein ARALYDRAFT_482458 [Arabidopsis lyrata subsp. lyrata] gi|297327205|gb|EFH57625.1| hypothetical protein ARALYDRAFT_482458 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15226862|ref|NP_181039.1| disease resistance-like protein/LRR domain-containing protein [Arabidopsis thaliana] gi|13272423|gb|AAK17150.1|AF325082_1 putative disease resistance protein [Arabidopsis thaliana] gi|3033389|gb|AAC12833.1| putative disease resistance protein [Arabidopsis thaliana] gi|17380976|gb|AAL36300.1| putative disease resistance protein [Arabidopsis thaliana] gi|21436087|gb|AAM51244.1| putative disease resistance protein [Arabidopsis thaliana] gi|330253947|gb|AEC09041.1| disease resistance-like protein/LRR domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|359488583|ref|XP_003633782.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase FLS2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359484185|ref|XP_002273824.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase FLS2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359496390|ref|XP_002268557.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359488591|ref|XP_003633783.1| PREDICTED: probable leucine-rich repeat receptor-like protein kinase At1g35710-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|225451409|ref|XP_002273126.1| PREDICTED: leucine-rich repeat receptor protein kinase EXS-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359488633|ref|XP_002264905.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase FLS2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359496717|ref|XP_003635312.1| PREDICTED: brassinosteroid LRR receptor kinase-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query906
TAIR|locus:2044767905 AT2G34930 "AT2G34930" [Arabido 0.899 0.900 0.523 2e-223
TAIR|locus:22050051019 RLP7 "AT1G47890" [Arabidopsis 0.896 0.796 0.272 2.3e-72
TAIR|locus:2825762994 RLP6 "AT1G45616" [Arabidopsis 0.954 0.870 0.284 7.1e-70
TAIR|locus:2005629 1140 AT1G75640 [Arabidopsis thalian 0.687 0.546 0.321 9.8e-68
UNIPROTKB|Q8RZV7 1294 P0413C03.22 "Putative extra sp 0.743 0.520 0.315 2.2e-67
TAIR|locus:2182870 1192 EMS1 "EXCESS MICROSPOROCYTES1" 0.692 0.526 0.317 4.6e-64
TAIR|locus:2825384847 RLP12 "AT1G71400" [Arabidopsis 0.646 0.691 0.316 6e-64
TAIR|locus:2120362 1249 GSO1 "GASSHO1" [Arabidopsis th 0.826 0.599 0.304 3.7e-62
TAIR|locus:2156349 1252 GSO2 "GASSHO 2" [Arabidopsis t 0.822 0.595 0.297 3.7e-62
TAIR|locus:2137296811 RLP46 "receptor like protein 4 0.643 0.718 0.307 1.5e-60
TAIR|locus:2044767 AT2G34930 "AT2G34930" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2157 (764.4 bits), Expect = 2.0e-223, P = 2.0e-223
 Identities = 435/831 (52%), Positives = 554/831 (66%)

Query:    45 CLDAEREGLLAFKESLTDPSGRLSSWVGQDCCKWNGVYCNNQSGHVTQLNLRNPYQLING 104
             C+  ER+ LL F+ +LTD S RL SW G DCC W GV C+ ++ HV +++LRNP Q +  
Sbjct:    33 CISTERQALLTFRAALTDLSSRLFSWSGPDCCNWPGVLCDARTSHVVKIDLRNPSQDVR- 91

Query:   105 GVGDSTAYKGSCLGGKINPXXXXXXXXXXXXXXXNDFEGAEIPEYFGQLKNLRYLNLSFS 164
                 S  YK   L GKI+P               NDF   EIPE+ GQ+ +LRYLNLS S
Sbjct:    92 ----SDEYKRGSLRGKIHPSLTQLKFLSYLDLSSNDFNELEIPEFIGQIVSLRYLNLSSS 147

Query:   165 SFSGEIPPQLGSLSSLQYLDLYADSFSSNSGSLALHAQXXX-XXXXXXXXXXXXXGFVKL 223
             SFSGEIP  LG+LS L+ LDLYA+SF  +SG+L+L A                  G+V L
Sbjct:   148 SFSGEIPTSLGNLSKLESLDLYAESFG-DSGTLSLRASNLRWLSSLSSSLKYLNMGYVNL 206

Query:   224 DHVGADWLQAVNMLPSLVELRLHYCQLQGIPLSLPF-INFTSISVLDLSENSFNSAIPPW 282
                G  WLQ  + + +L EL L   +L+ +P +L    +   + VLDLSENS NS IP W
Sbjct:   207 SGAGETWLQDFSRISALKELHLFNSELKNLPPTLSSSADLKLLEVLDLSENSLNSPIPNW 266

Query:   283 LFSLTSLTKLYLRWNFFTGHIPNEFANLKLLEVLDLSNNLDLGGQLPKLFGILRRLKSLD 342
             LF LT+L KL+LRW+F  G IP  F NLKLLE LDLSNNL L G++P + G L +LK LD
Sbjct:   267 LFGLTNLRKLFLRWDFLQGSIPTGFKNLKLLETLDLSNNLALQGEIPSVLGDLPQLKFLD 326

Query:   343 LSANNLNGEVHEFFDGFS-GRPNNLEYLDLSSNSLEGELPKSLGNLKNLQYLRLSGNSFW 401
             LSAN LNG++H F D FS  + N+L +LDLSSN L G LP+SLG+L+NLQ L LS NSF 
Sbjct:   327 LSANELNGQIHGFLDAFSRNKGNSLVFLDLSSNKLAGTLPESLGSLRNLQTLDLSSNSFT 386

Query:   402 GSIPSSIGNLSSLRKLDLSYNGMNGTIPESFGKLSELVDANLLQNSWEGILQESQFMNLK 461
             GS+PSSIGN++SL+KLDLS N MNGTI ES G+L+ELVD NL+ N+W G+LQ+S F+NL+
Sbjct:   387 GSVPSSIGNMASLKKLDLSNNAMNGTIAESLGQLAELVDLNLMANTWGGVLQKSHFVNLR 446

Query:   462 RLESFRLTTEPTKKFVFNVSYNWVPPFRLKSIQIENCQVGPSFPVWLQVQTELTSVILRN 521
              L+S RLTTEP +  VF +   W+PPFRL+ IQIENC++G  FP+WLQVQT+L  V LRN
Sbjct:   447 SLKSIRLTTEPYRSLVFKLPSTWIPPFRLELIQIENCRIG-LFPMWLQVQTKLNFVTLRN 505

Query:   522 VGISDTIPGDWFSKLSSEITYLILSNNQIKGKLPRQMNSPNLRSIDLSSNHFEGTLPLWS 581
              GI DTIP  WFS +SS++TYLIL+NN+IKG+LP+++  P L +IDLSSN+FEGT PLWS
Sbjct:   506 TGIEDTIPDSWFSGISSKVTYLILANNRIKGRLPQKLAFPKLNTIDLSSNNFEGTFPLWS 565

Query:   582 TNADELFLQDNRFSGPLPENIGSLMPRLQRLYLSWNQLSGRIPSSVCNLEDLQILSIRSN 641
             TNA EL L +N FSG LP+NI  LMPR++++YL  N  +G IPSS+C +  LQILS+R N
Sbjct:   566 TNATELRLYENNFSGSLPQNIDVLMPRMEKIYLFSNSFTGNIPSSLCEVSGLQILSLRKN 625

Query:   642 KLSGEFPNCWYHSQMFWGIDISNNSLTGSIPXXXXXXXXXXXXXXXXXXXXXXIPCSLQN 701
               SG FP CW+   M WGID+S N+L+G IP                      IP SL+N
Sbjct:   626 HFSGSFPKCWHRQFMLWGIDVSENNLSGEIPESLGMLPSLSVLLLNQNSLEGKIPESLRN 685

Query:   702 CTGLTSIDLGGNQLSGSLPLWISENLSSFFMLRLRSNLLSGDIPQRLCNLQNLHIIDLSH 761
             C+GLT+IDLGGN+L+G LP W+ + LSS FMLRL+SN  +G IP  LCN+ NL I+DLS 
Sbjct:   686 CSGLTNIDLGGNKLTGKLPSWVGK-LSSLFMLRLQSNSFTGQIPDDLCNVPNLRILDLSG 744

Query:   762 NNFSGAIPRCIGNLSALVYGNNSEVFQQLIWRVVKGRNPEYSNIIADVNSIDLSWNNLTG 821
             N  SG IP+CI NL+A+  G N+EVFQ L++ V + R  EY  I    NSI+LS NN++G
Sbjct:   745 NKISGPIPKCISNLTAIARGTNNEVFQNLVFIVTRAR--EYEAI---ANSINLSGNNISG 799

Query:   822 QIPDEIGNLSALHILNLSHNQLSGAIPQXXXXXXXXXXXXXXXXXXAGKIP 872
             +IP EI  L  L ILNLS N ++G+IP+                  +G IP
Sbjct:   800 EIPREILGLLYLRILNLSRNSMAGSIPEKISELSRLETLDLSKNKFSGAIP 850


GO:0006952 "defense response" evidence=ISS
GO:0007165 "signal transduction" evidence=IC
GO:0005618 "cell wall" evidence=IDA
GO:0050832 "defense response to fungus" evidence=IEP;IMP
TAIR|locus:2205005 RLP7 "AT1G47890" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2825762 RLP6 "AT1G45616" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2005629 AT1G75640 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q8RZV7 P0413C03.22 "Putative extra sporogenous cells" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2182870 EMS1 "EXCESS MICROSPOROCYTES1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2825384 RLP12 "AT1G71400" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2120362 GSO1 "GASSHO1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2156349 GSO2 "GASSHO 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2137296 RLP46 "receptor like protein 46" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
fgenesh2_kg.4__1518__AT2G34930.1
annotation not avaliable (912 aa)
(Arabidopsis lyrata)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query906
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-69
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-66
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 9e-61
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-16
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-15
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-13
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-13
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-12
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-12
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-11
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-09
PLN03150 623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-09
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 8e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-08
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 4e-08
pfam0826342 pfam08263, LRRNT_2, Leucine rich repeat N-terminal 1e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-06
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 2e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 7e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 8e-06
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 3e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 3e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-05
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 8e-05
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 3e-04
PLN032101153 PLN03210, PLN03210, Resistant to P 7e-04
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 0.001
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 0.002
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score =  248 bits (636), Expect = 2e-69
 Identities = 224/681 (32%), Positives = 321/681 (47%), Gaps = 122/681 (17%)

Query: 45  CLDAER-EGLLAFKESLTDPSGRLSSW-VGQDCCKWNGVYCNNQSGHVTQLNLRNPYQLI 102
            L AE  E LL+FK S+ DP   LS+W    D C W G+ CNN S  V  ++L       
Sbjct: 25  MLHAEELELLLSFKSSINDPLKYLSNWNSSADVCLWQGITCNNSS-RVVSIDL------- 76

Query: 103 NGGVGDSTAYKGSCLGGKINPSLLHLKYLDTLDLSLNDFEGAEIPEYFGQLKNLRYLNLS 162
                      G  + GKI+ ++  L Y+ T++LS N   G    + F    +LRYLNLS
Sbjct: 77  ----------SGKNISGKISSAIFRLPYIQTINLSNNQLSGPIPDDIFTTSSSLRYLNLS 126

Query: 163 FSSFSGEIPPQLGSLSSLQYLDLYADSFSSNSGSLALHAQNLNWLSGLSSLKLLNL-GFV 221
            ++F+G IP   GS+ +L+ LDL  +  S          +  N +   SSLK+L+L G V
Sbjct: 127 NNNFTGSIPR--GSIPNLETLDLSNNMLS---------GEIPNDIGSFSSLKVLDLGGNV 175

Query: 222 KLDHVGADWLQAVNMLPSLVELRLHYCQLQG-IPLSLPFINFTSISVLDLSENSFNSAIP 280
            +  +      ++  L SL  L L   QL G IP  L      S+  + L  N+ +  IP
Sbjct: 176 LVGKIPN----SLTNLTSLEFLTLASNQLVGQIPRELG--QMKSLKWIYLGYNNLSGEIP 229

Query: 281 PWLFSLTSLTKLYLRWNFFTGHIPNEFANLKLLEVLDLSNNLDLGGQLPKLFGILRRLKS 340
             +  LTSL  L L +N  TG IP+   NLK L+ L L  N  L G +P     L++L S
Sbjct: 230 YEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQN-KLSGPIPPSIFSLQKLIS 288

Query: 341 LDLSANNLNGEVHEFFDGFSGRPNNLEYLDLSSNSLEGELPKSLGNLKNLQYLRLSGNSF 400
           LDLS N+L+GE+ E       +  NLE L L SN+  G++P +L +L  LQ L+L  N F
Sbjct: 289 LDLSDNSLSGEIPELV----IQLQNLEILHLFSNNFTGKIPVALTSLPRLQVLQLWSNKF 344

Query: 401 WGSIPSSIGNLSSLRKLDLSYNGMNGTIPESFGKLSELVDANLLQNSWEGILQESQFMNL 460
            G IP ++G  ++L  LDLS N + G IPE       L    L  NS EG          
Sbjct: 345 SGEIPKNLGKHNNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEG---------- 394

Query: 461 KRLESFRLTTEPTKKFVFNVSYNWVPPFRLKSIQIENCQVGPSFPVWLQVQTELTSVILR 520
                                                 ++  S    L     L  V L+
Sbjct: 395 --------------------------------------EIPKS----LGACRSLRRVRLQ 412

Query: 521 NVGISDTIPGDWFSKLSSEITYLILSNNQIKGKL-PRQMNSPNLRSIDLSSNHFEGTLPL 579
           +   S  +P + F+KL   + +L +SNN ++G++  R+ + P+L+ + L+          
Sbjct: 413 DNSFSGELPSE-FTKLPL-VYFLDISNNNLQGRINSRKWDMPSLQMLSLAR--------- 461

Query: 580 WSTNADELFLQDNRFSGPLPENIGSLMPRLQRLYLSWNQLSGRIPSSVCNLEDLQILSIR 639
                       N+F G LP++ GS   RL+ L LS NQ SG +P  + +L +L  L + 
Sbjct: 462 ------------NKFFGGLPDSFGS--KRLENLDLSRNQFSGAVPRKLGSLSELMQLKLS 507

Query: 640 SNKLSGEFPNCWYHSQMFWGIDISNNSLTGSIPSSFGSLRSLSVLLLSNNNLSGGIPCSL 699
            NKLSGE P+     +    +D+S+N L+G IP+SF  +  LS L LS N LSG IP +L
Sbjct: 508 ENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIPKNL 567

Query: 700 QNCTGLTSIDLGGNQLSGSLP 720
            N   L  +++  N L GSLP
Sbjct: 568 GNVESLVQVNISHNHLHGSLP 588


Length = 968

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|219766 pfam08263, LRRNT_2, Leucine rich repeat N-terminal domain Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 906
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.98
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.97
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.96
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.96
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.88
KOG4237498 consensus Extracellular matrix protein slit, conta 99.87
PLN032101153 Resistant to P. syringae 6; Provisional 99.86
KOG4237498 consensus Extracellular matrix protein slit, conta 99.85
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.85
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.84
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.77
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.76
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.71
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.68
KOG0617264 consensus Ras suppressor protein (contains leucine 99.64
KOG0617264 consensus Ras suppressor protein (contains leucine 99.62
PLN03150623 hypothetical protein; Provisional 99.44
PLN03150623 hypothetical protein; Provisional 99.31
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.27
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.22
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.2
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.11
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.1
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.08
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.94
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.94
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.94
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.88
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.88
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.86
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.76
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.74
PF0826343 LRRNT_2: Leucine rich repeat N-terminal domain; In 98.66
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.64
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.63
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.55
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.55
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.55
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.27
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.25
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.18
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.17
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.08
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.07
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.06
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.04
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.92
KOG4341483 consensus F-box protein containing LRR [General fu 97.85
KOG4341483 consensus F-box protein containing LRR [General fu 97.76
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.75
PRK15386 426 type III secretion protein GogB; Provisional 97.75
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.73
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.62
PRK15386 426 type III secretion protein GogB; Provisional 97.58
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.54
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.28
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.25
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.11
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.92
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.9
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.45
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.25
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.15
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.11
KOG1947482 consensus Leucine rich repeat proteins, some prote 95.76
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.16
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.88
KOG4308478 consensus LRR-containing protein [Function unknown 93.28
KOG4308478 consensus LRR-containing protein [Function unknown 92.91
KOG0473 326 consensus Leucine-rich repeat protein [Function un 90.22
KOG0473326 consensus Leucine-rich repeat protein [Function un 89.79
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 88.96
KOG3864221 consensus Uncharacterized conserved protein [Funct 87.65
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 85.42
smart0037026 LRR Leucine-rich repeats, outliers. 85.42
KOG3864221 consensus Uncharacterized conserved protein [Funct 84.52
smart0037026 LRR Leucine-rich repeats, outliers. 83.31
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 83.31
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=100.00  E-value=2.5e-69  Score=673.05  Aligned_cols=585  Identities=37%  Similarity=0.574  Sum_probs=420.8

Q ss_pred             HHHHHHHHHHHhhCCCCCCCCCCC-CCCCCCCccceEecCCCCcEEEEecCCcccccCCCcCCCcCCCCccccccccccc
Q 002574           47 DAEREGLLAFKESLTDPSGRLSSW-VGQDCCKWNGVYCNNQSGHVTQLNLRNPYQLINGGVGDSTAYKGSCLGGKINPSL  125 (906)
Q Consensus        47 ~~~~~~ll~~k~~~~~~~~~l~~W-~~~~~c~w~gv~C~~~~~~v~~L~L~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l  125 (906)
                      ++|++||++||+++.+|.+.+.+| ...+||.|.||+|+. .++|+.|+|+++                 .+.|.+++.+
T Consensus        28 ~~~~~~l~~~~~~~~~~~~~~~~w~~~~~~c~w~gv~c~~-~~~v~~L~L~~~-----------------~i~~~~~~~~   89 (968)
T PLN00113         28 AEELELLLSFKSSINDPLKYLSNWNSSADVCLWQGITCNN-SSRVVSIDLSGK-----------------NISGKISSAI   89 (968)
T ss_pred             HHHHHHHHHHHHhCCCCcccCCCCCCCCCCCcCcceecCC-CCcEEEEEecCC-----------------CccccCChHH
Confidence            479999999999998888888999 467899999999975 579999999987                 7788888889


Q ss_pred             cCCCCCCEEeCCCCCCCCCCCChhhh-cCCCCCeeeccCCcCccCCCcCcCCCCCCcEEEccCCCCCCCcCCccccccch
Q 002574          126 LHLKYLDTLDLSLNDFEGAEIPEYFG-QLKNLRYLNLSFSSFSGEIPPQLGSLSSLQYLDLYADSFSSNSGSLALHAQNL  204 (906)
Q Consensus       126 ~~l~~L~~L~Ls~n~~~~~~lp~~l~-~l~~L~~L~Ls~n~~~~~~p~~l~~l~~L~~L~ls~n~~~~~~~~~~~~~~~~  204 (906)
                      ..+++|++|+|++|.+.+. +|..+. .+++|++|++++|++++.+|.  +.+++|++|++++|.+.+            
T Consensus        90 ~~l~~L~~L~Ls~n~~~~~-ip~~~~~~l~~L~~L~Ls~n~l~~~~p~--~~l~~L~~L~Ls~n~~~~------------  154 (968)
T PLN00113         90 FRLPYIQTINLSNNQLSGP-IPDDIFTTSSSLRYLNLSNNNFTGSIPR--GSIPNLETLDLSNNMLSG------------  154 (968)
T ss_pred             hCCCCCCEEECCCCccCCc-CChHHhccCCCCCEEECcCCccccccCc--cccCCCCEEECcCCcccc------------
Confidence            9999999999999998876 777655 888899999888888877664  334444444444333211            


Q ss_pred             hhhcCCCCCcEEECCCccCCCCCcchHHHhcCCCCCcEEEccCCcCCCCCCccCcCCCCcccEEECCCCcCCCCChhhhh
Q 002574          205 NWLSGLSSLKLLNLGFVKLDHVGADWLQAVNMLPSLVELRLHYCQLQGIPLSLPFINFTSISVLDLSENSFNSAIPPWLF  284 (906)
Q Consensus       205 ~~l~~l~~L~~L~l~~n~l~~~~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~~~~~l~~L~~L~Ls~n~~~~~~p~~l~  284 (906)
                                                                      ..+ ..+.++++|++|++++|.+.+.+|..++
T Consensus       155 ------------------------------------------------~~p-~~~~~l~~L~~L~L~~n~l~~~~p~~~~  185 (968)
T PLN00113        155 ------------------------------------------------EIP-NDIGSFSSLKVLDLGGNVLVGKIPNSLT  185 (968)
T ss_pred             ------------------------------------------------cCC-hHHhcCCCCCEEECccCcccccCChhhh
Confidence                                                            111 1244455566666666666555666666


Q ss_pred             cCCCCCEEEeecccccccCchhhcCCCCCCeEeCCCCCCCCCCcchhhhcCCCCCEEEccCCcCCcccccccccCCCCCC
Q 002574          285 SLTSLTKLYLRWNFFTGHIPNEFANLKLLEVLDLSNNLDLGGQLPKLFGILRRLKSLDLSANNLNGEVHEFFDGFSGRPN  364 (906)
Q Consensus       285 ~l~~L~~L~L~~n~~~~~~~~~l~~l~~L~~L~L~~n~~~~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~~~~l~~~~~  364 (906)
                      ++++|++|++++|.+.+.+|..++++++|++|++++| .+.+.+|..++.+++|++|++++|.+++..|..+..+.    
T Consensus       186 ~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n-~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~----  260 (968)
T PLN00113        186 NLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYN-NLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNLK----  260 (968)
T ss_pred             hCcCCCeeeccCCCCcCcCChHHcCcCCccEEECcCC-ccCCcCChhHhcCCCCCEEECcCceeccccChhHhCCC----
Confidence            6666666666666665555555555666666666555 55555555555555555555555555544444444444    


Q ss_pred             CccEEECcCCCCCCccchhccCCCCCceeeccCccccCCCCccCCCCCCCCEEeCcCccCCcccccchhccccCceeecC
Q 002574          365 NLEYLDLSSNSLEGELPKSLGNLKNLQYLRLSGNSFWGSIPSSIGNLSSLRKLDLSYNGMNGTIPESFGKLSELVDANLL  444 (906)
Q Consensus       365 ~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~~~~~~~~~~~~l~~L~~L~l~  444 (906)
                      +|++|++++|.+.+.+|..+.++++|++|++++|.+.+.+|..+..+++|+.|++++|.+.+.+|..+..+++|+.|+++
T Consensus       261 ~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~L~  340 (968)
T PLN00113        261 NLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFTGKIPVALTSLPRLQVLQLW  340 (968)
T ss_pred             CCCEEECcCCeeeccCchhHhhccCcCEEECcCCeeccCCChhHcCCCCCcEEECCCCccCCcCChhHhcCCCCCEEECc
Confidence            45555555555444444444444444444444444444444444444444444444444444444433333333333333


Q ss_pred             CCCccCCCChHHhhccccccEeecCCCCCcceeeeccCCCcCCCCccEEEeecccCCCCCChhcccCCcccEEEccCCCc
Q 002574          445 QNSWEGILQESQFMNLKRLESFRLTTEPTKKFVFNVSYNWVPPFRLKSIQIENCQVGPSFPVWLQVQTELTSVILRNVGI  524 (906)
Q Consensus       445 ~n~l~~~~~~~~~~~l~~L~~L~l~~n~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~l~~~~~L~~L~l~~~~~  524 (906)
                      +|.+.+.+|.                                                                      
T Consensus       341 ~n~l~~~~p~----------------------------------------------------------------------  350 (968)
T PLN00113        341 SNKFSGEIPK----------------------------------------------------------------------  350 (968)
T ss_pred             CCCCcCcCCh----------------------------------------------------------------------
Confidence            3332222111                                                                      


Q ss_pred             cCCCChhhhhhcCCCccEEEccCCcccCCCCCCCCCCCccEEeccCccCcccCCCCcccccccccccccCCCCCCchhhc
Q 002574          525 SDTIPGDWFSKLSSEITYLILSNNQIKGKLPRQMNSPNLRSIDLSSNHFEGTLPLWSTNADELFLQDNRFSGPLPENIGS  604 (906)
Q Consensus       525 ~~~~p~~~~~~~~~~L~~L~ls~n~l~~~~~~~~~~~~L~~L~ls~n~l~~~~~~~~~~L~~L~l~~n~l~~~~p~~~~~  604 (906)
                                                                                                  .+. 
T Consensus       351 ----------------------------------------------------------------------------~l~-  353 (968)
T PLN00113        351 ----------------------------------------------------------------------------NLG-  353 (968)
T ss_pred             ----------------------------------------------------------------------------HHh-
Confidence                                                                                        111 


Q ss_pred             ccccceeeccccccccccCCCCCCCCCCCcEEEccCCcCcccCCCCccCCCCccEEeCCCCcccccCCcCCCCCCCCCEE
Q 002574          605 LMPRLQRLYLSWNQLSGRIPSSVCNLEDLQILSIRSNKLSGEFPNCWYHSQMFWGIDISNNSLTGSIPSSFGSLRSLSVL  684 (906)
Q Consensus       605 ~~~~L~~L~ls~n~l~~~~~~~~~~l~~L~~L~Ls~n~l~~~~p~~l~~~~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L  684 (906)
                      .+++|+.|++++|.+++.+|..++.+++|+.|++++|.+.+.+|..+..+++|+.|++++|++++.+|..|..++.|+.|
T Consensus       354 ~~~~L~~L~Ls~n~l~~~~p~~~~~~~~L~~L~l~~n~l~~~~p~~~~~~~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L  433 (968)
T PLN00113        354 KHNNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFSGELPSEFTKLPLVYFL  433 (968)
T ss_pred             CCCCCcEEECCCCeeEeeCChhHhCcCCCCEEECcCCEecccCCHHHhCCCCCCEEECcCCEeeeECChhHhcCCCCCEE
Confidence            12334444444455555555666667788888888888888888888888888888888888888888888888899999


Q ss_pred             ECcCCccccccccccccCCCCCEEEccCCcCcccccHHHHhcCCCCcEEEccCCccccccCccccCCCCCCEEeCCCCcC
Q 002574          685 LLSNNNLSGGIPCSLQNCTGLTSIDLGGNQLSGSLPLWISENLSSFFMLRLRSNLLSGDIPQRLCNLQNLHIIDLSHNNF  764 (906)
Q Consensus       685 ~Ls~n~l~~~~p~~l~~l~~L~~L~L~~N~l~~~~p~~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~Ls~N~l  764 (906)
                      ++++|.+.+.+|..+..+++|+.|++++|++.+.+|..+.  .++|+.|++++|++.+.+|..+..+++|+.|++++|++
T Consensus       434 ~Ls~N~l~~~~~~~~~~l~~L~~L~L~~n~~~~~~p~~~~--~~~L~~L~ls~n~l~~~~~~~~~~l~~L~~L~Ls~N~l  511 (968)
T PLN00113        434 DISNNNLQGRINSRKWDMPSLQMLSLARNKFFGGLPDSFG--SKRLENLDLSRNQFSGAVPRKLGSLSELMQLKLSENKL  511 (968)
T ss_pred             ECcCCcccCccChhhccCCCCcEEECcCceeeeecCcccc--cccceEEECcCCccCCccChhhhhhhccCEEECcCCcc
Confidence            9999998888888888889999999999999888887654  68999999999999999999999999999999999999


Q ss_pred             CCCCCcccccccccccCCCccchheeeeeeecCCCcccccccCcccEEEcCCCcccccCChhhhccCCCCEEeCcCCccc
Q 002574          765 SGAIPRCIGNLSALVYGNNSEVFQQLIWRVVKGRNPEYSNIIADVNSIDLSWNNLTGQIPDEIGNLSALHILNLSHNQLS  844 (906)
Q Consensus       765 ~~~ip~~~~~l~~L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~~LdLs~N~l~~~ip~~l~~l~~L~~L~Ls~N~l~  844 (906)
                      ++.+|..++++++|                               +.|+|++|.+++.+|..++++++|+.|||++|+++
T Consensus       512 ~~~~p~~~~~l~~L-------------------------------~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~  560 (968)
T PLN00113        512 SGEIPDELSSCKKL-------------------------------VSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLS  560 (968)
T ss_pred             eeeCChHHcCccCC-------------------------------CEEECCCCcccccCChhHhCcccCCEEECCCCccc
Confidence            99999999888888                               89999999999999999999999999999999999


Q ss_pred             ccccccccCCCCCCeEeCcCCcccccCCCC---CCCCCCCccCCCCCCCCCCC---CCCCC
Q 002574          845 GAIPQSLSSLASLSKLNLSFNNLAGKIPSL---PNFNDPSIYEGNPLLCGAPL---PTKCP  899 (906)
Q Consensus       845 ~~ip~~l~~l~~L~~L~ls~N~l~g~iP~~---~~~~~~~~~~gn~~lc~~~l---~~~c~  899 (906)
                      +.+|..+.++++|++|++++|+++|.+|..   .+|...+ |.|||++||.+.   ..+|.
T Consensus       561 ~~~p~~l~~l~~L~~l~ls~N~l~~~~p~~~~~~~~~~~~-~~~n~~lc~~~~~~~~~~c~  620 (968)
T PLN00113        561 GEIPKNLGNVESLVQVNISHNHLHGSLPSTGAFLAINASA-VAGNIDLCGGDTTSGLPPCK  620 (968)
T ss_pred             ccCChhHhcCcccCEEeccCCcceeeCCCcchhcccChhh-hcCCccccCCccccCCCCCc
Confidence            999999999999999999999999999987   5667777 999999998652   24564



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query906
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 5e-45
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 1e-13
3rgx_A768 Structural Insight Into Brassinosteroid Perception 5e-45
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 9e-14
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 2e-16
1ozn_A285 1.5a Crystal Structure Of The Nogo Receptor Ligand 1e-10
1p8t_A285 Crystal Structure Of Nogo-66 Receptor Length = 285 2e-10
3kj4_A286 Structure Of Rat Nogo Receptor Bound To 1d9 Antagon 1e-09
3j0a_A844 Homology Model Of Human Toll-Like Receptor 5 Fitted 5e-08
2z63_A570 Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 A 5e-07
2z66_A306 Crystal Structure Of The Vt3 Hybrid Of Human Tlr4 A 5e-06
2o6q_A270 Structural Diversity Of The Hagfish Variable Lympho 1e-05
3fxi_A605 Crystal Structure Of The Human Tlr4-Human Md-2-E.Co 3e-05
3zyj_A440 Netring1 In Complex With Ngl1 Length = 440 9e-05
3v47_A455 Crystal Structure Of The N-Tetminal Fragment Of Zeb 1e-04
4g8a_A635 Crystal Structure Of Human Tlr4 Polymorphic Variant 1e-04
3rfs_A272 Design Of A Binding Scaffold Based On Variable Lymp 1e-04
2z7x_A549 Crystal Structure Of The Tlr1-Tlr2 Heterodimer Indu 2e-04
2z80_A353 Crystal Structure Of The Tlr1-Tlr2 Heterodimer Indu 3e-04
2v70_A220 Third Lrr Domain Of Human Slit2 Length = 220 4e-04
2omx_A462 Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX 7e-04
2omt_A462 Crystal Structure Of Inla G194s+sHEC1 COMPLEX Lengt 7e-04
2id5_A477 Crystal Structure Of The Lingo-1 Ectodomain Length 7e-04
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure

Iteration: 1

Score = 179 bits (455), Expect = 5e-45, Method: Compositional matrix adjust. Identities = 211/715 (29%), Positives = 310/715 (43%), Gaps = 142/715 (19%) Query: 263 TSISVLDLSENSFNSAIPPWLFSLTSLTKL-YLRWNFFTGHIPNEFAN-LKL--LEVLDL 318 S++ LDLS NS + + L SL S + L +L + T P + + LKL LEVLDL Sbjct: 97 ASLTSLDLSRNSLSGPVT-TLTSLGSCSGLKFLNVSSNTLDFPGKVSGGLKLNSLEVLDL 155 Query: 319 SNNLDLGGQLPK--LFGILRRLKSLDLSANNLNGEVHEFFDGFSGRPNNLEYLDLSSNSL 376 S N G + L LK L +S N ++G+V R NLE+LD+SSN+ Sbjct: 156 SANSISGANVVGWVLSDGCGELKHLAISGNKISGDVD------VSRCVNLEFLDVSSNNF 209 Query: 377 EGELPKSLGNLKNLQYLRLSGNSFWGSIPSSIGNLSSLRKLDLSYNGMNGTIPESFGKLS 436 +P LG+ LQ+L +SGN G +I + L+ L++S N G IP L Sbjct: 210 STGIP-FLGDCSALQHLDISGNKLSGDFSRAISTCTELKLLNISSNQFVGPIPPL--PLK 266 Query: 437 ELVDANLLQNSWEGILQESQFMNLKRLESFRLTTEPTKKFVFNVSYNWVPPFRLKSIQIE 496 L +L +N + G + + L L+ N Y VPPF Sbjct: 267 SLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSG--------NHFYGAVPPF-------- 310 Query: 497 NCQVGPSFPVWLQVQTELTSVILRNVGISDTIPGDWFSKLSSEITYLILSNNQIKGKLPR 556 + L S+ L + S +P D K+ + L LS N+ G+LP Sbjct: 311 -----------FGSCSLLESLALSSNNFSGELPMDTLLKMRG-LKVLDLSFNEFSGELPE 358 Query: 557 QMN--SPNLRSIDLSSNHFEG-TLPLWSTNAD----ELFLQDNRFSGPLPENIGSLMPRL 609 + S +L ++DLSSN+F G LP N EL+LQ+N F+G +P + S L Sbjct: 359 SLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTL-SNCSEL 417 Query: 610 QRLYLSWNQLSGRIPSSVCNLEDLQILSIRSNKLSGEFPNCWYHSQMFWGIDISNNSLTG 669 L+LS+N LSG IPSS+ +L L+ L + N L GE P + + + + N LTG Sbjct: 418 VSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTG 477 Query: 670 SIPXXXXXXXXXXXXXXXXXXXXXXIPCSLQNCTGLTSIDLGGNQLSGSLPLWISENLSS 729 IP L NCT L I L N+L+G +P WI L + Sbjct: 478 EIPS------------------------GLSNCTNLNWISLSNNRLTGEIPKWIGR-LEN 512 Query: 730 FFMLRLRSNLLSGDIPQRLCNLQNLHIIDLSHNNFSGAIP-------------------- 769 +L+L +N SG+IP L + ++L +DL+ N F+G IP Sbjct: 513 LAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRY 572 Query: 770 ----------RCIG------------------------NLSALVYG---------NNSEV 786 C G N+++ VYG N S + Sbjct: 573 VYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMM 632 Query: 787 FQQLIWRVVKGRNPEYSNIIADVNSIDLSWNNLTGQIPDEIGNLSALHILNLSHNQLSGA 846 F + + ++ G P+ + + ++L N+++G IPDE+G+L L+IL+LS N+L G Sbjct: 633 FLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGR 692 Query: 847 IPQXXXXXXXXXXXXXXXXXXAGKIPSLPNFND--PSIYEGNPLLCGAPLPTKCP 899 IPQ +G IP + F P+ + NP LCG PLP P Sbjct: 693 IPQAMSALTMLTEIDLSNNNLSGPIPEMGQFETFPPAKFLNNPGLCGYPLPRCDP 747
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1OZN|A Chain A, 1.5a Crystal Structure Of The Nogo Receptor Ligand Binding Domain Reveals A Convergent Recognition Scaffold Mediating Inhibition Of Myelination Length = 285 Back     alignment and structure
>pdb|1P8T|A Chain A, Crystal Structure Of Nogo-66 Receptor Length = 285 Back     alignment and structure
>pdb|3KJ4|A Chain A, Structure Of Rat Nogo Receptor Bound To 1d9 Antagonist Antibody Length = 286 Back     alignment and structure
>pdb|3J0A|A Chain A, Homology Model Of Human Toll-Like Receptor 5 Fitted Into An Electron Microscopy Single Particle Reconstruction Length = 844 Back     alignment and structure
>pdb|2Z63|A Chain A, Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 570 Back     alignment and structure
>pdb|2Z66|A Chain A, Crystal Structure Of The Vt3 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 306 Back     alignment and structure
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure
>pdb|3FXI|A Chain A, Crystal Structure Of The Human Tlr4-Human Md-2-E.Coli Lps Ra Complex Length = 605 Back     alignment and structure
>pdb|3ZYJ|A Chain A, Netring1 In Complex With Ngl1 Length = 440 Back     alignment and structure
>pdb|3V47|A Chain A, Crystal Structure Of The N-Tetminal Fragment Of Zebrafish Tlr5 In Complex With Salmonella Flagellin Length = 455 Back     alignment and structure
>pdb|4G8A|A Chain A, Crystal Structure Of Human Tlr4 Polymorphic Variant D299g And T399i In Complex With Md-2 And Lps Length = 635 Back     alignment and structure
>pdb|3RFS|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 272 Back     alignment and structure
>pdb|2Z7X|A Chain A, Crystal Structure Of The Tlr1-Tlr2 Heterodimer Induced By Binding Of A Tri-Acylated Lipopeptide Length = 549 Back     alignment and structure
>pdb|2Z80|A Chain A, Crystal Structure Of The Tlr1-Tlr2 Heterodimer Induced By Binding Of A Tri-Acylated Lipopeptide Length = 353 Back     alignment and structure
>pdb|2V70|A Chain A, Third Lrr Domain Of Human Slit2 Length = 220 Back     alignment and structure
>pdb|2OMX|A Chain A, Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMT|A Chain A, Crystal Structure Of Inla G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2ID5|A Chain A, Crystal Structure Of The Lingo-1 Ectodomain Length = 477 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query906
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 0.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-93
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 9e-85
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 8e-83
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-55
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-79
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-74
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-72
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-47
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-43
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-32
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-74
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-68
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-66
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 7e-57
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-20
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-73
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-50
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-47
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-38
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-67
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-62
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-55
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-52
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-37
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-23
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-08
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-66
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-61
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 6e-21
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 6e-10
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-66
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-64
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-56
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 8e-51
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-47
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-52
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-51
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-43
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-04
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-50
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-48
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-41
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-33
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-32
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-19
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-10
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-46
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-38
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-36
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-29
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-17
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-09
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-05
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-36
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-33
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 9e-29
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-25
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 9e-24
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-23
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 9e-16
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-08
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-36
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-35
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-34
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-24
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-23
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 1e-21
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 5e-14
1o6v_A466 Internalin A; bacterial infection, extracellular r 9e-36
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-34
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-32
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-35
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-33
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-32
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-29
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-28
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-28
4fmz_A347 Internalin; leucine rich repeat, structural genomi 9e-22
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 7e-11
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-34
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-26
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-24
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-23
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-23
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-18
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-17
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-08
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-32
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-30
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-30
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-18
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-15
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 9e-08
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-31
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 7e-29
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-28
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-27
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-25
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-18
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 8e-14
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-05
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-31
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 7e-31
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-26
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-21
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 9e-10
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-08
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 7e-31
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 9e-30
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 9e-29
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 7e-28
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-26
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-26
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-23
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-05
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-30
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-29
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-22
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-14
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 8e-13
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-29
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-23
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-21
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-20
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-19
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-06
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 3e-29
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 6e-29
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-28
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-25
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 3e-25
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 7e-24
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 5e-08
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-05
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-27
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-25
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-24
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-22
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-19
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-19
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-13
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-27
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-25
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-24
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-23
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-22
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-21
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-19
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-13
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-09
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-26
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-24
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 9e-22
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-19
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 9e-19
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-15
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-12
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-26
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-23
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-22
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-18
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-18
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-13
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 8e-04
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 8e-26
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-25
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-24
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-20
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 4e-19
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 9e-19
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 3e-18
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 3e-05
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 8e-26
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-19
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 7e-18
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-17
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-14
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-08
1ozn_A 285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-05
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-25
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-25
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-25
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 7e-20
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 6e-19
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-17
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-16
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 2e-05
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-23
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-21
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-20
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-18
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-16
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 8e-09
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 7e-05
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-23
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-21
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-20
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-19
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-17
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-16
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-14
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 5e-22
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 5e-21
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 4e-20
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 1e-16
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 5e-14
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 4e-13
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-21
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 6e-17
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-15
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-14
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-14
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 7e-13
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-08
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-21
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 6e-16
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-11
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 7e-10
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 3e-04
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-04
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 6e-19
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-15
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-13
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-12
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 8e-12
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-09
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 7e-09
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-18
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-17
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-16
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-16
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-11
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-04
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 2e-18
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 2e-17
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-16
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-15
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 4e-13
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 5e-12
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-11
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-17
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-15
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-14
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-14
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-13
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-11
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 9e-11
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-10
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-10
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 5e-10
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-09
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-08
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-17
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-15
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 6e-12
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 7e-12
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-08
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-08
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-06
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-06
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-17
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-16
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-14
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-13
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 6e-12
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 7e-12
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-10
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-16
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-15
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-11
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 6e-10
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-08
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-08
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 7e-08
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 7e-08
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 7e-16
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 9e-16
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-11
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-10
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 5e-09
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-06
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-15
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-15
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-14
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-14
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-12
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 7e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 9e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-04
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-15
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 6e-14
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-11
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-09
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-09
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 9e-09
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-08
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-14
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-12
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 8e-10
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-09
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 7e-09
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 9e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-04
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 4e-14
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-10
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-08
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 7e-08
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-06
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-06
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 5e-06
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 6e-05
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-13
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-11
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-11
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-06
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 9e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-13
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-11
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-10
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-08
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 5e-08
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-04
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 6e-13
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 3e-09
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 5e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-12
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-09
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 6e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-06
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 7e-06
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-09
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-06
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-12
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-12
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-06
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 8e-12
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 3e-11
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 4e-05
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 5e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-11
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 7e-04
3m19_A251 Variable lymphocyte receptor A diversity region; a 8e-11
3m19_A251 Variable lymphocyte receptor A diversity region; a 4e-10
3m19_A251 Variable lymphocyte receptor A diversity region; a 7e-08
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-06
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-06
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-04
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-10
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 3e-07
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 1e-06
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 3e-05
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-09
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-05
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-05
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 7e-05
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 6e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 2e-09
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 5e-05
3e6j_A229 Variable lymphocyte receptor diversity region; var 4e-09
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-08
3e6j_A229 Variable lymphocyte receptor diversity region; var 5e-05
3e6j_A229 Variable lymphocyte receptor diversity region; var 3e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 3e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 5e-09
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-05
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 8e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 7e-09
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 4e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-04
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 1e-08
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 8e-07
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 8e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 7e-08
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 7e-08
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-06
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 4e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 9e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 7e-04
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 9e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-07
1w8a_A192 SLIT protein; signaling protein, secreted protein, 4e-07
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 4e-07
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 2e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 1e-04
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 9e-07
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 7e-06
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 6e-05
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 1e-04
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 3e-06
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 5e-05
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 7e-04
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 8e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  567 bits (1463), Expect = 0.0
 Identities = 224/874 (25%), Positives = 371/874 (42%), Gaps = 141/874 (16%)

Query: 45  CLDAEREGLLAFKESLTDPSGRLSSW-VGQDCCKWNGVYCNNQSGHVTQLNLRNPYQLIN 103
            L  E   L++FK+ L D    L  W   ++ C ++GV C +    VT ++L +      
Sbjct: 9   SLYREIHQLISFKDVLPDK-NLLPDWSSNKNPCTFDGVTCRD--DKVTSIDLSSKPL--- 62

Query: 104 GGVGDSTAYKGSCLGGKINPSLLHLKYLDTLDLSLNDFEGAEIPEYFGQLKNLRYLNLSF 163
                      +     ++ SLL L  L++L LS +   G  +   F    +L  L+LS 
Sbjct: 63  -----------NVGFSAVSSSLLSLTGLESLFLSNSHING-SVSG-FKCSASLTSLDLSR 109

Query: 164 SSFSGEIPP--QLGSLSSLQYLDLYADSFSSNSGSLALHAQNLNWLSGLSSLKLLNLGFV 221
           +S SG +     LGS S L++L++     SSN+         ++    L+SL++L+L   
Sbjct: 110 NSLSGPVTTLTSLGSCSGLKFLNV-----SSNTLDFPG---KVSGGLKLNSLEVLDLSAN 161

Query: 222 KLDHVGADWLQAVNMLPSLVELRLHYCQLQGIPLSLPFINFTSISVLDLSENSFNSAIPP 281
            +           +    L  L +   ++ G    +      ++  LD+S N+F++ I P
Sbjct: 162 SISGANVVGWVLSDGCGELKHLAISGNKISG---DVDVSRCVNLEFLDVSSNNFSTGI-P 217

Query: 282 WLFSLTSLTKLYLRWNFFTGHIPNEFANLKLLEVLDLSNNLDLGGQLPKLFGILRRLKSL 341
           +L   ++L  L +  N  +G      +    L++L++S+N    G +P     L+ L+ L
Sbjct: 218 FLGDCSALQHLDISGNKLSGDFSRAISTCTELKLLNISSN-QFVGPIPP--LPLKSLQYL 274

Query: 342 DLSANNLNGEVHEFFDGFSGRPNNLEYLDLSSNSLEGELPKSLGNLKNLQYLRLSGNSFW 401
            L+ N   GE+ +F    SG  + L  LDLS N   G +P   G+   L+ L LS N+F 
Sbjct: 275 SLAENKFTGEIPDF---LSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFS 331

Query: 402 GSIP-SSIGNLSSLRKLDLSYNGMNGTIPESFGKLS-ELVDANLLQNSWEG-ILQESQFM 458
           G +P  ++  +  L+ LDLS+N  +G +PES   LS  L+  +L  N++ G IL      
Sbjct: 332 GELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQN 391

Query: 459 NLKRLESFRLTTEPTKKFVFNVSYNWVPPFRLKSIQIENCQVGPSFPVWLQVQTELTSVI 518
               L+   L              N                                   
Sbjct: 392 PKNTLQELYL------------QNN----------------------------------- 404

Query: 519 LRNVGISDTIPGDWFSKLSSEITYLILSNNQIKGKLPRQM-NSPNLRSIDLSSNHFEGTL 577
               G +  IP    S  S  +  L LS N + G +P  + +   LR + L  N  EG +
Sbjct: 405 ----GFTGKIP-PTLSNCSE-LVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEI 458

Query: 578 PLWSTNADEL---FLQDNRFSGPLPENIGSLMPRLQRLYLSWNQLSGRIPSSVCNLEDLQ 634
           P        L    L  N  +G +P  + +    L  + LS N+L+G IP  +  LE+L 
Sbjct: 459 PQELMYVKTLETLILDFNDLTGEIPSGLSNC-TNLNWISLSNNRLTGEIPKWIGRLENLA 517

Query: 635 ILSIRSNKLSGEFPNCWYHSQMFWGIDISNNSLTGSIPSSFGSLRSLSVLLLSNNNLSGG 694
           IL + +N  SG  P      +    +D++ N   G+IP++           ++ N ++G 
Sbjct: 518 ILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQS----GKIAANFIAGK 573

Query: 695 IPCSLQNCTGLTSIDLGGN--QLSGSLPLWISENLSSFFMLRLRSNLLSGDIPQRLCNLQ 752
               ++N          GN  +  G     ++  LS+     + S +  G       N  
Sbjct: 574 RYVYIKNDGMKKECHGAGNLLEFQGIRSEQLN-RLSTRNPCNITSRVYGGHTSPTFDNNG 632

Query: 753 NLHIIDLSHNNFSGAIPRCIGNLSALVYGNNSEVFQQLIWRVVKGRNPEYSNIIADVNSI 812
           ++  +D+S+N  SG IP+ IG++  L                                 +
Sbjct: 633 SMMFLDMSYNMLSGYIPKEIGSMPYLF-------------------------------IL 661

Query: 813 DLSWNNLTGQIPDEIGNLSALHILNLSHNQLSGAIPQSLSSLASLSKLNLSFNNLAGKIP 872
           +L  N+++G IPDE+G+L  L+IL+LS N+L G IPQ++S+L  L++++LS NNL+G IP
Sbjct: 662 NLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIP 721

Query: 873 SLPNFN--DPSIYEGNPLLCGAPLPTKCPGKHSP 904
            +  F    P+ +  NP LCG PLP   P     
Sbjct: 722 EMGQFETFPPAKFLNNPGLCGYPLPRCDPSNADG 755


>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 Back     alignment and structure

Structure Templates Detected by HHsearch ?

No hit with probability above 80.00


Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 906
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 8e-24
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 6e-19
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-18
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 0.001
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 7e-21
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-19
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 4e-14
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 7e-13
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-11
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-08
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-08
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-19
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 9e-17
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-14
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-13
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 7e-13
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-06
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 5e-17
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 5e-12
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 9e-12
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-10
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 5e-10
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 8e-09
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 3e-07
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-15
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 9e-10
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 8e-06
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 6e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.001
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.001
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-11
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 4e-09
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-08
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 3e-08
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 4e-08
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-06
d1p9ag_ 266 c.10.2.7 (G:) von Willebrand factor binding domain 4e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 8e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.001
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 4e-10
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 1e-05
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 5e-05
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 1e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 5e-09
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 6e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 7e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 6e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 6e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 6e-09
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 6e-09
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 5e-06
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 9e-06
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 5e-07
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 6e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 8e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 6e-07
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 3e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 5e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.003
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.004
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 8e-07
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 2e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 5e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 8e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 1e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 4e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.004
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 7e-06
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 1e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 5e-04
d2ca6a1 344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.003
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.004
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 7e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 3e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 3e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.004
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 1e-04
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 0.001
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 7e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.001
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.001
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.003
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 0.001
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 0.003
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
 Score =  102 bits (254), Expect = 8e-24
 Identities = 74/376 (19%), Positives = 129/376 (34%), Gaps = 37/376 (9%)

Query: 364 NNLEYLDLSSNSLEGELPKSLGNLKNLQYLRLSGNSFWGSIPSSIGNLSSLRKLDLSYNG 423
           + +  L      ++      +  L NL  +  S N      P  + NL+ L  + ++ N 
Sbjct: 44  DQVTTLQADRLGIKS--IDGVEYLNNLTQINFSNNQLTDITP--LKNLTKLVDILMNNNQ 99

Query: 424 MNGTIPESFGKLSELVDANLLQNSWEGILQESQFMNLKRLESFRLTTEPTKKFVFNVSYN 483
           +    P +       +     Q +    L+    +N   L S  ++       + ++   
Sbjct: 100 IADITPLANLTNLTGLTLFNNQITDIDPLKNLTNLNRLELSSNTISDISALSGLTSLQQL 159

Query: 484 WVPPFRLKSIQIENCQVGPSFPVWLQVQTELTSVILRNVGISDTIPGDWFSKLSSEITYL 543
                      + N        +     ++                        + +  L
Sbjct: 160 SFGNQVTDLKPLANLTTLERLDISSNKVSD-----------------ISVLAKLTNLESL 202

Query: 544 ILSNNQIKGKLPRQMNSPNLRSIDLSSNHFEGTLPLWS-TNADELFLQDNRFSGPLPENI 602
           I +NNQI    P      NL  + L+ N  +    L S TN  +L L +N+ S   P   
Sbjct: 203 IATNNQISDITP-LGILTNLDELSLNGNQLKDIGTLASLTNLTDLDLANNQISNLAPL-- 259

Query: 603 GSLMPRLQRLYLSWNQLSGRIPSSVCNLEDLQILSIRSNKLSGEFPNCWYHSQMFWGIDI 662
            S + +L  L L  NQ+S   P  +  L  L  L +  N+   E  +   + +    + +
Sbjct: 260 -SGLTKLTELKLGANQISNISP--LAGLTALTNLELNENQ--LEDISPISNLKNLTYLTL 314

Query: 663 SNNSLTGSIPSSFGSLRSLSVLLLSNNNLSGGIPCSLQNCTGLTSIDLGGNQLSGSLPLW 722
             N+++   P    SL  L  L  +NN +S     SL N T +  +  G NQ+S   PL 
Sbjct: 315 YFNNISDISP--VSSLTKLQRLFFANNKVSD--VSSLANLTNINWLSAGHNQISDLTPL- 369

Query: 723 ISENLSSFFMLRLRSN 738
              NL+    L L   
Sbjct: 370 --ANLTRITQLGLNDQ 383


>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query906
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 100.0
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 100.0
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 100.0
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 100.0
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 100.0
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 100.0
d1p9ag_266 von Willebrand factor binding domain of glycoprote 100.0
d1p9ag_266 von Willebrand factor binding domain of glycoprote 100.0
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.97
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.96
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.96
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.94
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.94
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.94
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.92
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.91
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.91
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.91
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.91
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.91
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.91
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.9
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.88
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.87
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.78
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.77
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.73
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.67
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.6
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.89
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.65
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 98.26
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=100.00  E-value=0  Score=278.64  Aligned_cols=292  Identities=33%  Similarity=0.575  Sum_probs=166.3

Q ss_pred             CCCHHHHHHHHHHHHHCCCCCCCCCCC-CCCCCCC--CCCEEECCC--CCCEEEEECCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             793898999999886088999997899-9899977--332483399--99589972179522247986788677776556
Q 002574           44 LCLDAEREGLLAFKESLTDPSGRLSSW-VGQDCCK--WNGVYCNNQ--SGHVTQLNLRNPYQLINGGVGDSTAYKGSCLG  118 (906)
Q Consensus        44 ~~~~~~~~~l~~~~~~~~~~~~~~~~W-~~~~~c~--w~gv~c~~~--~~~v~~L~L~~~~~~~~~~~~~~~~~~~~~~~  118 (906)
                      .|.++|++||++||+++.+|. .+++| .+.|||.  |.||+|+..  .+||++|+|+++                 .+.
T Consensus         2 ~c~~~e~~aLl~~k~~~~~~~-~l~sW~~~~d~C~~~w~gv~C~~~~~~~~v~~L~L~~~-----------------~l~   63 (313)
T d1ogqa_           2 LCNPQDKQALLQIKKDLGNPT-TLSSWLPTTDCCNRTWLGVLCDTDTQTYRVNNLDLSGL-----------------NLP   63 (313)
T ss_dssp             CSCHHHHHHHHHHHHHTTCCG-GGTTCCTTSCTTTTCSTTEEECCSSSCCCEEEEEEECC-----------------CCS
T ss_pred             CCCHHHHHHHHHHHHHCCCCC-CCCCCCCCCCCCCCCCCCEEEECCCCCEEEEEEECCCC-----------------CCC
T ss_conf             989899999999999779998-67788999999889488969748999479889989899-----------------888


Q ss_pred             C--CCCCCCCCCCCCCEEECCC-CCCCCCCCCHHHHCCCCCCEEECCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCCCC
Q ss_conf             2--0054443787889885989-999999978000048889835025775766788475999988589855898999867
Q 002574          119 G--KINPSLLHLKYLDTLDLSL-NDFEGAEIPEYFGQLKNLRYLNLSFSSFSGEIPPQLGSLSSLQYLDLYADSFSSNSG  195 (906)
Q Consensus       119 ~--~l~~~l~~l~~L~~L~Ls~-~~~~~~~lp~~l~~l~~L~~L~L~~~~~~~~~p~~l~~l~~L~~L~l~~n~~~~~~~  195 (906)
                      |  .+|+.++++++|++|++++ |.+.+. +|..++++++|++|++++|.+.+..+..+..+.+|++++++.|.      
T Consensus        64 g~~~lp~~l~~L~~L~~L~Ls~~N~l~g~-iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l~l~~N~------  136 (313)
T d1ogqa_          64 KPYPIPSSLANLPYLNFLYIGGINNLVGP-IPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNA------  136 (313)
T ss_dssp             SCEECCGGGGGCTTCSEEEEEEETTEESC-CCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSE------
T ss_pred             CCCCCCHHHHCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCHHHHCCCCCCCCCCCCCCCHHHHCCCCCCCCC------
T ss_conf             88879847846753352020265433300-24311454200110203564344332222201110011112245------


Q ss_pred             CCCCCCCCHHHHCCCCCCCEEECCCCCCCCCCCCHHHHHCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCCEEECCCCCC
Q ss_conf             73000243011129999968977984477777546887218999969982487688889966767998635998779858
Q 002574          196 SLALHAQNLNWLSGLSSLKLLNLGFVKLDHVGADWLQAVNMLPSLVELRLHYCQLQGIPLSLPFINFTSISVLDLSENSF  275 (906)
Q Consensus       196 ~~~~~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~~~~l~~l~~L~~L~l~~~~l~~~~~~~~~~~l~~L~~L~Ls~n~~  275 (906)
                                                                                                     +
T Consensus       137 -------------------------------------------------------------------------------~  137 (313)
T d1ogqa_         137 -------------------------------------------------------------------------------L  137 (313)
T ss_dssp             -------------------------------------------------------------------------------E
T ss_pred             -------------------------------------------------------------------------------C
T ss_conf             -------------------------------------------------------------------------------5


Q ss_pred             CCCCHHHHHCCCCCCEEEEECCCCCCCCCHHHCCCCCC-CEEECCCCCCCCCCCCHHHHCCCCCCEEECCCCCCCCCCCC
Q ss_conf             99980655369999799902255533484110289999-96867798789998635431589999997558848754221
Q 002574          276 NSAIPPWLFSLTSLTKLYLRWNFFTGHIPNEFANLKLL-EVLDLSNNLDLGGQLPKLFGILRRLKSLDLSANNLNGEVHE  354 (906)
Q Consensus       276 ~~~~~~~l~~l~~L~~L~l~~n~~~~~~~~~l~~l~~L-~~L~L~~n~~~~~~~~~~l~~l~~L~~L~l~~n~l~~~~~~  354 (906)
                      ...+|..+..++.++.+++++|.+.+.+|..+..+..+ +.+++++| .+++..+..+..+.. ..+++..+...+..+.
T Consensus       138 ~~~~p~~l~~l~~L~~l~l~~n~l~~~ip~~~~~l~~l~~~l~~~~n-~l~~~~~~~~~~l~~-~~l~l~~~~~~~~~~~  215 (313)
T d1ogqa_         138 SGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRN-RLTGKIPPTFANLNL-AFVDLSRNMLEGDASV  215 (313)
T ss_dssp             ESCCCGGGGGCTTCCEEECCSSCCEEECCGGGGCCCTTCCEEECCSS-EEEEECCGGGGGCCC-SEEECCSSEEEECCGG
T ss_pred             CCCCCHHHCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCC
T ss_conf             55685122067400000023553356203121443112323102246-435332433222222-2333333433222222


Q ss_pred             CCCCCCCCCCCCCEEECCCCCCCCCCCHHCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCCCCCCHHC
Q ss_conf             12267999999658988588787864410129988862323376356887834799999889968576588436501004
Q 002574          355 FFDGFSGRPNNLEYLDLSSNSLEGELPKSLGNLKNLQYLRLSGNSFWGSIPSSIGNLSSLRKLDLSYNGMNGTIPESFGK  434 (906)
Q Consensus       355 ~l~~l~~~~~~L~~L~l~~~~~~~~~p~~l~~l~~L~~L~l~~n~~~~~~~~~l~~l~~L~~L~L~~n~~~~~~~~~~~~  434 (906)
                      .+..+.    +++.+++.++.+.+.. ..+..+++++.|++++|++.+.+|..++.+++|+.|++++|++++.+|. ++.
T Consensus       216 ~~~~~~----~l~~l~~~~~~l~~~~-~~~~~~~~L~~L~Ls~N~l~g~iP~~l~~L~~L~~L~Ls~N~l~g~iP~-~~~  289 (313)
T d1ogqa_         216 LFGSDK----NTQKIHLAKNSLAFDL-GKVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQ-GGN  289 (313)
T ss_dssp             GCCTTS----CCSEEECCSSEECCBG-GGCCCCTTCCEEECCSSCCEECCCGGGGGCTTCCEEECCSSEEEEECCC-STT
T ss_pred             CCCCCC----CCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCEECCCCCHHHHCCCCCCEEECCCCCCCCCCCC-CCC
T ss_conf             222222----2111222222222222-2222455444444765706660876884799999897958835166898-666


Q ss_pred             CCCCCEEECCCCC
Q ss_conf             4667541167888
Q 002574          435 LSELVDANLLQNS  447 (906)
Q Consensus       435 l~~L~~L~l~~n~  447 (906)
                      +++|+.+++.+|+
T Consensus       290 L~~L~~l~l~~N~  302 (313)
T d1ogqa_         290 LQRFDVSAYANNK  302 (313)
T ss_dssp             GGGSCGGGTCSSS
T ss_pred             CCCCCHHHHCCCC
T ss_conf             7998978868895



>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure