Citrus Sinensis ID: 002655

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890------
MGNLLSSFLSSPESFRSILSYVGGEAKYVWALQVNLDALQAELDKLIRTKDDLLNKVELVEQQQPRARRTNQVKGWLQRVQETVTKVVDLQNVRDQELDRLCLGGFCSKDLASSYYFGKKVVTLTEQVILLKNERGEIKDIAEMVPEDAAVELALERTVVGQESMLDQVWRCITDQEKNRGIIGLYGTGGVGKTTLLKQVNNKFCIEQRQHHFDVVIWGVVSREPKLDKIQDAIGKRIGLSAESWMDKSLEEKALDISNILSRKKFVLLLDDIWQPIDLTELGIPLQSLNVSSKVVFTTRSLDVCGSMEADEKIEVKYLVHDEAWRLFQEKVGEATLRCHSDILELAQTLARECCGLPLALKTIGRAMAYKKNPDEWKYATKVLSTSPEKFSGMEENVFARLKFSYDSLPNYIIRSCFLYCSLFPEDYEVYKGDLIDYWTSEGFVDAFDEGYTIIGDLLRACLLEEVNDNHVKMHDVIRDMALWIACKIDKEEENFLVHAGALLTEAPKIKDWEGFKRISLMENNITSLSAIPNCPHLRTLLLYRNRISMITDGFFQFMPSLKVLNLGFNIFLNKLPSGLSSLISLEHLDLSFTVIRELPEEMKALVNLRYLNLEYVYLNRLPLQLLCNFTKLQALRMLGCSNYSGEEEDRVFFKDAEPFMKELLCLENLDLLSFTFDSWHAFETFLTFQKLLSCTESLELTKLYTPMSLNVLPLAYMKHLKNFLIQNCAFEELKIENAVEIQNLVQRGFRSLHTVFISDCSRLKELTWLVFAPNLKNIDVQNCNNMEEIISPGKLSEVSEIKERQNFLAELKFLCLKDLENLESIYFDPLPFPQLKEIEVTGCPKLKKLPLDSTRAMGHKIVVKGNIEWWVELQWEDRVTQRVFSTCFDPMEIVF
cccHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccHHHHHHHHHHHHHcccccccEEEEEEcccccHHHHHHHHHccccccHHcccccEEEEEEEcccccHHHHHHHHHHHHcccccccccccHHHHHHHHHHHccccEEEEEEcccccccccccccccccccccccEEEEEcccHHHHHHccccccEEcccccHHHHHHHHHHHHccccccccccHHHHHHHHHHHccccHHHHHHHHHHHcccccHHHHHHHHHHHHcccccccccccHHHHHHHccccccccccHHHHHHHHccccccccccHHHHHHHHHHccccccccHHHHHHHHHHHcccccccccccEEEcHHHHHHHHHHHHHHccccccEEEEccccccccccccccccEEEEEEEccccccccccccccccEEEEEcccccccccHHHHcccccccEEEcccccccccccccccccccccEEcccccccccccHHHHccccccccccccccccccccHHccccccccEEEccccccccccccccccccccccccccccccccccEEEEEEcccHHHHHHHcHHHHHccccEEEEcccccccccccccccccccccEEEcccccccEEEEccccccccccccccccEEEEEEEccccccccccccccccccEEEEEccccccEEcccccccccccccccccccccccEEEcccccccccccccccccccccEEEEEccccccccccccccccccEEEEEcccccccccccccHHHHHHcccccEEEEEcc
cccEEEEEEccHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccEEcccccccccccccccccEEcccHHHHHHHHHHHccccccEEEEEEccccccHHHHHHHHHcccHHHHccccccEEEEEEEcccccHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHccccEEEEEEcccccccHHHHcccccccccccEEEEEEccHHHHHHHcccccEEcccccHHHHHHHHHHHHccccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHccccHHHHHHHHHHHHHcHHHcccccccccHHHEEcHcccccHHHHHHHEEEEcccccccEcHHHHHHHHHHcccccHHHcHHHHHHHHHHHHHHccccccEEEEHHHHHHHHHHHHHHHccccccEEEEcccccEEcccccccccEEEEEEcccccccccccccccccEEEEEcccccccccHHHHHcccccEEEEEcccccHHcccccccccccccEEEccccccccccHHcccccccEEEEEccccccccccccccccccccEEEEccccccccccccccccccccccHHHHHccccccEEEEEccccccHHHHHHHcccccccEEEEEccccccccccHccccccccccEEEEEcccccHcccccccccccccccccccccEEEEEcccccccccccccccccEEEEEcccccHcccccccccccHHHccccccccccccEEEEcccccHHcccccccccccccEEEEcccccHcccccccccccccEEEEcccHHHHHHHcHccHHHHHHHccccccEHHcc
mgnllssflsspeSFRSILSYVGGEAKYVWALQVNLDALQAELDKLIRTKDDLLNKVELVEqqqprarrtNQVKGWLQRVQETVTKVVDLQNVRDQELDRLclggfcskdlassyyfgkKVVTLTEQVILLKNERGEIKDIAEMVPEDAAVELALERTVVGQESMLDQVWRCITdqeknrgiiglygtggvgktTLLKQVNNKFCIEQRQHHFDVVIWgvvsrepkldkIQDAIGKRIGLSAESWMDKSLEEKALDISNILSRKKFVLLLDdiwqpidltelgiplqslnvsskVVFTTRsldvcgsmeaDEKIEVKYLVHDEAWRLFQEKVGEATLRCHSDILELAQTLARECCGLPLALKTIGRAMAYKKNPDEWKYATKVLstspekfsgmEENVFARLKFSydslpnyiirSCFLYCslfpedyevykgdlidywtsegfvdafdeGYTIIGDLLRACLLEEVNDNHVKMHDVIRDMALWIACKIDKEEENFLVHAGAllteapkikdwegfKRISLMENnitslsaipncphlrTLLLYRNRISMitdgffqfmpslkvLNLGFNIFLNKLPSGLSSLISLEHLDLSFTVIRELPEEMKALVNLRYLNLEYVYLNRLPLQLLCNFTKLQALRMlgcsnysgeeedrvffkDAEPFMKELLCLenldllsftfDSWHAFETFLTFQKLLSCtesleltklytpmslnvlPLAYMKHLKNFLIQNCAFEELKIENAVEIQNLVQRGFRSLHTVFISdcsrlkeltwlvfapnlknidvqncnnmeeiispgklsevSEIKERQNFLAELKFLCLKDLEnlesiyfdplpfpqlkeievtgcpklkklpldstramGHKIVVKGNIEWWVELQWEDRVTQRVFstcfdpmeivf
mgnllssflsspESFRSILSYVGGEAKYVWALQVNLDALQAELDKLIRTKDDLLNKVElveqqqprarrtnqvkgwlqrVQETVtkvvdlqnvrdqelDRLCLGGFCSKDLASSYYFGKKVVTLTEQVILLKNERGEIKDIAEMVPEDAAVELALERTVVGQESMLDQVWRCITdqeknrgiiglygtggvgKTTLLKQVNNKFCIEQRQHHFDVVIWgvvsrepkldkiqDAIGKRIGLSAESWMDKSLEEKALDISNILSRKKFVLLLDDIWQPIDLTELGiplqslnvsskVVFTTRSLDVCGSMEADEKIEVKYLVHDEAWRLFQEKVGEATLRCHSDILELAQTLARECCGLPLALKTIGRAMAYKKNPDEWKYATKVLStspekfsgMEENVFARLKFSYDSLPNYIIRSCFLYCSLFPEDYEVYKGDLIDYWTSEGFVDAFDEGYTIIGDLLRACLLEEVNDNHVKMHDVIRDMALWIACKIDKEEENFLVHAGallteapkikDWEGFKRISLMENNItslsaipncpHLRTLLLYRNRISMITDGFFQFMPSLKVLNLGFNIFLNKLPSGLSSLISLEHLDLSFTVIRELPEEMKALVNLRYLNLEYVYLNRLPLQLLCNFTKLQALRMLGCSNYSGEEEDRVFFKDAEPFMKELLCLENLDLLSFTFDSWHAFETFLTFQKLLSCTESLELTKLYTPMSLNVLPLAYMKHLKNFLIQNCAFEELKIENAVEIQNLVQRGFRSLHTVFISDCSRLKELTWLVFAPNLKNIDVQNCNNMEEIISPGKLSEVSEIKERQNFLAELKFLCLKDLENLESIYFDPLPFPQLKEIEVTGCPKLkklpldstramgHKIVVKGNIEWWVELQWEDRVTQRVFSTcfdpmeivf
MGNllssflsspesfrsILSYVGGEAKYVWALQVNLDALQAELDKLIRTKDDLLNKVELVEQQQPRARRTNQVKGWLQRVQETVTKVVDLQNVRDQELDRLCLGGFCSKDLASSYYFGKKVVTLTEQVILLKNERGEIKDIAEMVPEDAAVELALERTVVGQESMLDQVWRCITDQEKNRgiiglygtggvgkttllkQVNNKFCIEQRQHHFDVVIWGVVSREPKLDKIQDAIGKRIGLSAESWMDKSLEEKALDISNILSRKKFVLLLDDIWQPIDLTELGIPLQSLNVSSKVVFTTRSLDVCGSMEADEKIEVKYLVHDEAWRLFQEKVGEATLRCHSDILELAQTLARECCGLPLALKTIGRAMAYKKNPDEWKYATKVLSTSPEKFSGMEENVFARLKFSYDSLPNYIIRSCFLYCSLFPEDYEVYKGDLIDYWTSEGFVDAFDEGYTIIGDLLRACLLEEVNDNHVKMHDVIRDMALWIACKIDKEEENFLVHAGALLTEAPKIKDWEGFKRISLMENNITSLSAIPNCPHLRTLLLYRNRISMITDGFFQFMPSLKVLNLGFNIFLNKLPSGLSSLISLEHLDLSFTVIRELPEEMKALVNLRYLNLEYVYLNRLPLQLLCNFTKLQALRMLGCSNYSGEEEDRVFFKDAEPFMKEllclenldllSFTFDSWHAFETFLTFQKLLSCTESLELTKLYTPMSLNVLPLAYMKHLKNFLIQNCAFEELKIENAVEIQNLVQRGFRSLHTVFISDCSRLKELTWLVFAPNLKNIDVQNCNNMEEIISPGKLSEVSEIKERQNFLAELKFLCLKDLENLESIYFDPLPFPQLKEIEVTGCPKLKKLPLDSTRAMGHKIVVKGNIEWWVELQWEDRVTQRVFSTCFDPMEIVF
**************FRSILSYVGGEAKYVWALQVNLDALQAELDKLIRTKDDLLNKVELV**********NQVKGWLQRVQETVTKVVDLQNVRDQELDRLCLGGFCSKDLASSYYFGKKVVTLTEQVILLKNERGEIKDIAEMVPEDAAVELALERTVVGQESMLDQVWRCITDQEKNRGIIGLYGTGGVGKTTLLKQVNNKFCIEQRQHHFDVVIWGVVSREPKLDKIQDAIGKRIGLSAESWMDKSLEEKALDISNILSRKKFVLLLDDIWQPIDLTELGIPLQSLNVSSKVVFTTRSLDVCGSMEADEKIEVKYLVHDEAWRLFQEKVGEATLRCHSDILELAQTLARECCGLPLALKTIGRAMAYKKNPDEWKYATKVLST***KFSGMEENVFARLKFSYDSLPNYIIRSCFLYCSLFPEDYEVYKGDLIDYWTSEGFVDAFDEGYTIIGDLLRACLLEEVNDNHVKMHDVIRDMALWIACKIDKEEENFLVHAGALLTEAPKIKDWEGFKRISLMENNITSLSAIPNCPHLRTLLLYRNRISMITDGFFQFMPSLKVLNLGFNIFLNKLPSGLSSLISLEHLDLSFTVIRELPEEMKALVNLRYLNLEYVYLNRLPLQLLCNFTKLQALRMLGCSNYSGEEEDRVFFKDAEPFMKELLCLENLDLLSFTFDSWHAFETFLTFQKLLSCTESLELTKLYTPMSLNVLPLAYMKHLKNFLIQNCAFEELKIENAVEIQNLVQRGFRSLHTVFISDCSRLKELTWLVFAPNLKNIDVQNCNNMEEIISPGKLSEVSEIKERQNFLAELKFLCLKDLENLESIYFDPLPFPQLKEIEVTGCPKLKKLPLDSTRAMGHKIVVKGNIEWWVELQWEDRVTQRVFSTCFDPME***
MGNLLSSFLSSPESFRSILSYVGGEAKYVWALQVNLDALQAELDKLIRTKDDLLNKVELV**Q******TNQVKGWLQRVQETVTKVVDLQNVRDQELDRLCLGGFCSKDLASSYYFGKKVVTLTEQVILLK***************************VGQESMLDQVWRCITDQEKNRGIIGLYGTGGVGKTTLLKQVNNKFCIEQRQHHFDVVIWGVVSREPKLDKIQDAIGKRIGL*************ALDISNILSRKKFVLLLDDIWQPIDLTELGIPLQSLNVSSKVVFTTRSLDVCGSMEADEKIEVKYLVHDEAWRLFQEKVGEATLRCHSDILELAQTLARECCGLPLALKTIGRAMAYKKNPDEWKYATKVLS***********NVFARLKFSYDSLPNYIIRSCFLYCSLFPEDYEVYKGDLIDYWTSEGFVDAFDEGYTIIGDLLRACLLEEVNDNHVKMHDVIRDMALWIACKIDKEEENFLVHAGALLTEAPKIKDWEGFKRISLMENNITSLSAIPNCPHLRTLLLYRNRISMITDGFFQFMPSLKVLNLGFNIFLNKLPSGLSSLISLEHLDLSFTVIRELPEEMKALVNLRYLNLEYVYLNRLPLQLLCNFTKLQALRMLGCSNYSGEEEDRVFF****PFMKELLCLENLDLLSFTFDSWHAFETFLTFQKLLSCTESLELTKLYTPMSLNVLPLAYMKHLKNFLIQNCAFEELKIENAVEIQNLVQRGFRSLHTVFISDCSRLKELTWLVFAPNLKNIDVQNCNNMEEIISPGKLSEV*EIKE*QNFLAELKFLCLKDLENLESIYFDPLPFPQLKEIEVTGCPKLKKLPLD*********VVKGNIEWWVELQWEDRVTQRVFSTCFDPMEIVF
MGNLLSSFLSSPESFRSILSYVGGEAKYVWALQVNLDALQAELDKLIRTKDDLLNKVELVEQQQPRARRTNQVKGWLQRVQETVTKVVDLQNVRDQELDRLCLGGFCSKDLASSYYFGKKVVTLTEQVILLKNERGEIKDIAEMVPEDAAVELALERTVVGQESMLDQVWRCITDQEKNRGIIGLYGTGGVGKTTLLKQVNNKFCIEQRQHHFDVVIWGVVSREPKLDKIQDAIGKRIGLSAESWMDKSLEEKALDISNILSRKKFVLLLDDIWQPIDLTELGIPLQSLNVSSKVVFTTRSLDVCGSMEADEKIEVKYLVHDEAWRLFQEKVGEATLRCHSDILELAQTLARECCGLPLALKTIGRAMAYKKNPDEWKYATKVLSTSPEKFSGMEENVFARLKFSYDSLPNYIIRSCFLYCSLFPEDYEVYKGDLIDYWTSEGFVDAFDEGYTIIGDLLRACLLEEVNDNHVKMHDVIRDMALWIACKIDKEEENFLVHAGALLTEAPKIKDWEGFKRISLMENNITSLSAIPNCPHLRTLLLYRNRISMITDGFFQFMPSLKVLNLGFNIFLNKLPSGLSSLISLEHLDLSFTVIRELPEEMKALVNLRYLNLEYVYLNRLPLQLLCNFTKLQALRMLGCSNYSGEEEDRVFFKDAEPFMKELLCLENLDLLSFTFDSWHAFETFLTFQKLLSCTESLELTKLYTPMSLNVLPLAYMKHLKNFLIQNCAFEELKIENAVEIQNLVQRGFRSLHTVFISDCSRLKELTWLVFAPNLKNIDVQNCNNMEEIISPGKLSEVSEIKERQNFLAELKFLCLKDLENLESIYFDPLPFPQLKEIEVTGCPKLKKLPLDSTRAMGHKIVVKGNIEWWVELQWEDRVTQRVFSTCFDPMEIVF
*GNLLSSFLSSPESFRSILSYVGGEAKYVWALQVNLDALQAELDKLIRTKDDLLNKVELVEQQQPRARRTNQVKGWLQRVQETVTKVVDLQNVRDQELDRLCLGGFCSKDLASSYYFGKKVVTLTEQVILLKNERGEIKDIAEMVP*DAAVELALERTVVGQESMLDQVWRCITDQEKNRGIIGLYGTGGVGKTTLLKQVNNKFCIEQRQHHFDVVIWGVVSREPKLDKIQDAIGKRIGLSAESWMDKSLEEKALDISNILSRKKFVLLLDDIWQPIDLTELGIPLQSLNVSSKVVFTTRSLDVCGSMEADEKIEVKYLVHDEAWRLFQEKVGEATLRCHSDILELAQTLARECCGLPLALKTIGRAMAYKKNPDEWKYATKVLSTSPEKFSGMEENVFARLKFSYDSLPNYIIRSCFLYCSLFPEDYEVYKGDLIDYWTSEGFVDAFDEGYTIIGDLLRACLLEEVNDNHVKMHDVIRDMALWIACKIDKEEENFLVHAGALLTEAPKIKDWEGFKRISLMENNITSLSAIPNCPHLRTLLLYRNRISMITDGFFQFMPSLKVLNLGFNIFLNKLPSGLSSLISLEHLDLSFTVIRELPEEMKALVNLRYLNLEYVYLNRLPLQLLCNFTKLQALRMLGCSNYSGEEEDRVFFKDAEPFMKELLCLENLDLLSFTFDSWHAFETFLTFQKLLSCTESLELTKLYTPMSLNVLPLAYMKHLKNFLIQNCAFEELKIENAVEIQNLVQRGFRSLHTVFISDCSRLKELTWLVFAPNLKNIDVQNCNNMEEIISPGKLSEVSEIKERQNFLAELKFLCLKDLENLESIYFDPLPFPQLKEIEVTGCPKLKKLPLDSTRAMGHKIVVKGNIEWWVELQWEDRVTQRVFSTCFDPMEIVF
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGNLLSSFLSSPESFRSILSYVGGEAKYxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxQPRARRTNQVKGWLQRVQETVTKVVDLQNVRDQELDRLCLGGFCSKDLASSYYFGKKVVTLTEQVILLKNERGEIKDIAEMVPEDAAVELALERTVVGQESMLDQVWRCITDQEKNRGIIGLYGTGGVGKTTLLKQVNNKFCIEQRQHHFDVVIWGVVSREPKLDKIQDAIGKRIGLSAESWMDKSLEEKALDISNILSRKKFVLLLDDIWQPIDLTELGIPLQSLNVSSKVVFTTRSLDVCGSMEADEKIEVKYLVHDEAWRLFQEKVGEATLRCHSDILELAQTLARECCGLPLALKTIGRAMAYKKNPDEWKYATKVLSTSPEKFSGMEENVFARLKFSYDSLPNYIIRSCFLYCSLFPEDYEVYKGDLIDYWTSEGFVDAFDEGYTIIGDLLRACLLEEVNDNHVKMHDVIRDMALWIACKIDKEEENFLVHAGALLTEAPKIKDWEGFKRISLMENNITSLSAIPNCPHLRTLLLYRNRISMITDGFFQFMPSLKVLNLGFNIFLNKLPSGLSSLISLEHLDLSFTVIRELPEEMKALVNLRYLNLEYVYLNRLPLQLLCNFTKLQALRMLGCSNYSGEEEDRVFFKDAEPFMKELLCLENLDLLSFTFDSWHAFETFLTFQKLLSCTESLELTKLYTPMSLNVLPLAYMKHLKNFLIQNCAFEELKIENAVEIQNLVQRGFRSLHTVFISDCSRLKELTWLVFAPNLKNIDVQNCNNMEEIISPGKLSEVSEIKERQNFLAELKFLCLKDLENLESIYFDPLPFPQLKEIEVTGCPKLKKLPLDSTRAMGHKIVVKGNIEWWVELQWEDRVTQRVFSTCFDPMEIVF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query896 2.2.26 [Sep-21-2011]
Q8RXS5888 Probable disease resistan yes no 0.953 0.961 0.400 1e-173
P60838894 Probable disease resistan no no 0.960 0.963 0.413 1e-172
O64973889 Disease resistance protei no no 0.962 0.969 0.409 1e-171
Q8L3R3885 Disease resistance protei no no 0.966 0.978 0.407 1e-165
Q9C8T9898 Putative disease resistan no no 0.921 0.919 0.402 1e-164
O82484892 Putative disease resistan no no 0.963 0.967 0.388 1e-163
P60839884 Probable disease resistan no no 0.959 0.972 0.392 1e-158
Q9FLB4874 Putative disease resistan no no 0.954 0.978 0.384 1e-151
Q940K0889 Probable disease resistan no no 0.956 0.964 0.386 1e-150
O64789925 Probable disease resistan no no 0.921 0.892 0.391 1e-150
>sp|Q8RXS5|DRL40_ARATH Probable disease resistance protein At5g63020 OS=Arabidopsis thaliana GN=At5g63020 PE=2 SV=2 Back     alignment and function desciption
 Score =  610 bits (1573), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 360/899 (40%), Positives = 543/899 (60%), Gaps = 45/899 (5%)

Query: 1   MGNLLSSFLSSPESFRSILSYVGGEAKYVWALQVNLDALQAELDKLIRTKDDLLNKVELV 60
           MG  +S  +S  +  +++ S +     Y+  L+ NL ALQ  L+++ + ++DLL K+  +
Sbjct: 1   MGGCVSVSISCDQLTKNVCSCLNRNGDYIHGLEENLTALQRALEQIEQRREDLLRKI--L 58

Query: 61  EQQQPRARRTNQVKGWLQRVQETVTKVVDLQNVRDQELDRLCLGGFCSKDLASSYYFGKK 120
            +++   +R + V+GW+ +V+  V +V +L  +R  ++ RLCL GFCSK+L SSY +GK+
Sbjct: 59  SEERRGLQRLSVVQGWVSKVEAIVPRVNELVRMRSVQVQRLCLCGFCSKNLVSSYRYGKR 118

Query: 121 VVTLTEQVILLKNERGEIKDIAEMVPEDAAVELALERTVVGQESMLDQVWRCITDQEKNR 180
           V+ + E+V +L+ + G+   +AE V + A VE    R +V  + ML+  W  + + E   
Sbjct: 119 VMKMIEEVEVLRYQ-GDFAVVAERV-DAARVEERPTRPMVAMDPMLESAWNRLMEDEI-- 174

Query: 181 GIIGLYGTGGVGKTTLLKQVNNKFCIEQRQHHFDVVIWGVVSREPKLDKIQDAIGKRIGL 240
           GI+GL+G GGVGKTTLL  +NN+F   +    FD+VIW VVS+E ++ +IQD I +++  
Sbjct: 175 GILGLHGMGGVGKTTLLSHINNRF--SRVGGEFDIVIWIVVSKELQIQRIQDEIWEKLRS 232

Query: 241 SAESWMDKSLEEKALDISNILSRKKFVLLLDDIWQPIDLTELGIPLQSLNVSSKVVFTTR 300
             E W  K+ + KA +I N+L  K+FVLLLDDIW  +DLTE+G+P  S     K+VFTTR
Sbjct: 233 DNEKWKQKTEDIKASNIYNVLKHKRFVLLLDDIWSKVDLTEVGVPFPSRENGCKIVFTTR 292

Query: 301 SLDVCGSMEADEKIEVKYLVHDEAWRLFQEKVGEATLRCHSDILELAQTLARECCGLPLA 360
             ++CG M  D  +EV+ L  D+AW LF +KVGE TL  H +I  +A+T+A++C GLPLA
Sbjct: 293 LKEICGRMGVDSDMEVRCLAPDDAWDLFTKKVGEITLGSHPEIPTVARTVAKKCRGLPLA 352

Query: 361 LKTIGRAMAYKKNPDEWKYATKVLSTSPEKFSGMEENVFARLKFSYDSLPNYIIRSCFLY 420
           L  IG  MAYK+   EW+ A  VL++S  +FSGME+ +   LK+SYD+L +  ++ CF Y
Sbjct: 353 LNVIGETMAYKRTVQEWRSAIDVLTSSAAEFSGMEDEILPILKYSYDNLKSEQLKLCFQY 412

Query: 421 CSLFPEDYEVYKGDLIDYWTSEGFVD-----AFDEGYTIIGDLLRACLLEEVNDNHVKMH 475
           C+LFPED+ + K DL+DYW  EGF+D     A ++GY IIG L+R+CLL E N   VKMH
Sbjct: 413 CALFPEDHNIEKNDLVDYWIGEGFIDRNKGKAENQGYEIIGILVRSCLLMEENQETVKMH 472

Query: 476 DVIRDMALWIACKIDKEEENFLVHAGALLTEAPKIKDWEGFKRISLMENNITSLSAIPNC 535
           DV+R+MALWIA    K++ENF+V AG      P+I+ W+  +R+SLM NNI S+   P  
Sbjct: 473 DVVREMALWIASDFGKQKENFIVQAGLQSRNIPEIEKWKVARRVSLMFNNIESIRDAPES 532

Query: 536 PHLRTLLLYRNRISMITDGFFQFMPSLKVLNLGFNIFLNKLPSGLSSLISLEHLDLSFTV 595
           P L TLLL +N +  I+  FF+ MP L VL+L  N  L  LP+ +S  +SL++L LS T 
Sbjct: 533 PQLITLLLRKNFLGHISSSFFRLMPMLVVLDLSMNRDLRHLPNEISECVSLQYLSLSRTR 592

Query: 596 IRELPEEMKALVNLRYLNLEYVYLNRLPLQLLCNFTKLQALRMLGCSNYSGEEEDRVF-- 653
           IR  P  +  L  L YLNLEY  +    ++ +C  + L +L++L           R+F  
Sbjct: 593 IRIWPAGLVELRKLLYLNLEYTRM----VESICGISGLTSLKVL-----------RLFVS 637

Query: 654 -FKDAEPFMKELLCLENLDLLSFTFDSWHAFETFLTFQKLLSCTESLELTKLYTPMSLNV 712
            F +    + EL  LENL  L+ T       E FL+ Q+L SCT +L +  L  P S  +
Sbjct: 638 GFPEDPCVLNELQLLENLQTLTITLGLASILEQFLSNQRLASCTRALRIENL-NPQSSVI 696

Query: 713 LPLAYMKHLKNFLIQNCAFEELKIENAVEIQNL----VQRGFRSLHTVFISDCSRLKELT 768
             +A M  L+     +    E+K++    +  L        F +L  V +  C+RL++LT
Sbjct: 697 SFVATMDSLQELHFADSDIWEIKVKRNETVLPLHIPTTTTFFPNLSQVSLEFCTRLRDLT 756

Query: 769 WLVFAPNLKNIDVQNCNNMEEIISPGKLSEVSEIKERQNFLA--ELKFLCLKDLENLESI 826
           WL+FAPNL  + V + ++++E+I+        E  E+QN +   ELK L L++++ L+ I
Sbjct: 757 WLIFAPNLTVLRVISASDLKEVIN-------KEKAEQQNLIPFQELKELRLENVQMLKHI 809

Query: 827 YFDPLPFPQLKEIEVTGCPKLKKLPLDSTRAMGHKIVVKGNIEWWVELQWEDRVTQRVF 885
           +  PLPFP L++I V GC +L+KLPL+ T      +V++ + +W   L+WED  T+  F
Sbjct: 810 HRGPLPFPCLQKILVNGCSELRKLPLNFTSVPRGDLVIEAHKKWIEILEWEDEATKARF 868
Probable disease resistance protein.
Arabidopsis thaliana (taxid: 3702)
>sp|P60838|DRL1_ARATH Probable disease resistance protein At1g12280 OS=Arabidopsis thaliana GN=At1g12280 PE=3 SV=1 Back     alignment and function description
>sp|O64973|RPS5_ARATH Disease resistance protein RPS5 OS=Arabidopsis thaliana GN=RPS5 PE=1 SV=2 Back     alignment and function description
>sp|Q8L3R3|RFL1_ARATH Disease resistance protein RFL1 OS=Arabidopsis thaliana GN=RFL1 PE=3 SV=2 Back     alignment and function description
>sp|Q9C8T9|DRL19_ARATH Putative disease resistance protein At1g63350 OS=Arabidopsis thaliana GN=At1g63350 PE=2 SV=1 Back     alignment and function description
>sp|O82484|DRL23_ARATH Putative disease resistance protein At4g10780 OS=Arabidopsis thaliana GN=At4g10780 PE=2 SV=1 Back     alignment and function description
>sp|P60839|DRL2_ARATH Probable disease resistance protein At1g12290 OS=Arabidopsis thaliana GN=At1g12290 PE=2 SV=1 Back     alignment and function description
>sp|Q9FLB4|DRL31_ARATH Putative disease resistance protein At5g05400 OS=Arabidopsis thaliana GN=At5g05400 PE=2 SV=1 Back     alignment and function description
>sp|Q940K0|DRL15_ARATH Probable disease resistance protein At1g61180 OS=Arabidopsis thaliana GN=At1g61180 PE=2 SV=2 Back     alignment and function description
>sp|O64789|DRL18_ARATH Probable disease resistance protein At1g61310 OS=Arabidopsis thaliana GN=At1g61310 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query896
24461866890 NBS-LRR type disease resistance protein 0.979 0.986 0.507 0.0
24461861890 NBS-LRR type disease resistance protein 0.977 0.984 0.491 0.0
24461863889 NBS-LRR type disease resistance protein 0.972 0.979 0.479 0.0
24461864899 NBS-LRR type disease resistance protein 0.977 0.974 0.477 0.0
24461865892 NBS-LRR type disease resistance protein 0.979 0.984 0.49 0.0
225443158903 PREDICTED: probable disease resistance p 0.979 0.972 0.454 0.0
224055915880 cc-nbs-lrr resistance protein [Populus t 0.959 0.977 0.451 0.0
255553103910 Disease resistance protein RPS5, putativ 0.947 0.932 0.451 0.0
359482674991 PREDICTED: probable disease resistance p 0.960 0.868 0.446 0.0
359482672905 PREDICTED: probable disease resistance p 0.978 0.969 0.445 0.0
>gi|24461866|gb|AAN62353.1|AF506028_20 NBS-LRR type disease resistance protein [Citrus trifoliata] Back     alignment and taxonomy information
 Score =  830 bits (2143), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 457/901 (50%), Positives = 591/901 (65%), Gaps = 23/901 (2%)

Query: 1   MGNLLSSFLSSPESFRSILSYVGGEAKYVWALQVNLDALQAELDKLIRTKDDLLNKVELV 60
           MGN+    +     F   L ++  EAKY+  L+ NLD LQ +L++LI  KDD++N+VE+ 
Sbjct: 1   MGNVFGVQIPWSNIFPRCLDWILNEAKYISQLEDNLDDLQTKLEQLIEAKDDVMNRVEIA 60

Query: 61  EQQQPRARRTNQVKGWLQRVQETVTKVVDLQNVRDQELDRLCLGGFCSKDLASSYYFGKK 120
           E+QQ    R NQV+GW+ RV+    +   L  V  QE++RLCL G+CSK+  SSY FGKK
Sbjct: 61  ERQQ--MSRLNQVQGWVSRVEAVKAEADQLIRVGSQEIERLCLWGYCSKNCKSSYDFGKK 118

Query: 121 VVTLTEQVILLKNERGEIKDIAEMVPEDAAVELALERTVVGQESMLDQVWRCITDQEKNR 180
           V    + V  L  E G  + +AE VP  AA E   E TV+G +S L+QVWRC+   E+  
Sbjct: 119 VTKKLQLVETLMGE-GIFEVVAEKVPGAAATERPTEPTVIGLQSQLEQVWRCLV--EEPA 175

Query: 181 GIIGLYGTGGVGKTTLLKQVNNKFCIEQRQHHFDVVIWGVVSREPKLDKIQDAIGKRIGL 240
           GI+GLYG GGVGKTTLL  +NNKF   +   +F+ VIW VVS++ +L+ IQ+ IG++IGL
Sbjct: 176 GIVGLYGMGGVGKTTLLTHINNKFL--ESTTNFNYVIWVVVSKDLRLENIQETIGEKIGL 233

Query: 241 SAESWMDKSLEEKALDISNILSRKKFVLLLDDIWQPIDLTELGIPLQSLNVS-SKVVFTT 299
             ++W ++ +E+KALDI  IL  KKFVLLLDD+WQ +DL E+G+PL     S SKVVFT+
Sbjct: 234 LNDTWKNRRIEQKALDIFKILKEKKFVLLLDDLWQRVDLVEVGVPLPGPQSSTSKVVFTS 293

Query: 300 RSLDVCGSMEADEKIEVKYLVHDEAWRLFQEKVGEATLRCHSDILELAQTLARECCGLPL 359
           RS +VCG MEA +K +V  L   +AW LFQ+KVGE TL+   DI +LAQT A+EC GLPL
Sbjct: 294 RSEEVCGLMEAHKKFKVACLSDIDAWELFQQKVGEETLK-SPDIRQLAQTAAKECGGLPL 352

Query: 360 ALKTIGRAMAYKKNPDEWKYATKVLSTSPEKFSGMEENVFARLKFSYDSLPNYIIRSCFL 419
           AL TIGRAMA KK P+EW YA +VL TS  +F G+   V+  LKFSYDSLP+  IRSC L
Sbjct: 353 ALITIGRAMACKKTPEEWTYAIEVLRTSSSQFPGLGNEVYPLLKFSYDSLPSDTIRSCLL 412

Query: 420 YCSLFPEDYEVYKGDLIDYWTSEGFV---DAFDE---GYTIIGDLLRACLLEEVNDNHVK 473
           YC L+PEDY + K  LID W  EGF+   D F E   GY I+G LL ACLLEE  D  VK
Sbjct: 413 YCCLYPEDYCISKEILIDCWIGEGFLTERDRFGEQNQGYHILGILLHACLLEEGGDGEVK 472

Query: 474 MHDVIRDMALWIACKIDKEEENFLVHAGALLTEAPKIKDWEGFKRISLMENNITSLSAIP 533
           MHDV+RDMALWIAC I+KE++NFLV+AG  L EAP +  WE  +R+SLM N IT+LS + 
Sbjct: 473 MHDVVRDMALWIACAIEKEKDNFLVYAGVGLIEAPDVSGWEKARRLSLMHNQITNLSEVA 532

Query: 534 NCPHLRTLLLYRNRISMITDGFFQFMPSLKVLNLGFNIFLNKLPSGLSSLISLEHLDLSF 593
            CPHL TL L  N + MI + FF+FMPSLKVLNL  +  L  LP G+S L+SL+HLDLS 
Sbjct: 533 TCPHLLTLFLNENELQMIHNDFFRFMPSLKVLNLA-DSSLTNLPEGISKLVSLQHLDLSK 591

Query: 594 TVIRELPEEMKALVNLRYLNLEYVY-LNRLPLQLLCNFTKLQALRMLGCSN--YSGEEED 650
           + I ELP E+KALVNL+ LNLEY + L  +P QL+ N ++L  LRM   S+  +    ED
Sbjct: 592 SSIEELPLELKALVNLKCLNLEYTWSLTTIPRQLISNLSRLHVLRMFAASHSAFDRASED 651

Query: 651 RVFFKDAEPFMKELLCLENLDLLSFTFDSWHAFETFLTFQKLLSCTESLELTKLYTPMSL 710
            + F   E  ++ELL L+ L+++SFT  S H  ++FL+  KL SCT +L L       SL
Sbjct: 652 SILFGGGELIVEELLGLKYLEVISFTLRSSHGLQSFLSSHKLRSCTRALLLQCFNDSTSL 711

Query: 711 NVLPLAYMKHLKNFLIQNC-AFEELKIENAVEIQNLVQRGFRSLHTVFISDCSRLKELTW 769
            V  LA +K L    I  C   EELK++   E+Q  V   F SL  V I  CS+LK+LT+
Sbjct: 712 EVSALADLKQLNRLWITECKKLEELKMDYTREVQQFV---FHSLKKVEILACSKLKDLTF 768

Query: 770 LVFAPNLKNIDVQNCNNMEEIISPGKLSEVSEIKERQNFLAELKFLCLKDLENLESIYFD 829
           LVFAPNL++I++  C  MEE++S GK +EV E+    N  A+L+ L L    NL+SIY+ 
Sbjct: 769 LVFAPNLESIELMGCPAMEEMVSMGKFAEVPEVVANLNPFAKLQNLKLFGATNLKSIYWK 828

Query: 830 PLPFPQLKEIEVTGCPKLKKLPLDSTRAMGHKIVVKGNIEWWVELQWEDRVTQRVFSTCF 889
           PLPFP LK +  + C KLKKLPLDS  A    IV+ G   WW +L+W D  T+  F  CF
Sbjct: 829 PLPFPHLKSMSFSHCYKLKKLPLDSNSARERNIVISGTRRWWEQLEWVDEATRNAFLPCF 888

Query: 890 D 890
           D
Sbjct: 889 D 889

Source: Citrus trifoliata

Species: Citrus trifoliata

Genus: Citrus

Family: Rutaceae

Order: Sapindales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|24461861|gb|AAN62348.1|AF506028_15 NBS-LRR type disease resistance protein [Citrus trifoliata] Back     alignment and taxonomy information
>gi|24461863|gb|AAN62350.1|AF506028_17 NBS-LRR type disease resistance protein [Citrus trifoliata] Back     alignment and taxonomy information
>gi|24461864|gb|AAN62351.1|AF506028_18 NBS-LRR type disease resistance protein [Citrus trifoliata] Back     alignment and taxonomy information
>gi|24461865|gb|AAN62352.1|AF506028_19 NBS-LRR type disease resistance protein [Citrus trifoliata] Back     alignment and taxonomy information
>gi|225443158|ref|XP_002263674.1| PREDICTED: probable disease resistance protein At5g63020-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224055915|ref|XP_002298700.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222845958|gb|EEE83505.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255553103|ref|XP_002517594.1| Disease resistance protein RPS5, putative [Ricinus communis] gi|223543226|gb|EEF44758.1| Disease resistance protein RPS5, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|359482674|ref|XP_002281708.2| PREDICTED: probable disease resistance protein At1g12280-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359482672|ref|XP_003632805.1| PREDICTED: probable disease resistance protein At1g12280-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query896
TAIR|locus:2034770894 SUMM2 "AT1G12280" [Arabidopsis 0.934 0.936 0.405 5.5e-157
TAIR|locus:2166320888 AT5G63020 [Arabidopsis thalian 0.936 0.944 0.387 5.8e-153
TAIR|locus:2201986885 RFL1 "AT1G12210" [Arabidopsis 0.936 0.948 0.397 1e-148
TAIR|locus:2201996889 RPS5 "AT1G12220" [Arabidopsis 0.931 0.939 0.399 2.1e-148
TAIR|locus:2034765884 AT1G12290 [Arabidopsis thalian 0.929 0.942 0.382 7.3e-146
TAIR|locus:2132741892 AT4G10780 [Arabidopsis thalian 0.933 0.937 0.378 3.2e-145
TAIR|locus:2031366898 AT1G63350 "AT1G63350" [Arabido 0.926 0.924 0.379 3.3e-143
TAIR|locus:2008440899 AT1G61180 [Arabidopsis thalian 0.934 0.931 0.373 2.8e-137
TAIR|locus:2008510967 AT1G61190 "AT1G61190" [Arabido 0.959 0.889 0.365 4.4e-132
TAIR|locus:2153474874 AT5G05400 [Arabidopsis thalian 0.912 0.935 0.376 1.9e-131
TAIR|locus:2034770 SUMM2 "AT1G12280" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1530 (543.6 bits), Expect = 5.5e-157, P = 5.5e-157
 Identities = 356/879 (40%), Positives = 509/879 (57%)

Query:    28 YVWALQVNLDALQAELDKLIRTKDDLLNKVELVEQQQPRARRTNQVKGWLQRVQETVTKV 87
             Y+  L  N+ A++ +++ L + +DD+  +V+ +E+   R  R +QV+GWL  V     K 
Sbjct:    28 YICELSKNVVAMKKDMEVLKKKRDDVKRRVD-IEEFTRRRERLSQVQGWLTNVSTVENKF 86

Query:    88 VDLQNVRDQELDRLCLGGFCSKDLASSYYFGKKVVTLTEQVILLKNERGEIKDIAEMVPE 147
              +L    D EL RLCL GFCSK++  SY +GK+VV + +++  L ++ G+   +    P 
Sbjct:    87 NELLTTNDAELQRLCLFGFCSKNVKMSYLYGKRVVLMLKEIESLSSQ-GDFDTVTLATPI 145

Query:   148 DAAVELALERTVVGQESMLDQVWRCITDQEKNRXXXXXXXXXXXXXXXXXXQVNNKFCIE 207
                 E+ ++ T+VGQE+ML++VW  +T  E                     ++NNKF   
Sbjct:   146 ARIEEMPIQPTIVGQETMLERVWTRLT--EDGDEIVGLYGMGGVGKTTLLTRINNKF--S 201

Query:   208 QRQHHFDVVIWGVVSREPKLDKIQDAIGKRIGLSAESWMDKSLEEKALDISNILSRKKFV 267
             ++   F VVIW VVS+ P + +IQ  IGKR+ L  E W + +  ++ALDI N+L ++KFV
Sbjct:   202 EKCSGFGVVIWVVVSKSPDIHRIQGDIGKRLDLGGEEWDNVNENQRALDIYNVLGKQKFV 261

Query:   268 LLLDDIWQPIDLTELGIPLQSLNVSSKVVFTTRSLDVCGSMEADEKIEVKYLVHDEAWRL 327
             LLLDDIW+ ++L  LG+P  S     KVVFTTRS DVCG M  D+ +EV  L  +EAW L
Sbjct:   262 LLLDDIWEKVNLEVLGVPYPSRQNGCKVVFTTRSRDVCGRMRVDDPMEVSCLEPNEAWEL 321

Query:   328 FQEKVGEATLRCHSDILELAQTLARECCGLPLALKTIGRAMAYKKNPDEWKYATKVLSTS 387
             FQ KVGE TL+ H DI ELA+ +A +CCGLPLAL  IG  MA K+   EW+ A  VLS+ 
Sbjct:   322 FQMKVGENTLKGHPDIPELARKVAGKCCGLPLALNVIGETMACKRMVQEWRNAIDVLSSY 381

Query:   388 PEKFSGMEENVFARLKFSYDSLPNYIIRSCFLYCSLFPEDYEVYKGDLIDYWTSEGFVD- 446
               +F GME+ +   LK+SYD+L    ++ CFLYCSLFPEDY + K  LIDYW  EGF+D 
Sbjct:   382 AAEFPGMEQ-ILPILKYSYDNLNKEQVKPCFLYCSLFPEDYRMEKERLIDYWICEGFIDE 440

Query:   447 ------AFDEGYTIIGDLLRACLL--EEVNDNHVKMHDVIRDMALWIACKIDKEEENFLV 498
                   A  +GY IIG L+RACLL  E +N   VKMHDV+R+MALWIA  + + +E  +V
Sbjct:   441 NESRERALSQGYEIIGILVRACLLLEEAINKEQVKMHDVVREMALWIASDLGEHKERCIV 500

Query:   499 HAGALLTEAPKIKDWEGFKRISLMENNITSLSAIPNCPHLRTLLLYRN-RISMITDGFFQ 557
               G  L E PK+K+W   +R+SLMEN I  LS  P C  L TL L +N  +  I+D FF+
Sbjct:   501 QVGVGLREVPKVKNWSSVRRMSLMENEIEILSGSPECLELTTLFLQKNDSLLHISDEFFR 560

Query:   558 FMPSLKVLNLGFNIFLNKLPSGLSSLISLEHLDLSFTVIRELPEEMKALVNLRYLNLEYV 617
              +P L VL+L  N  L KLP+ +S L+SL +LDLS+T I+ LP  ++ L  LRYL L+Y 
Sbjct:   561 CIPMLVVLDLSGNSSLRKLPNQISKLVSLRYLDLSWTYIKRLPVGLQELKKLRYLRLDY- 619

Query:   618 YLNRLP-LQLLCNFTKLQALRMLGCSNYSGEEEDRVFFKDAEPFMKEXXXXXXXXXXSFT 676
              + RL  +  + N + L+ L++L  S  S +             ++E          + +
Sbjct:   620 -MKRLKSISGISNISSLRKLQLLQ-SKMSLDMS----------LVEELQLLEHLEVLNIS 667

Query:   677 FDSWHAFETFLTFQKLLSCTESLELTKLYTPMSLNVLPLAYMKHLKNFLIQNCAFEELKI 736
               S    E  L   +L+ C + L L  +    S  VL L  M +L   +I+ C   E+KI
Sbjct:   668 IKSSLVVEKLLNAPRLVKCLQILVLRGVQEESS-GVLTLPDMDNLNKVIIRKCGMCEIKI 726

Query:   737 EN---AVEIQNLVQRGF-RSLHTVFISDCSRLKELTWLVFAPNLKNIDVQNCNNMEEIIS 792
             E    ++      +  F  +L TV IS C  LK+LTWL+FAPNL +++V +   +E II+
Sbjct:   727 ERKTLSLSSNRSPKTQFLHNLSTVHISSCDGLKDLTWLLFAPNLTSLEVLDSELVEGIIN 786

Query:   793 PGKLSEVSEIKERQNFLAELKFLCLKDLENLESIYFDPLPFPQLKEIEVTGCPKLKKLPL 852
               K   +S I   Q    +L+ L L +L  L SIY+ PL FP LK I +T CP+L+KLPL
Sbjct:   787 QEKAMTMSGIIPFQ----KLESLRLHNLAMLRSIYWQPLSFPCLKTIHITKCPELRKLPL 842

Query:   853 DSTRAM-GHKIVVKGNIEWWVE-LQWEDRVTQRVFSTCF 889
             DS  A+   ++V+K   E W+E ++W++  T+  F   F
Sbjct:   843 DSEIAIRDEELVIKYQEEEWLERVEWDNEATRLRFLPFF 881
GO:0006952 "defense response" evidence=IGI;ISS
GO:0043531 "ADP binding" evidence=IEA
TAIR|locus:2166320 AT5G63020 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2201986 RFL1 "AT1G12210" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2201996 RPS5 "AT1G12220" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2034765 AT1G12290 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2132741 AT4G10780 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2031366 AT1G63350 "AT1G63350" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2008440 AT1G61180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2008510 AT1G61190 "AT1G61190" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2153474 AT5G05400 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8RXS5DRL40_ARATHNo assigned EC number0.40040.95310.9617yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
fgenesh4_pm.C_LG_I001004
cc-nbs-lrr resistance protein (880 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query896
pfam00931285 pfam00931, NB-ARC, NB-ARC domain 2e-88
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 4e-09
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 5e-08
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-06
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 9e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-04
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-04
pfam13191154 pfam13191, AAA_16, AAA ATPase domain 5e-04
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 0.002
>gnl|CDD|216202 pfam00931, NB-ARC, NB-ARC domain Back     alignment and domain information 
 Score =  282 bits (723), Expect = 2e-88
 Identities = 110/290 (37%), Positives = 166/290 (57%), Gaps = 6/290 (2%)

Query: 162 QESMLDQVWRCITDQEKNRGIIGLYGTGGVGKTTLLKQVNNKFCIEQRQHHFDVVIWGVV 221
           +E M++ +   + +   N G++G+ G GGVGKTTL KQ+ N   +     HFD V W VV
Sbjct: 1   REDMIEALIEKLLEMSDNLGVVGIVGMGGVGKTTLAKQIYNDDSV---GGHFDSVAWVVV 57

Query: 222 SREPKLDKIQDAIGKRIGLSAESWMDKSLEEKALDISNILSRKKFVLLLDDIWQPIDLTE 281
           S+     ++Q  I + +GL    W++K+  E A+ I   L RK+F+L+LDD+W+  D  +
Sbjct: 58  SKTYTEFRLQKDILQELGLDDSDWVEKNESELAVKIKEALLRKRFLLVLDDVWEKNDWDK 117

Query: 282 LGIPLQSLNVSSKVVFTTRSLDVCGSM-EADEKIEVKYLVHDEAWRLFQEKVGEATLRCH 340
           +G+P       S+V+ TTRS  V G M    +  EV+ L  +E+W LF  KV E  L   
Sbjct: 118 IGVPFPDGENGSRVIVTTRSESVAGRMGGTSKPHEVESLEPEESWELFSNKVFEKELPPC 177

Query: 341 SDILELAQTLARECCGLPLALKTIGRAMAYKKNPDEWKYATKVLSTSPEKFSGMEENVFA 400
            ++ E+A+ +  +C GLPLALK +G  +A+K    EW++  + L+       G+ E V +
Sbjct: 178 PELEEVAKEIVEKCKGLPLALKVLGGLLAFKSTVQEWEHVLEQLNNELAGRDGLNE-VLS 236

Query: 401 RLKFSYDSLPNYIIRSCFLYCSLFPEDYEVYKGDLIDYWTSEGFVDAFDE 450
            L  SYD+LP + ++ CFLY +LFPEDY + K  LI  W +EGFV   D 
Sbjct: 237 ILSLSYDNLPMH-LKRCFLYLALFPEDYNIRKEQLIKLWIAEGFVIPSDI 285

Length = 285
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|221970 pfam13191, AAA_16, AAA ATPase domain Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 896
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 100.0
PLN03210 1153 Resistant to P. syringae 6; Provisional 100.0
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.83
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.82
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.81
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.81
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.77
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.77
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.77
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.64
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.51
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.46
KOG0617264 consensus Ras suppressor protein (contains leucine 99.45
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.43
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.39
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.36
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.36
PRK04841 903 transcriptional regulator MalT; Provisional 99.36
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.35
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.33
KOG0617264 consensus Ras suppressor protein (contains leucine 99.3
PRK00411394 cdc6 cell division control protein 6; Reviewed 99.3
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 99.23
TIGR02928365 orc1/cdc6 family replication initiation protein. M 99.19
KOG4237498 consensus Extracellular matrix protein slit, conta 99.17
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 99.12
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 99.09
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 99.09
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 99.06
PF05729166 NACHT: NACHT domain 99.0
KOG4237498 consensus Extracellular matrix protein slit, conta 98.97
KOG4341483 consensus F-box protein containing LRR [General fu 98.93
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.92
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.9
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.86
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.86
PRK06893229 DNA replication initiation factor; Validated 98.76
PTZ001121164 origin recognition complex 1 protein; Provisional 98.71
COG3903414 Predicted ATPase [General function prediction only 98.62
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 98.6
COG3899849 Predicted ATPase [General function prediction only 98.59
PRK13342413 recombination factor protein RarA; Reviewed 98.59
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.58
PRK04195482 replication factor C large subunit; Provisional 98.58
PRK07003830 DNA polymerase III subunits gamma and tau; Validat 98.56
KOG4341483 consensus F-box protein containing LRR [General fu 98.56
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.56
COG2256436 MGS1 ATPase related to the helicase subunit of the 98.55
PTZ00202550 tuzin; Provisional 98.55
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.52
PF13173128 AAA_14: AAA domain 98.51
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 98.47
TIGR02903615 spore_lon_C ATP-dependent protease, Lon family. Me 98.47
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 98.47
PRK12402337 replication factor C small subunit 2; Reviewed 98.47
PRK05564313 DNA polymerase III subunit delta'; Validated 98.45
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 98.44
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 98.42
PRK08727233 hypothetical protein; Validated 98.41
PRK12323700 DNA polymerase III subunits gamma and tau; Provisi 98.4
PRK14960702 DNA polymerase III subunits gamma and tau; Provisi 98.39
PRK14963504 DNA polymerase III subunits gamma and tau; Provisi 98.38
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.35
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.34
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 98.34
cd01128249 rho_factor Transcription termination factor rho is 98.33
PLN03025319 replication factor C subunit; Provisional 98.33
PRK00440319 rfc replication factor C small subunit; Reviewed 98.33
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 98.32
PRK14962472 DNA polymerase III subunits gamma and tau; Provisi 98.32
PRK08084235 DNA replication initiation factor; Provisional 98.31
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.29
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.29
PRK08691709 DNA polymerase III subunits gamma and tau; Validat 98.25
PRK14956484 DNA polymerase III subunits gamma and tau; Provisi 98.24
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 98.23
PRK08903227 DnaA regulatory inactivator Hda; Validated 98.23
KOG2028554 consensus ATPase related to the helicase subunit o 98.22
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 98.22
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 98.22
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.21
PRK13341725 recombination factor protein RarA/unknown domain f 98.21
PRK06645507 DNA polymerase III subunits gamma and tau; Validat 98.2
PRK14957546 DNA polymerase III subunits gamma and tau; Provisi 98.2
PRK07471365 DNA polymerase III subunit delta'; Validated 98.2
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 98.19
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.19
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.17
PRK09376416 rho transcription termination factor Rho; Provisio 98.17
PRK14958509 DNA polymerase III subunits gamma and tau; Provisi 98.16
PRK05642234 DNA replication initiation factor; Validated 98.16
PRK14951618 DNA polymerase III subunits gamma and tau; Provisi 98.15
PLN03150623 hypothetical protein; Provisional 98.14
PRK07994647 DNA polymerase III subunits gamma and tau; Validat 98.14
PRK09087226 hypothetical protein; Validated 98.14
PRK09112351 DNA polymerase III subunit delta'; Validated 98.13
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 98.13
PRK14964491 DNA polymerase III subunits gamma and tau; Provisi 98.12
PRK07940394 DNA polymerase III subunit delta'; Validated 98.11
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.09
PF14516331 AAA_35: AAA-like domain 98.07
PRK14087450 dnaA chromosomal replication initiation protein; P 98.05
PRK05896605 DNA polymerase III subunits gamma and tau; Validat 98.04
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 98.03
PRK11331459 5-methylcytosine-specific restriction enzyme subun 98.03
TIGR00767415 rho transcription termination factor Rho. Members 98.0
PLN03150623 hypothetical protein; Provisional 98.0
PRK14969527 DNA polymerase III subunits gamma and tau; Provisi 98.0
PRK14959624 DNA polymerase III subunits gamma and tau; Provisi 97.99
PRK14970367 DNA polymerase III subunits gamma and tau; Provisi 97.99
PRK14954620 DNA polymerase III subunits gamma and tau; Provisi 97.98
PRK09111598 DNA polymerase III subunits gamma and tau; Validat 97.98
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.96
KOG2227529 consensus Pre-initiation complex, subunit CDC6, AA 97.95
PRK03992389 proteasome-activating nucleotidase; Provisional 97.94
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 97.92
PRK14952584 DNA polymerase III subunits gamma and tau; Provisi 97.9
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 97.9
PRK07764824 DNA polymerase III subunits gamma and tau; Validat 97.89
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 97.88
PRK08451535 DNA polymerase III subunits gamma and tau; Validat 97.88
TIGR00362405 DnaA chromosomal replication initiator protein Dna 97.88
PRK14950585 DNA polymerase III subunits gamma and tau; Provisi 97.88
PRK14088440 dnaA chromosomal replication initiation protein; P 97.88
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.87
PRK00149450 dnaA chromosomal replication initiation protein; R 97.86
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 97.86
CHL00181287 cbbX CbbX; Provisional 97.85
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 97.85
KOG2543438 consensus Origin recognition complex, subunit 5 [R 97.85
PRK07133725 DNA polymerase III subunits gamma and tau; Validat 97.85
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 97.85
PRK06620214 hypothetical protein; Validated 97.82
KOG0989346 consensus Replication factor C, subunit RFC4 [Repl 97.82
PRK14971614 DNA polymerase III subunits gamma and tau; Provisi 97.82
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 97.81
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.81
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 97.8
TIGR00763775 lon ATP-dependent protease La. This protein is ind 97.8
PRK06305451 DNA polymerase III subunits gamma and tau; Validat 97.79
PRK14953486 DNA polymerase III subunits gamma and tau; Provisi 97.77
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.75
PHA02544316 44 clamp loader, small subunit; Provisional 97.75
PRK14948620 DNA polymerase III subunits gamma and tau; Provisi 97.73
PRK14086617 dnaA chromosomal replication initiation protein; P 97.72
PRK15386426 type III secretion protein GogB; Provisional 97.69
PRK06647563 DNA polymerase III subunits gamma and tau; Validat 97.68
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 97.68
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 97.68
PRK15386426 type III secretion protein GogB; Provisional 97.68
CHL00095821 clpC Clp protease ATP binding subunit 97.67
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.65
COG3267269 ExeA Type II secretory pathway, component ExeA (pr 97.64
PRK05707328 DNA polymerase III subunit delta'; Validated 97.64
PRK10865857 protein disaggregation chaperone; Provisional 97.6
PRK05563559 DNA polymerase III subunits gamma and tau; Validat 97.59
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.58
COG0593408 DnaA ATPase involved in DNA replication initiation 97.58
PRK12422445 chromosomal replication initiation protein; Provis 97.54
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 97.52
PRK10787784 DNA-binding ATP-dependent protease La; Provisional 97.52
PRK14965576 DNA polymerase III subunits gamma and tau; Provisi 97.52
PRK07399314 DNA polymerase III subunit delta'; Validated 97.52
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.51
TIGR01241495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 97.49
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 97.47
PF00004132 AAA: ATPase family associated with various cellula 97.47
COG0466782 Lon ATP-dependent Lon protease, bacterial type [Po 97.45
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 97.44
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 97.42
smart00382148 AAA ATPases associated with a variety of cellular 97.41
COG2255332 RuvB Holliday junction resolvasome, helicase subun 97.4
PF05673249 DUF815: Protein of unknown function (DUF815); Inte 97.39
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.33
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.31
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.31
PRK10536262 hypothetical protein; Provisional 97.31
CHL00176638 ftsH cell division protein; Validated 97.29
COG1373398 Predicted ATPase (AAA+ superfamily) [General funct 97.28
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 97.26
PRK08116268 hypothetical protein; Validated 97.25
PRK08769319 DNA polymerase III subunit delta'; Validated 97.22
PRK12608380 transcription termination factor Rho; Provisional 97.22
PRK08118167 topology modulation protein; Reviewed 97.2
PRK08058329 DNA polymerase III subunit delta'; Validated 97.18
PF10443431 RNA12: RNA12 protein; InterPro: IPR018850 Mitochon 97.16
PRK07261171 topology modulation protein; Provisional 97.16
TIGR00602637 rad24 checkpoint protein rad24. This family is bas 97.14
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 97.14
KOG1514767 consensus Origin recognition complex, subunit 1, a 97.13
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.07
PRK06871325 DNA polymerase III subunit delta'; Validated 97.07
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 97.05
KOG0741744 consensus AAA+-type ATPase [Posttranslational modi 97.04
PRK08181269 transposase; Validated 97.03
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 97.01
PF04665241 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 97.01
PRK06090319 DNA polymerase III subunit delta'; Validated 96.99
KOG2004906 consensus Mitochondrial ATP-dependent protease PIM 96.95
COG0542786 clpA ATP-binding subunits of Clp protease and DnaK 96.94
PRK12377248 putative replication protein; Provisional 96.88
PRK06526254 transposase; Provisional 96.86
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.86
COG1223368 Predicted ATPase (AAA+ superfamily) [General funct 96.85
CHL00195489 ycf46 Ycf46; Provisional 96.85
PRK06964342 DNA polymerase III subunit delta'; Validated 96.85
CHL00095821 clpC Clp protease ATP binding subunit 96.84
PRK09361225 radB DNA repair and recombination protein RadB; Pr 96.83
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 96.8
PRK08939306 primosomal protein DnaI; Reviewed 96.77
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 96.76
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 96.75
PRK04296190 thymidine kinase; Provisional 96.75
PRK10865857 protein disaggregation chaperone; Provisional 96.74
KOG0733802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 96.72
PRK07993334 DNA polymerase III subunit delta'; Validated 96.72
KOG0991333 consensus Replication factor C, subunit RFC2 [Repl 96.72
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 96.72
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 96.71
cd01393226 recA_like RecA is a bacterial enzyme which has rol 96.71
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 96.69
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 96.67
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 96.66
PRK09183259 transposase/IS protein; Provisional 96.64
KOG0735952 consensus AAA+-type ATPase [Posttranslational modi 96.64
COG2812515 DnaX DNA polymerase III, gamma/tau subunits [DNA r 96.63
COG0470325 HolB ATPase involved in DNA replication [DNA repli 96.63
TIGR02237209 recomb_radB DNA repair and recombination protein R 96.63
PF08423256 Rad51: Rad51; InterPro: IPR013632 This domain is f 96.61
PRK07952244 DNA replication protein DnaC; Validated 96.59
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 96.58
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 96.58
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 96.57
cd01394218 radB RadB. The archaeal protein radB shares simila 96.57
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r 96.51
PRK06835329 DNA replication protein DnaC; Validated 96.5
TIGR02012321 tigrfam_recA protein RecA. This model describes or 96.48
KOG1969877 consensus DNA replication checkpoint protein CHL12 96.48
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 96.48
PRK06921266 hypothetical protein; Provisional 96.47
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 96.46
PRK04132846 replication factor C small subunit; Provisional 96.42
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 96.39
PRK09354349 recA recombinase A; Provisional 96.39
cd00983325 recA RecA is a bacterial enzyme which has roles in 96.38
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.37
COG2884223 FtsE Predicted ATPase involved in cell division [C 96.35
COG1875436 NYN ribonuclease and ATPase of PhoH family domains 96.34
PF07693325 KAP_NTPase: KAP family P-loop domain; InterPro: IP 96.33
PRK06696223 uridine kinase; Validated 96.31
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 96.28
PRK05541176 adenylylsulfate kinase; Provisional 96.28
cd00561159 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B 96.27
COG1484254 DnaC DNA replication protein [DNA replication, rec 96.23
TIGR02238313 recomb_DMC1 meiotic recombinase Dmc1. This model d 96.23
cd03115173 SRP The signal recognition particle (SRP) mediates 96.22
KOG2228408 consensus Origin recognition complex, subunit 4 [R 96.22
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.21
PRK00771437 signal recognition particle protein Srp54; Provisi 96.2
cd01133274 F1-ATPase_beta F1 ATP synthase beta subunit, nucle 96.19
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 96.19
COG0542786 clpA ATP-binding subunits of Clp protease and DnaK 96.16
PRK15455644 PrkA family serine protein kinase; Provisional 96.16
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.14
PRK08699325 DNA polymerase III subunit delta'; Validated 96.13
COG1102179 Cmk Cytidylate kinase [Nucleotide transport and me 96.09
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 96.09
TIGR03877237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 96.08
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 96.07
PRK10733644 hflB ATP-dependent metalloprotease; Reviewed 96.07
COG4608268 AppF ABC-type oligopeptide transport system, ATPas 96.07
KOG0736953 consensus Peroxisome assembly factor 2 containing 96.03
COG1618179 Predicted nucleotide kinase [Nucleotide transport 96.02
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 95.99
PRK04301317 radA DNA repair and recombination protein RadA; Va 95.99
PLN03186342 DNA repair protein RAD51 homolog; Provisional 95.96
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 95.96
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 95.95
PRK06067234 flagellar accessory protein FlaH; Validated 95.95
PRK07667193 uridine kinase; Provisional 95.95
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 95.94
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 95.94
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 95.94
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 95.93
cd03216163 ABC_Carb_Monos_I This family represents the domain 95.92
PRK10867433 signal recognition particle protein; Provisional 95.91
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 95.88
PLN03187344 meiotic recombination protein DMC1 homolog; Provis 95.88
KOG0730693 consensus AAA+-type ATPase [Posttranslational modi 95.87
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 95.86
cd03246173 ABCC_Protease_Secretion This family represents the 95.85
TIGR00959428 ffh signal recognition particle protein. This mode 95.84
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 95.83
PRK13531498 regulatory ATPase RavA; Provisional 95.82
TIGR00064272 ftsY signal recognition particle-docking protein F 95.81
PF03308266 ArgK: ArgK protein; InterPro: IPR005129 Bacterial 95.77
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 95.76
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 95.75
TIGR03881229 KaiC_arch_4 KaiC domain protein, PAE1156 family. M 95.74
PTZ00035337 Rad51 protein; Provisional 95.74
KOG0733802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 95.73
PLN00020413 ribulose bisphosphate carboxylase/oxygenase activa 95.7
TIGR01650327 PD_CobS cobaltochelatase, CobS subunit. This model 95.7
KOG0734752 consensus AAA+-type ATPase containing the peptidas 95.67
COG1703323 ArgK Putative periplasmic protein kinase ArgK and 95.66
PRK06547172 hypothetical protein; Provisional 95.63
TIGR02239316 recomb_RAD51 DNA repair protein RAD51. This eukary 95.62
PRK14974336 cell division protein FtsY; Provisional 95.59
TIGR02236310 recomb_radA DNA repair and recombination protein R 95.58
PF00485194 PRK: Phosphoribulokinase / Uridine kinase family; 95.58
PRK04328249 hypothetical protein; Provisional 95.57
COG1066456 Sms Predicted ATP-dependent serine protease [Postt 95.57
KOG0744423 consensus AAA+-type ATPase [Posttranslational modi 95.56
TIGR02858270 spore_III_AA stage III sporulation protein AA. Mem 95.56
COG1136226 SalX ABC-type antimicrobial peptide transport syst 95.54
PHA00729226 NTP-binding motif containing protein 95.53
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 95.53
PF00154322 RecA: recA bacterial DNA recombination protein; In 95.51
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 95.46
PRK10463290 hydrogenase nickel incorporation protein HypB; Pro 95.45
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 95.44
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 95.42
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 95.4
PTZ00494664 tuzin-like protein; Provisional 95.4
PTZ00301210 uridine kinase; Provisional 95.4
COG0572218 Udk Uridine kinase [Nucleotide transport and metab 95.38
KOG2123388 consensus Uncharacterized conserved protein [Funct 95.37
COG1126240 GlnQ ABC-type polar amino acid transport system, A 95.36
COG2607287 Predicted ATPase (AAA+ superfamily) [General funct 95.35
COG0468279 RecA RecA/RadA recombinase [DNA replication, recom 95.34
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.33
PRK11823446 DNA repair protein RadA; Provisional 95.32
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 95.3
TIGR00390441 hslU ATP-dependent protease HslVU, ATPase subunit. 95.3
COG4088261 Predicted nucleotide kinase [Nucleotide transport 95.29
PRK13765637 ATP-dependent protease Lon; Provisional 95.29
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 95.27
PTZ00088229 adenylate kinase 1; Provisional 95.27
KOG2170344 consensus ATPase of the AAA+ superfamily [General 95.24
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 95.24
PRK08233182 hypothetical protein; Provisional 95.23
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) cat 95.21
PRK09270229 nucleoside triphosphate hydrolase domain-containin 95.2
PRK10416318 signal recognition particle-docking protein FtsY; 95.19
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 95.17
PF01583156 APS_kinase: Adenylylsulphate kinase; InterPro: IPR 95.16
TIGR00150133 HI0065_YjeE ATPase, YjeE family. Members of this f 95.16
) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309127 Torsin: Torsin; InterPro: IPR010448 This family co 95.15
TIGR00416454 sms DNA repair protein RadA. The gene protuct code 95.15
PRK05201443 hslU ATP-dependent protease ATP-binding subunit Hs 95.14
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 95.14
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 95.14
KOG0728404 consensus 26S proteasome regulatory complex, ATPas 95.14
PRK05480209 uridine/cytidine kinase; Provisional 95.13
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational 95.06
PRK07132299 DNA polymerase III subunit delta'; Validated 95.04
PF06745226 KaiC: KaiC; InterPro: IPR014774 This entry represe 95.04
COG0563178 Adk Adenylate kinase and related kinases [Nucleoti 95.03
COG1224450 TIP49 DNA helicase TIP49, TBP-interacting protein 95.03
TIGR00235207 udk uridine kinase. Model contains a number of lon 95.02
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 95.01
PRK03839180 putative kinase; Provisional 95.01
cd01124187 KaiC KaiC is a circadian clock protein primarily f 94.97
PRK06762166 hypothetical protein; Provisional 94.97
TIGR01360188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 94.97
KOG2035351 consensus Replication factor C, subunit RFC3 [Cell 94.97
TIGR00708173 cobA cob(I)alamin adenosyltransferase. Alternate n 94.95
PRK08533230 flagellar accessory protein FlaH; Reviewed 94.95
PF03205140 MobB: Molybdopterin guanine dinucleotide synthesis 94.86
PF07726131 AAA_3: ATPase family associated with various cellu 94.81
PRK00625173 shikimate kinase; Provisional 94.8
TIGR00764608 lon_rel lon-related putative ATP-dependent proteas 94.79
PRK12678672 transcription termination factor Rho; Provisional 94.78
PF08433270 KTI12: Chromatin associated protein KTI12 ; InterP 94.77
PRK05986191 cob(I)alamin adenolsyltransferase/cobinamide ATP-d 94.73
PF10236309 DAP3: Mitochondrial ribosomal death-associated pro 94.73
PRK05439311 pantothenate kinase; Provisional 94.72
KOG3347176 consensus Predicted nucleotide kinase/nuclear prot 94.7
PRK09519790 recA DNA recombination protein RecA; Reviewed 94.69
PF00910107 RNA_helicase: RNA helicase; InterPro: IPR000605 He 94.68
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 94.68
KOG0729435 consensus 26S proteasome regulatory complex, ATPas 94.66
PRK04040188 adenylate kinase; Provisional 94.64
PF00158168 Sigma54_activat: Sigma-54 interaction domain; Inte 94.64
KOG0652424 consensus 26S proteasome regulatory complex, ATPas 94.64
TIGR02655484 circ_KaiC circadian clock protein KaiC. Members of 94.6
COG3640255 CooC CO dehydrogenase maturation factor [Cell divi 94.6
COG0714329 MoxR-like ATPases [General function prediction onl 94.59
PRK06217183 hypothetical protein; Validated 94.59
PF03029238 ATP_bind_1: Conserved hypothetical ATP binding pro 94.59
KOG0731774 consensus AAA+-type ATPase containing the peptidas 94.58
PRK06002450 fliI flagellum-specific ATP synthase; Validated 94.58
TIGR03575340 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryoti 94.58
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty 94.58
cd02025220 PanK Pantothenate kinase (PanK) catalyzes the phos 94.57
PRK05973237 replicative DNA helicase; Provisional 94.56
cd03217200 ABC_FeS_Assembly ABC-type transport system involve 94.54
TIGR01359183 UMP_CMP_kin_fam UMP-CMP kinase family. This subfam 94.52
KOG0743457 consensus AAA+-type ATPase [Posttranslational modi 94.52
COG0541451 Ffh Signal recognition particle GTPase [Intracellu 94.52
TIGR03498418 FliI_clade3 flagellar protein export ATPase FliI. 94.51
TIGR00554290 panK_bact pantothenate kinase, bacterial type. Sho 94.51
PRK08972444 fliI flagellum-specific ATP synthase; Validated 94.49
KOG3864221 consensus Uncharacterized conserved protein [Funct 94.46
PRK12597461 F0F1 ATP synthase subunit beta; Provisional 94.4
PRK15429686 formate hydrogenlyase transcriptional activator Fh 94.4
COG1428216 Deoxynucleoside kinases [Nucleotide transport and 94.4
cd03281213 ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS 94.38
PF07724171 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR 94.37
PF13481193 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. 94.36
PRK00131175 aroK shikimate kinase; Reviewed 94.33
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.27
COG0396251 sufC Cysteine desulfurase activator ATPase [Posttr 94.27
PF08298358 AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 Thi 94.27
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 94.26
PF03969362 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 94.21
PF12775272 AAA_7: P-loop containing dynein motor region D3; P 94.19
PRK05922434 type III secretion system ATPase; Validated 94.17
PF00006215 ATP-synt_ab: ATP synthase alpha/beta family, nucle 94.17
cd01136326 ATPase_flagellum-secretory_path_III Flagellum-spec 94.15
COG1936180 Predicted nucleotide kinase (related to CMP and AM 94.15
PRK08149428 ATP synthase SpaL; Validated 94.15
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 94.14
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 94.1
cd02024187 NRK1 Nicotinamide riboside kinase (NRK) is an enzy 94.1
PRK00889175 adenylylsulfate kinase; Provisional 94.08
PRK14721420 flhF flagellar biosynthesis regulator FlhF; Provis 94.06
TIGR02322179 phosphon_PhnN phosphonate metabolism protein/1,5-b 94.04
PF01078206 Mg_chelatase: Magnesium chelatase, subunit ChlI; I 94.02
TIGR03878259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 94.0
PRK09280463 F0F1 ATP synthase subunit beta; Validated 94.0
TIGR02902531 spore_lonB ATP-dependent protease LonB. Members of 93.99
COG0467260 RAD55 RecA-superfamily ATPases implicated in signa 93.99
PRK08927442 fliI flagellum-specific ATP synthase; Validated 93.98
PRK13949169 shikimate kinase; Provisional 93.96
PRK14723767 flhF flagellar biosynthesis regulator FlhF; Provis 93.95
cd02020147 CMPK Cytidine monophosphate kinase (CMPK) catalyze 93.93
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. 93.92
KOG3864221 consensus Uncharacterized conserved protein [Funct 93.87
COG2401593 ABC-type ATPase fused to a predicted acetyltransfe 93.86
COG0465596 HflB ATP-dependent Zn proteases [Posttranslational 93.86
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). 93.85
PF06068398 TIP49: TIP49 C-terminus; InterPro: IPR010339 This 93.85
PRK14530215 adenylate kinase; Provisional 93.84
PRK13407334 bchI magnesium chelatase subunit I; Provisional 93.84
PF03266168 NTPase_1: NTPase; InterPro: IPR004948 This entry r 93.83
PRK13947171 shikimate kinase; Provisional 93.82
TIGR03305449 alt_F1F0_F1_bet alternate F1F0 ATPase, F1 subunit 93.81
PRK10751173 molybdopterin-guanine dinucleotide biosynthesis pr 93.78
TIGR02030337 BchI-ChlI magnesium chelatase ATPase subunit I. Th 93.77
cd01125239 repA Hexameric Replicative Helicase RepA. RepA is 93.77
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phospho 93.72
PF14532138 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 93.71
CHL00081350 chlI Mg-protoporyphyrin IX chelatase 93.67
cd02028179 UMPK_like Uridine monophosphate kinase_like (UMPK_ 93.62
TIGR01039461 atpD ATP synthase, F1 beta subunit. The sequences 93.61
PF1324576 AAA_19: Part of AAA domain 93.61
COG2842297 Uncharacterized ATPase, putative transposase [Gene 93.55
TIGR01351210 adk adenylate kinases. Adenylate kinase (EC 2.7.4. 93.55
TIGR00455184 apsK adenylylsulfate kinase (apsK). Important resi 93.52
cd01135276 V_A-ATPase_B V/A-type ATP synthase (non-catalytic) 93.5
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 93.49
PRK15453290 phosphoribulokinase; Provisional 93.46
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, c 93.43
COG0003322 ArsA Predicted ATPase involved in chromosome parti 93.42
PRK15064530 ABC transporter ATP-binding protein; Provisional 93.42
PRK09435332 membrane ATPase/protein kinase; Provisional 93.4
cd00464154 SK Shikimate kinase (SK) is the fifth enzyme in th 93.36
COG0488530 Uup ATPase components of ABC transporters with dup 93.36
TIGR03263180 guanyl_kin guanylate kinase. Members of this famil 93.36
PLN02318656 phosphoribulokinase/uridine kinase 93.33
PRK05800170 cobU adenosylcobinamide kinase/adenosylcobinamide- 93.32
PTZ00185574 ATPase alpha subunit; Provisional 93.32
PRK03846198 adenylylsulfate kinase; Provisional 93.31
TIGR00176155 mobB molybdopterin-guanine dinucleotide biosynthes 93.3
KOG1532366 consensus GTPase XAB1, interacts with DNA repair p 93.29
COG0488530 Uup ATPase components of ABC transporters with dup 93.28
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 93.28
cd01132274 F1_ATPase_alpha F1 ATP synthase alpha, central dom 93.27
PRK12339197 2-phosphoglycerate kinase; Provisional 93.26
PRK05342412 clpX ATP-dependent protease ATP-binding subunit Cl 93.25
PRK14527191 adenylate kinase; Provisional 93.23
COG2019189 AdkA Archaeal adenylate kinase [Nucleotide transpo 93.23
COG3854308 SpoIIIAA ncharacterized protein conserved in bacte 93.21
PRK00300205 gmk guanylate kinase; Provisional 93.2
PF08477119 Miro: Miro-like protein; InterPro: IPR013684 Mitoc 93.18
smart00534185 MUTSac ATPase domain of DNA mismatch repair MUTS f 93.18
PRK05057172 aroK shikimate kinase I; Reviewed 93.18
PRK11160574 cysteine/glutathione ABC transporter membrane/ATP- 93.16
PRK05917290 DNA polymerase III subunit delta'; Validated 93.16
PRK07721438 fliI flagellum-specific ATP synthase; Validated 93.15
PRK05688451 fliI flagellum-specific ATP synthase; Validated 93.1
cd03243202 ABC_MutS_homologs The MutS protein initiates DNA m 93.1
TIGR03522301 GldA_ABC_ATP gliding motility-associated ABC trans 93.1
PF00625183 Guanylate_kin: Guanylate kinase; InterPro: IPR0081 93.09
TIGR03880224 KaiC_arch_3 KaiC domain protein, AF_0351 family. T 93.08
PRK09099441 type III secretion system ATPase; Provisional 93.08
cd00544169 CobU Adenosylcobinamide kinase / adenosylcobinamid 93.06
PRK14738206 gmk guanylate kinase; Provisional 93.05
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information 
Probab=100.00  E-value=3.6e-98  Score=874.40  Aligned_cols=838  Identities=40%  Similarity=0.656  Sum_probs=701.0

Q ss_pred             HHHHHHHhhhcccchHhhhHHhHHHHHHHHHHHHHHHHHHHHHHHHHHhhCccccCcHHHHHHHHHHHHHHHHHHHHHHh
Q 002655           14 SFRSILSYVGGEAKYVWALQVNLDALQAELDKLIRTKDDLLNKVELVEQQQPRARRTNQVKGWLQRVQETVTKVVDLQNV   93 (896)
Q Consensus        14 ~~~~l~~~~~~~~~~~~~~~~~~~~l~~~l~~l~~~l~~~~~~~~~ae~~~~~~~~~~~~~~Wl~~l~~~~~~~~d~~d~   93 (896)
                      .++++.+.+.++...+.+.++++..|++++..|+.+++|       |+.++   .....+..|.+.+++++|+++|+++.
T Consensus         8 ~~~~~~~~l~~~~~~~~~~~~~i~~Lk~~L~~l~~~l~d-------~~a~~---~~~~~~~~~~e~~~~~~~~~e~~~~~   77 (889)
T KOG4658|consen    8 GVEKLDQLLNRESECLDGKDNYILELKENLKALQSALED-------LDAKR---DDLERRVNWEEDVGDLVYLAEDIIWL   77 (889)
T ss_pred             ehhhHHHHHHHHHHHHhchHHHHHHHHHHHHHHHHHHHH-------HHhhc---chHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            346788888899999999999999999999999999887       44443   45567889999999999999999998


Q ss_pred             hhhhhc----------------cccccCcCCcCcchhhhhhHHHHHHHHHHHHHHhhcCCcceeec-cCCchhhhhhccc
Q 002655           94 RDQELD----------------RLCLGGFCSKDLASSYYFGKKVVTLTEQVILLKNERGEIKDIAE-MVPEDAAVELALE  156 (896)
Q Consensus        94 ~~~~~~----------------~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~  156 (896)
                      |..+..                +-|..++|......-+.+++++.++.++++.+.. ++.|..++. ..+......+|..
T Consensus        78 ~~v~~~~~~~~~~l~~~~~~~~~~c~~~~~~~~~~~~~~~~~rv~~~l~~ve~l~~-~~~~~~~~~~~~~~~~~e~~~~~  156 (889)
T KOG4658|consen   78 FLVEEIERKANDLLSTRSVERQRLCLCGFCSKNVSDSYKYGKRVSKVLREVESLGS-KGVFEVVGESLDPREKVETRPIQ  156 (889)
T ss_pred             HHHHHHHHHHhHHhhhhHHHHHHHhhhhhHhHhhhhhHhHHHHHHHHHHHHHHhcc-ccceecccccccchhhcccCCCC
Confidence            865422                1233355666667778888999999999998876 556666654 2333344444544


Q ss_pred             ccc-cchhHHHHHHHHHhhccCCCccEEEEEcCCCCcHHHHHHHHHhhhhhhhhcCCCCEEEEEEeCCCCCHHHHHHHHH
Q 002655          157 RTV-VGQESMLDQVWRCITDQEKNRGIIGLYGTGGVGKTTLLKQVNNKFCIEQRQHHFDVVIWGVVSREPKLDKIQDAIG  235 (896)
Q Consensus       157 ~~~-vGr~~~~~~l~~~L~~~~~~~~vi~I~G~gGiGKTtLa~~v~~~~~~~~~~~~f~~~~wv~~s~~~~~~~~~~~i~  235 (896)
                      +.. ||.+..++++.+.|.++  +..+++|+||||+||||||+.++|+..  +++.+||.++||+||+.++...++.+|+
T Consensus       157 ~~~~VG~e~~~~kl~~~L~~d--~~~iv~i~GMGGvGKTTL~~qi~N~~~--~v~~~Fd~~iWV~VSk~f~~~~iq~~Il  232 (889)
T KOG4658|consen  157 SESDVGLETMLEKLWNRLMED--DVGIVGIYGMGGVGKTTLARQIFNKFD--EVGNHFDGVIWVVVSKEFTTRKIQQTIL  232 (889)
T ss_pred             ccccccHHHHHHHHHHHhccC--CCCEEEEECCCcccHHHHHHHHhcccc--hhcccCceEEEEEEcccccHHhHHHHHH
Confidence            444 99999999999999988  459999999999999999999999984  3889999999999999999999999999


Q ss_pred             HHhCCCcccccccCHHHHHHHHHHHhcCCcEEEEEeccCCcccccccccCcCCCCCCcEEEEecCChhhhcc-CCCCceE
Q 002655          236 KRIGLSAESWMDKSLEEKALDISNILSRKKFVLLLDDIWQPIDLTELGIPLQSLNVSSKVVFTTRSLDVCGS-MEADEKI  314 (896)
Q Consensus       236 ~~l~~~~~~~~~~~~~~~~~~l~~~l~~k~~LlVlDdv~~~~~~~~~~~~l~~~~~gs~IivTtR~~~v~~~-~~~~~~~  314 (896)
                      +.++.....+.....++.+..|.+.|+++||+|||||||+..+|+.++.++|...+||+|++|||++.||.. +++...+
T Consensus       233 ~~l~~~~~~~~~~~~~~~~~~i~~~L~~krfllvLDDIW~~~dw~~I~~~~p~~~~g~KvvlTTRs~~V~~~~m~~~~~~  312 (889)
T KOG4658|consen  233 ERLGLLDEEWEDKEEDELASKLLNLLEGKRFLLVLDDIWEEVDWDKIGVPFPSRENGSKVVLTTRSEEVCGRAMGVDYPI  312 (889)
T ss_pred             HHhccCCcccchhhHHHHHHHHHHHhccCceEEEEecccccccHHhcCCCCCCccCCeEEEEEeccHhhhhccccCCccc
Confidence            999987766666667899999999999999999999999999999999999999899999999999999998 8888999


Q ss_pred             EeccCChHHHHHHHHHhhCCcccCCCccHHHHHHHHHHHcCCchhHHHHHHHHhcCCCChhHHHHHHHHhcCC-CCcCCC
Q 002655          315 EVKYLVHDEAWRLFQEKVGEATLRCHSDILELAQTLARECCGLPLALKTIGRAMAYKKNPDEWKYATKVLSTS-PEKFSG  393 (896)
Q Consensus       315 ~l~~L~~~ea~~Lf~~~~~~~~~~~~~~~~~~~~~i~~~c~g~PLal~~~g~~L~~~~~~~~w~~~~~~l~~~-~~~~~~  393 (896)
                      +++.|+++|||+||++.++.......+.++++|++++++|+|+|||++++|+.|+.+.+..+|+++.+.+.+. ..+.++
T Consensus       313 ~v~~L~~~eaW~LF~~~v~~~~~~~~~~i~~lak~v~~kC~GLPLAl~viG~~ma~K~t~~eW~~~~~~l~s~~~~~~~~  392 (889)
T KOG4658|consen  313 EVECLTPEEAWDLFQKKVGPNTLGSHPDIEELAKEVAEKCGGLPLALNVLGGLLACKKTVQEWRRALNVLKSSLAADFSG  392 (889)
T ss_pred             cccccCccccHHHHHHhhccccccccccHHHHHHHHHHHhCChHHHHHHHHHHhcCCCcHHHHHHHHccccccccCCCCc
Confidence            9999999999999999999876566667999999999999999999999999999999999999999999887 566677


Q ss_pred             ChHHHHhHHhhccCCCCchhhhHHHhhhcCCCCCcccchhhHHHHHHHcCCcc-------hhhhhhHHHHHHHHcccccc
Q 002655          394 MEENVFARLKFSYDSLPNYIIRSCFLYCSLFPEDYEVYKGDLIDYWTSEGFVD-------AFDEGYTIIGDLLRACLLEE  466 (896)
Q Consensus       394 ~~~~i~~~l~~sy~~L~~~~~k~cfl~~s~fp~~~~i~~~~li~~w~a~g~i~-------~~~~~~~~l~~L~~~~Ll~~  466 (896)
                      +.+.++.+|++||+.||+ ++|.||+|||+||+||.|+++.|+.+|+||||+.       .++.|+.|+++|++++|+..
T Consensus       393 ~~~~i~~iLklSyd~L~~-~lK~CFLycalFPED~~I~~e~Li~yWiaEGfi~~~~~~~~~~d~G~~~i~~LV~~~Ll~~  471 (889)
T KOG4658|consen  393 MEESILPILKLSYDNLPE-ELKSCFLYCALFPEDYEIKKEKLIEYWIAEGFIDPLDGGETAEDVGYDYIEELVRASLLIE  471 (889)
T ss_pred             hhhhhHHhhhccHhhhhH-HHHHHHHhhccCCcccccchHHHHHHHHhccCcCccccccchhcchHHHHHHHHHHHHHhh
Confidence            788999999999999995 8999999999999999999999999999999997       47899999999999999998


Q ss_pred             cc----cCeEEehHHHHHHHHHHHhhcccccccEEEecCcccccCCcccCcccceeeeccccCccccCCCCCCCCCcEEE
Q 002655          467 VN----DNHVKMHDVIRDMALWIACKIDKEEENFLVHAGALLTEAPKIKDWEGFKRISLMENNITSLSAIPNCPHLRTLL  542 (896)
Q Consensus       467 ~~----~~~~~mHdlv~~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~l~l~~~~~~~l~~~~~~~~L~~L~  542 (896)
                      ..    ...|.|||+||++|.+++++.+.++++.++..+......|....|...|++++.+|.+..++.-..+++|++|.
T Consensus       472 ~~~~~~~~~~kmHDvvRe~al~ias~~~~~~e~~iv~~~~~~~~~~~~~~~~~~rr~s~~~~~~~~~~~~~~~~~L~tLl  551 (889)
T KOG4658|consen  472 ERDEGRKETVKMHDVVREMALWIASDFGKQEENQIVSDGVGLSEIPQVKSWNSVRRMSLMNNKIEHIAGSSENPKLRTLL  551 (889)
T ss_pred             cccccceeEEEeeHHHHHHHHHHhccccccccceEEECCcCccccccccchhheeEEEEeccchhhccCCCCCCccceEE
Confidence            63    37899999999999999999888888888888777778889999999999999999999998888999999999


Q ss_pred             cccCc--cccccchhhccCCCccEEecccccccccCCccccCCCcCcEEeccCCCccccchhhhcCCCCcEEecccc-cc
Q 002655          543 LYRNR--ISMITDGFFQFMPSLKVLNLGFNIFLNKLPSGLSSLISLEHLDLSFTVIRELPEEMKALVNLRYLNLEYV-YL  619 (896)
Q Consensus       543 l~~~~--l~~~~~~~~~~l~~L~~L~L~~~~~~~~lp~~~~~l~~L~~L~l~~~~i~~lp~~i~~L~~L~~L~l~~~-~l  619 (896)
                      +.+|.  +..++..||..|+.|++|||++|..+.++|++|+.|.+||||++++|.++.+|.++++|++|.+|++..+ .+
T Consensus       552 l~~n~~~l~~is~~ff~~m~~LrVLDLs~~~~l~~LP~~I~~Li~LryL~L~~t~I~~LP~~l~~Lk~L~~Lnl~~~~~l  631 (889)
T KOG4658|consen  552 LQRNSDWLLEISGEFFRSLPLLRVLDLSGNSSLSKLPSSIGELVHLRYLDLSDTGISHLPSGLGNLKKLIYLNLEVTGRL  631 (889)
T ss_pred             EeecchhhhhcCHHHHhhCcceEEEECCCCCccCcCChHHhhhhhhhcccccCCCccccchHHHHHHhhheecccccccc
Confidence            99997  7888889999999999999999999999999999999999999999999999999999999999999998 55


Q ss_pred             ccccccccCCCCccceeeccCccCCCCCccccccccCcchhhhhhccCcCCceeEEEecchhhhHhhhhccccccceeEE
Q 002655          620 NRLPLQLLCNFTKLQALRMLGCSNYSGEEEDRVFFKDAEPFMKELLCLENLDLLSFTFDSWHAFETFLTFQKLLSCTESL  699 (896)
Q Consensus       620 ~~lp~~~i~~l~~L~~L~l~~c~~~~~~~e~~~~~~~~~~~l~~L~~L~~L~~l~i~~~~~~~~~~~~~~~~~~~~L~~L  699 (896)
                      ..+ ++.+..|++||+|.+..-. .          ..+...+.++.+|++|+.++++..+....+.+.....+.+..+.+
T Consensus       632 ~~~-~~i~~~L~~Lr~L~l~~s~-~----------~~~~~~l~el~~Le~L~~ls~~~~s~~~~e~l~~~~~L~~~~~~l  699 (889)
T KOG4658|consen  632 ESI-PGILLELQSLRVLRLPRSA-L----------SNDKLLLKELENLEHLENLSITISSVLLLEDLLGMTRLRSLLQSL  699 (889)
T ss_pred             ccc-cchhhhcccccEEEeeccc-c----------ccchhhHHhhhcccchhhheeecchhHhHhhhhhhHHHHHHhHhh
Confidence            555 4546779999999998732 1          123467889999999999999776653344444444444455555


Q ss_pred             EecccCCCCcccccchhhccccceEEeccCCceeeeeccccccccccccccCcccEEeeccCCCCCCCcccccCCCCcEE
Q 002655          700 ELTKLYTPMSLNVLPLAYMKHLKNFLIQNCAFEELKIENAVEIQNLVQRGFRSLHTVFISDCSRLKELTWLVFAPNLKNI  779 (896)
Q Consensus       700 ~l~~~~~~~~~~~~~l~~~~~L~~L~i~~~~~~~l~~~~~~~~~~~~~~~l~~L~~L~L~~c~~l~~l~~l~~l~~L~~L  779 (896)
                      .+..+..  .....++..+.+|+.|.|.+|...+....+.......  ..|+++.++.+.+|...+.+.|....|+|+.|
T Consensus       700 ~~~~~~~--~~~~~~~~~l~~L~~L~i~~~~~~e~~~~~~~~~~~~--~~f~~l~~~~~~~~~~~r~l~~~~f~~~L~~l  775 (889)
T KOG4658|consen  700 SIEGCSK--RTLISSLGSLGNLEELSILDCGISEIVIEWEESLIVL--LCFPNLSKVSILNCHMLRDLTWLLFAPHLTSL  775 (889)
T ss_pred             hhccccc--ceeecccccccCcceEEEEcCCCchhhcccccccchh--hhHHHHHHHHhhccccccccchhhccCcccEE
Confidence            5433222  1222357778999999999999977444443321111  13778999999999999999998899999999


Q ss_pred             eEecCccccccccCCcCccccccccccccCccccee-eccCCcccccccCCCCCCCCccEEEecCCCCCCCCCCCCCC--
Q 002655          780 DVQNCNNMEEIISPGKLSEVSEIKERQNFLAELKFL-CLKDLENLESIYFDPLPFPQLKEIEVTGCPKLKKLPLDSTR--  856 (896)
Q Consensus       780 ~L~~c~~l~~l~~~~~~~~l~~~~~~~~~~~~L~~L-~l~~~~~L~~l~~~~~~~~~L~~L~i~~c~~L~~lp~~~~~--  856 (896)
                      .+..|..++++++......  ........|+++..+ .+.+.+.+.++...+..+++|+.+.+..||+++.+|.....  
T Consensus       776 ~l~~~~~~e~~i~~~k~~~--~l~~~i~~f~~~~~l~~~~~l~~l~~i~~~~l~~~~l~~~~ve~~p~l~~~P~~~~~~i  853 (889)
T KOG4658|consen  776 SLVSCRLLEDIIPKLKALL--ELKELILPFNKLEGLRMLCSLGGLPQLYWLPLSFLKLEELIVEECPKLGKLPLLSTLTI  853 (889)
T ss_pred             EEecccccccCCCHHHHhh--hcccEEecccccccceeeecCCCCceeEecccCccchhheehhcCcccccCccccccce
Confidence            9999999999876432211  111123457777777 68888888888888888899999999999999999987655  


Q ss_pred             CCC-cceEEEcchhhhhhcccCCccccccc
Q 002655          857 AMG-HKIVVKGNIEWWVELQWEDRVTQRVF  885 (896)
Q Consensus       857 ~~l-~~l~I~~~~~~~~~l~~~~~~~~~~~  885 (896)
                      ... ..+....+.+|.+.++|+++..+..+
T Consensus       854 ~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~  883 (889)
T KOG4658|consen  854 VGCEEKLKEYPDGEWLEGVYWEDELTKLRF  883 (889)
T ss_pred             eccccceeecCCccceeeEEehhhhhhhhc
Confidence            222 23333456678999999999888665

>PLN03210 Resistant to P Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>COG3903 Predicted ATPase [General function prediction only] Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>COG3899 Predicted ATPase [General function prediction only] Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>PTZ00202 tuzin; Provisional Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PRK09376 rho transcription termination factor Rho; Provisional Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF14516 AAA_35: AAA-like domain Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>TIGR00767 rho transcription termination factor Rho Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG2227 consensus Pre-initiation complex, subunit CDC6, AAA+ superfamily ATPase [Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>KOG2543 consensus Origin recognition complex, subunit 5 [Replication, recombination and repair] Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>COG1373 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK12608 transcription termination factor Rho; Provisional Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF10443 RNA12: RNA12 protein; InterPro: IPR018850 Mitochondrial escape protein 2 (also known as RNA12) plays a role in maintaining the mitochondrial genome and in controlling mtDNA escape [, ] Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>KOG1514 consensus Origin recognition complex, subunit 1, and related proteins [Replication, recombination and repair] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>PF08423 Rad51: Rad51; InterPro: IPR013632 This domain is found at the C terminus of the DNA repair and recombination protein Rad51 Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA Back     alignment and domain information
>KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PRK04132 replication factor C small subunit; Provisional Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK09354 recA recombinase A; Provisional Back     alignment and domain information
>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only] Back     alignment and domain information
>PF07693 KAP_NTPase: KAP family P-loop domain; InterPro: IPR011646 The KAP (after Kidins220/ARMS and PifA) family of predicted NTPases are sporadically distributed across a wide phylogenetic range in bacteria and in animals Back     alignment and domain information
>PRK06696 uridine kinase; Validated Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02238 recomb_DMC1 meiotic recombinase Dmc1 Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>KOG2228 consensus Origin recognition complex, subunit 4 [Replication, recombination and repair] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>cd01133 F1-ATPase_beta F1 ATP synthase beta subunit, nucleotide-binding domain Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15455 PrkA family serine protein kinase; Provisional Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>PRK04301 radA DNA repair and recombination protein RadA; Validated Back     alignment and domain information
>PLN03186 DNA repair protein RAD51 homolog; Provisional Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>PRK07667 uridine kinase; Provisional Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>PLN03187 meiotic recombination protein DMC1 homolog; Provisional Back     alignment and domain information
>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family Back     alignment and domain information
>PTZ00035 Rad51 protein; Provisional Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06547 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02239 recomb_RAD51 DNA repair protein RAD51 Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>TIGR02236 recomb_radA DNA repair and recombination protein RadA Back     alignment and domain information
>PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 Back     alignment and domain information
>PRK04328 hypothetical protein; Provisional Back     alignment and domain information
>COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02858 spore_III_AA stage III sporulation protein AA Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>PF00154 RecA: recA bacterial DNA recombination protein; InterPro: IPR013765 The recA gene product is a multifunctional enzyme that plays a role in homologous recombination, DNA repair and induction of the SOS response [] Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PTZ00494 tuzin-like protein; Provisional Back     alignment and domain information
>PTZ00301 uridine kinase; Provisional Back     alignment and domain information
>COG0572 Udk Uridine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>COG0468 RecA RecA/RadA recombinase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK13765 ATP-dependent protease Lon; Provisional Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>PTZ00088 adenylate kinase 1; Provisional Back     alignment and domain information
>KOG2170 consensus ATPase of the AAA+ superfamily [General function prediction only] Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) Back     alignment and domain information
>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>TIGR00150 HI0065_YjeE ATPase, YjeE family Back     alignment and domain information
>PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins Back     alignment and domain information
>TIGR00416 sms DNA repair protein RadA Back     alignment and domain information
>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG0728 consensus 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05480 uridine/cytidine kinase; Provisional Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK07132 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>PRK03839 putative kinase; Provisional Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>PRK06762 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>KOG2035 consensus Replication factor C, subunit RFC3 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>TIGR00708 cobA cob(I)alamin adenosyltransferase Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A Back     alignment and domain information
>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model Back     alignment and domain information
>PRK00625 shikimate kinase; Provisional Back     alignment and domain information
>TIGR00764 lon_rel lon-related putative ATP-dependent protease Back     alignment and domain information
>PRK12678 transcription termination factor Rho; Provisional Back     alignment and domain information
>PF08433 KTI12: Chromatin associated protein KTI12 ; InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II [] Back     alignment and domain information
>PRK05986 cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase; Validated Back     alignment and domain information
>PF10236 DAP3: Mitochondrial ribosomal death-associated protein 3; InterPro: IPR019368 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PRK05439 pantothenate kinase; Provisional Back     alignment and domain information
>KOG3347 consensus Predicted nucleotide kinase/nuclear protein involved oxidative stress response [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK09519 recA DNA recombination protein RecA; Reviewed Back     alignment and domain information
>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK04040 adenylate kinase; Provisional Back     alignment and domain information
>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor Back     alignment and domain information
>KOG0652 consensus 26S proteasome regulatory complex, ATPase RPT5 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>COG3640 CooC CO dehydrogenase maturation factor [Cell division and chromosome partitioning] Back     alignment and domain information
>COG0714 MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>PRK06217 hypothetical protein; Validated Back     alignment and domain information
>PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity Back     alignment and domain information
>KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06002 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>TIGR03575 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryotic Back     alignment and domain information
>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) Back     alignment and domain information
>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway Back     alignment and domain information
>PRK05973 replicative DNA helicase; Provisional Back     alignment and domain information
>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family Back     alignment and domain information
>KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR03498 FliI_clade3 flagellar protein export ATPase FliI Back     alignment and domain information
>TIGR00554 panK_bact pantothenate kinase, bacterial type Back     alignment and domain information
>PRK08972 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK12597 F0F1 ATP synthase subunit beta; Provisional Back     alignment and domain information
>PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional Back     alignment and domain information
>COG1428 Deoxynucleoside kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes Back     alignment and domain information
>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08298 AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 This is entry is found at the N terminus of PrkA proteins - bacterial and archaeal serine kinases approximately 630 residues in length Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF03969 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 ATPase family gene 1 (AFG1) ATPase is a 377 amino acid putative protein with an ATPase motif typical of the protein family including SEC18p PAS1, CDC48-VCP and TBP Back     alignment and domain information
>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A Back     alignment and domain information
>PRK05922 type III secretion system ATPase; Validated Back     alignment and domain information
>PF00006 ATP-synt_ab: ATP synthase alpha/beta family, nucleotide-binding domain This Pfam entry corresponds to chains a,b,c,d,e and f; InterPro: IPR000194 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>cd01136 ATPase_flagellum-secretory_path_III Flagellum-specific ATPase/type III secretory pathway virulence-related protein Back     alignment and domain information
>COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK08149 ATP synthase SpaL; Validated Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+) Back     alignment and domain information
>PRK00889 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>PRK09280 F0F1 ATP synthase subunit beta; Validated Back     alignment and domain information
>TIGR02902 spore_lonB ATP-dependent protease LonB Back     alignment and domain information
>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] Back     alignment and domain information
>PRK08927 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>PRK13949 shikimate kinase; Provisional Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor Back     alignment and domain information
>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG2401 ABC-type ATPase fused to a predicted acetyltransferase domain [General function prediction only] Back     alignment and domain information
>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) Back     alignment and domain information
>PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins Back     alignment and domain information
>PRK14530 adenylate kinase; Provisional Back     alignment and domain information
>PRK13407 bchI magnesium chelatase subunit I; Provisional Back     alignment and domain information
>PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] Back     alignment and domain information
>PRK13947 shikimate kinase; Provisional Back     alignment and domain information
>TIGR03305 alt_F1F0_F1_bet alternate F1F0 ATPase, F1 subunit beta Back     alignment and domain information
>PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional Back     alignment and domain information
>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I Back     alignment and domain information
>cd01125 repA Hexameric Replicative Helicase RepA Back     alignment and domain information
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate Back     alignment and domain information
>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H Back     alignment and domain information
>CHL00081 chlI Mg-protoporyphyrin IX chelatase Back     alignment and domain information
>cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>TIGR01039 atpD ATP synthase, F1 beta subunit Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>COG2842 Uncharacterized ATPase, putative transposase [General function prediction only] Back     alignment and domain information
>TIGR01351 adk adenylate kinases Back     alignment and domain information
>TIGR00455 apsK adenylylsulfate kinase (apsK) Back     alignment and domain information
>cd01135 V_A-ATPase_B V/A-type ATP synthase (non-catalytic) subunit B Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>PRK15453 phosphoribulokinase; Provisional Back     alignment and domain information
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>COG0003 ArsA Predicted ATPase involved in chromosome partitioning [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09435 membrane ATPase/protein kinase; Provisional Back     alignment and domain information
>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>PLN02318 phosphoribulokinase/uridine kinase Back     alignment and domain information
>PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated Back     alignment and domain information
>PTZ00185 ATPase alpha subunit; Provisional Back     alignment and domain information
>PRK03846 adenylylsulfate kinase; Provisional Back     alignment and domain information
>TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB Back     alignment and domain information
>KOG1532 consensus GTPase XAB1, interacts with DNA repair protein XPA [Replication, recombination and repair] Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>cd01132 F1_ATPase_alpha F1 ATP synthase alpha, central domain Back     alignment and domain information
>PRK12339 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>PRK14527 adenylate kinase; Provisional Back     alignment and domain information
>COG2019 AdkA Archaeal adenylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases Back     alignment and domain information
>smart00534 MUTSac ATPase domain of DNA mismatch repair MUTS family Back     alignment and domain information
>PRK05057 aroK shikimate kinase I; Reviewed Back     alignment and domain information
>PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>PRK05917 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK07721 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>PRK05688 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch Back     alignment and domain information
>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>PF00625 Guanylate_kin: Guanylate kinase; InterPro: IPR008144 Guanylate kinase (2 Back     alignment and domain information
>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family Back     alignment and domain information
>PRK09099 type III secretion system ATPase; Provisional Back     alignment and domain information
>cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) Back     alignment and domain information
>PRK14738 gmk guanylate kinase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query896
3rfs_A272 Design Of A Binding Scaffold Based On Variable Lymp 5e-05
2z80_A353 Crystal Structure Of The Tlr1-Tlr2 Heterodimer Indu 2e-04
2z7x_B 520 Crystal Structure Of The Tlr1-Tlr2 Heterodimer Indu 3e-04
2z7x_A 549 Crystal Structure Of The Tlr1-Tlr2 Heterodimer Indu 5e-04
>pdb|3RFS|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 272 Back     alignment and structure 
Iteration: 1

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 44/157 (28%), Positives = 76/157 (48%), Gaps = 9/157 (5%)
Query: 490 DKEEENFLVHAGALLTEAPKIKDWEGF------KRISLMENNITSLSAIPNCPHLRTLLL 543
           D   +N L     ++     IK  +G       + ++L  N +  +SA+    +L  L+L
Sbjct: 33  DAVTQNELNSIDQIIANNSDIKSVQGIQYLPNVRYLALGGNKLHDISALKELTNLTYLIL 92
Query: 544 YRNRISMITDGFFQFMPSLKVLNLGFNIFLNKLPSGL-SSLISLEHLDLSFTVIRELPEE 602
             N++  + +G F  + +LK L L  N  L  LP G+   L +L +L+L+   ++ LP+ 
Sbjct: 93  TGNQLQSLPNGVFDKLTNLKELVLVEN-QLQSLPDGVFDKLTNLTYLNLAHNQLQSLPKG 151
Query: 603 M-KALVNLRYLNLEYVYLNRLPLQLLCNFTKLQALRM 638
           +   L NL  L+L Y  L  LP  +    T+L+ LR+
Sbjct: 152 VFDKLTNLTELDLSYNQLQSLPEGVFDKLTQLKDLRL 188
>pdb|2Z80|A Chain A, Crystal Structure Of The Tlr1-Tlr2 Heterodimer Induced By Binding Of A Tri-Acylated Lipopeptide Length = 353 Back     alignment and structure
>pdb|2Z7X|B Chain B, Crystal Structure Of The Tlr1-Tlr2 Heterodimer Induced By Binding Of A Tri-Acylated Lipopeptide Length = 520 Back     alignment and structure
>pdb|2Z7X|A Chain A, Crystal Structure Of The Tlr1-Tlr2 Heterodimer Induced By Binding Of A Tri-Acylated Lipopeptide Length = 549 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query896
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 1e-56
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 5e-54
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-45
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-13
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 9e-22
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-21
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-17
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 7e-15
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-14
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-21
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-19
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-17
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-11
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-05
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-21
1o6v_A 466 Internalin A; bacterial infection, extracellular r 7e-16
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-10
1o6v_A466 Internalin A; bacterial infection, extracellular r 8e-10
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-07
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-21
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-16
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-13
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-11
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-07
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-20
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-17
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-17
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-12
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 9e-09
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-05
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-20
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-15
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-15
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-13
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-11
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-09
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-20
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-18
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-18
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-17
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 7e-16
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 6e-12
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-11
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-20
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-10
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-20
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-19
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-19
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-20
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-16
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-13
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-04
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 3e-19
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-19
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-16
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-13
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 7e-06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-19
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-15
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-09
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-19
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 7e-15
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-11
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 8e-19
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 6e-16
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-12
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 9e-19
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-18
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-18
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-17
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-14
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-18
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-14
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-13
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-10
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 7e-06
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-05
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-04
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-17
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-11
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-07
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-17
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-15
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-13
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-17
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-12
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-17
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-14
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-12
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 8e-09
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-08
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 8e-05
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 4e-17
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-13
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-05
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 5e-17
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-16
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-15
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 7e-14
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 7e-17
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-15
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-14
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-11
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-16
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-15
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-15
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-13
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-12
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-16
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 6e-15
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-14
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-14
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-12
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-16
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-15
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-15
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-11
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-16
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 9e-10
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-06
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 8e-05
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 7e-16
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-14
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 5e-14
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 6e-14
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-13
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 5e-08
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-04
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-15
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-09
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-15
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-14
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-14
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-11
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-15
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-14
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-06
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-15
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-14
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-14
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-12
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-12
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-10
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-09
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-06
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 5e-06
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 4e-04
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 7e-15
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-14
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-13
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-13
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 6e-13
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-04
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 8e-15
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-04
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-14
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 5e-13
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-12
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-10
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 5e-04
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 1e-13
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 4e-10
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 4e-10
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-13
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 5e-12
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-05
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-13
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-11
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-11
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-10
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-08
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-13
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 6e-12
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-10
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 9e-13
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-12
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-12
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-10
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-12
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 4e-09
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 8e-12
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-11
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 8e-08
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-11
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-10
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-10
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-10
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 4e-10
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 4e-08
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-06
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-06
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-06
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 9e-06
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-11
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-10
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-09
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-11
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-11
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-11
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 7e-07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-11
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 4e-11
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-11
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 4e-11
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-11
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-09
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 4e-09
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-04
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 6e-11
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-09
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-06
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 4e-09
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 1e-07
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 6e-06
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 5e-04
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-08
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-07
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-07
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 7e-07
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 7e-07
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 3e-08
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 3e-08
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-07
3m19_A251 Variable lymphocyte receptor A diversity region; a 4e-06
3e6j_A229 Variable lymphocyte receptor diversity region; var 9e-07
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 6e-06
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 8e-06
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 1e-05
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 9e-06
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 2e-05
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 2e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 3e-05
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 5e-05
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 8e-05
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 5e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 5e-05
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 6e-05
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 6e-05
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591 Back     alignment and structure
 Score =  204 bits (520), Expect = 1e-56
 Identities = 79/539 (14%), Positives = 170/539 (31%), Gaps = 69/539 (12%)

Query: 119 KKVVTLTEQVILLKNERGEIKDIAEMVPEDAAVELALERTVVGQESMLDQVWRCITDQEK 178
              + +        +  G    +  ++ E    +  +    V ++ +++ + + ++  + 
Sbjct: 88  HDGIPVVSSSSGKDSVSGITSYVRTVLCEGGVPQRPVV--FVTRKKLVNAIQQKLSKLKG 145

Query: 179 NRGIIGLYGTGGVGKTTLLKQVNNKFCIEQRQHHFDVVIWGVVSREPKLDKIQD--AIGK 236
             G + ++G  G GK+ L  +      +         V W  V ++ K   +     +  
Sbjct: 146 EPGWVTIHGMAGCGKSVLAAEAVRDHSL-LEGCFPGGVHWVSVGKQDKSGLLMKLQNLCT 204

Query: 237 RIGLSAESWMDKSLEEKALD--ISNILSRK--KFVLLLDDIWQPIDLTELGIPLQSLNVS 292
           R+           L  +     +  ++ RK  + +L+LDD+W           L++ +  
Sbjct: 205 RLDQDESFSQRLPLNIEEAKDRLRILMLRKHPRSLLILDDVWDSW-------VLKAFDSQ 257

Query: 293 SKVVFTTRSLDVCGSMEADEKI--EVKYLVHDEAWRLFQEKVGEATLRCHSDILELAQTL 350
            +++ TTR   V  S+   + +      L  ++   +    V        +D+ E A ++
Sbjct: 258 CQILLTTRDKSVTDSVMGPKYVVPVESSLGKEKGLEILSLFVNM----KKADLPEQAHSI 313

Query: 351 ARECCGLPLALKTIGRAMAYKKNPDEWKYATKVLSTS-----PEKFSGMEENVFARLKFS 405
            +EC G PL +  IG  +     P+ W+Y  K L         +  S   E +   +  S
Sbjct: 314 IKECKGSPLVVSLIGALLRDF--PNRWEYYLKQLQNKQFKRIRKSSSYDYEALDEAMSIS 371

Query: 406 YDSLPNYIIRSCFLYCSLFPEDYEVYKGDLIDYWTSEGFV--DAFDEGYTIIGDLLRACL 463
            + L   I +  +   S+  +D +V    L   W  E     D   E        +   L
Sbjct: 372 VEMLREDI-KDYYTDLSILQKDVKVPTKVLCILWDMETEEVEDILQE-------FVNKSL 423

Query: 464 LEEVNDNHV---KMHDVIRDMALWIACKIDKEEENFLVHAGALLTEAPKIKDWEGFKRIS 520
           L    +       +HD+  D      C      +   +H   +       +         
Sbjct: 424 LFCDRNGKSFRYYLHDLQVDFLTEKNC-----SQLQDLHKKIITQFQRYHQPH------- 471

Query: 521 LMENNITSLSAIPNCPHLRTLLLYRNRISMITDGFFQFMPSLKVLNLGFNIFLNKLPSGL 580
                 T      +C +    L Y    + +       M SL  +         K     
Sbjct: 472 ------TLSPDQEDCMYWYNFLAYHMASAKMHKELCALMFSLDWIK-------AKTELVG 518

Query: 581 SSLISLEHLDLSFTVIRELPEEMKALVNLRYLNLEYVYLNRLP--LQLLCNFTKLQALR 637
            + +  E ++    +  +     +       LN   +     P  +QL     +   + 
Sbjct: 519 PAHLIHEFVEYRHILDEKDCAVSENFQEFLSLNGHLLGRQPFPNIVQLGLCEPETSEVY 577
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

No hit with probability above 80.00

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 896
d2a5yb3277 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenor 2e-35
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-09
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 6e-09
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-08
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-06
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 9e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-08
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 9e-08
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.002
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-07
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 2e-04
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 3e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 7e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 7e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.004
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.004
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 8e-04
d1m9la_198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 9e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.002
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.003
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.004
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.003
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.004
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 0.004
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]

 Score =  133 bits (336), Expect = 2e-35
 Identities = 41/273 (15%), Positives = 93/273 (34%), Gaps = 27/273 (9%)

Query: 156 ERTVVGQESMLDQVWRCITD-QEKNRGIIGLYGTGGVGKTTLLKQVNNKFCIEQRQHHFD 214
           + T   +E  +D+V + + +  + +   + L+G  G GK+ +  Q  +K   +    ++D
Sbjct: 19  QMTCYIREYHVDRVIKKLDEMCDLDSFFLFLHGRAGSGKSVIASQALSKS-DQLIGINYD 77

Query: 215 VVIWGVVSREPKLDKIQDAIGKRIGLSAESWMDK--------SLEEKALDISNILSRKKF 266
            ++W   S               + L +E  +          S+  K +  + ++ R   
Sbjct: 78  SIVWLKDSGTAPKSTFDLFTDILLMLKSEDDLLNFPSVEHVTSVVLKRMICNALIDRPNT 137

Query: 267 VLLLDDIWQPIDLTELGIPLQSLNVSSKVVFTTRSLDVCGSMEADEKI-EVKYLVHDEAW 325
           + + DD+ Q   +           +  + + TTR +++  +     +  EV  L  DE +
Sbjct: 138 LFVFDDVVQEETIRWAQ------ELRLRCLVTTRDVEISNAASQTCEFIEVTSLEIDECY 191

Query: 326 RLFQEKVGEATLRCHSDILELAQTLARECCGLPLALKTIGRAMAYKKNPDEWKYATKVLS 385
              +       +    +   +         G P  L    ++    K  ++       L 
Sbjct: 192 DFLEAYGMPMPVGEKEED--VLNKTIELSSGNPATLMMFFKSCE-PKTFEKMAQLNNKLE 248

Query: 386 TSPEKFSGMEENVFARLKFSYDSLPNYIIRSCF 418
           +           V     +SY SL    ++ C 
Sbjct: 249 SRG------LVGVECITPYSYKSLAMA-LQRCV 274
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query896
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 100.0
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.9
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.88
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.85
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.81
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.76
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.73
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.73
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.72
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.7
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.67
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.66
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.66
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.65
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.65
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.64
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.59
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.59
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.53
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.51
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.51
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.5
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.45
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 99.44
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 99.29
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.29
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.29
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.28
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.28
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.23
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.08
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 99.06
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 99.0
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 98.99
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 98.99
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.97
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 98.97
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 98.97
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 98.9
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.89
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.85
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 98.83
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.8
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 98.78
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.77
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 98.76
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 98.68
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 98.64
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.64
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 98.62
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 98.61
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.61
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 98.56
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 98.48
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 98.46
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 98.44
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.42
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 98.13
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 98.12
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 97.45
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 97.44
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.42
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 97.42
d2qy9a2211 GTPase domain of the signal recognition particle r 97.26
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 97.24
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 97.16
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 97.13
d2jdid3276 Central domain of beta subunit of F1 ATP synthase 97.06
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 97.06
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 97.04
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.03
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 97.03
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 96.95
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 96.95
d1vmaa2213 GTPase domain of the signal recognition particle r 96.94
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 96.94
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 96.92
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 96.92
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 96.85
d1g2912240 Maltose transport protein MalK, N-terminal domain 96.8
d1ls1a2207 GTPase domain of the signal sequence recognition p 96.78
d1okkd2207 GTPase domain of the signal recognition particle r 96.75
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 96.75
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 96.73
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 96.73
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 96.71
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 96.69
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 96.68
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 96.66
d1ihua2279 Arsenite-translocating ATPase ArsA {Escherichia co 96.62
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 96.61
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 96.59
d1j8yf2211 GTPase domain of the signal sequence recognition p 96.58
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 96.57
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 96.56
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 96.55
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 96.54
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 96.52
d2hyda1255 Putative multidrug export ATP-binding/permease pro 96.51
d1cp2a_269 Nitrogenase iron protein {Clostridium pasteurianum 96.48
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 96.46
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 96.46
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 96.43
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 96.42
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 96.41
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 96.36
d1svma_362 Papillomavirus large T antigen helicase domain {Si 96.31
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 96.3
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 96.29
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 96.28
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 96.26
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 96.26
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 96.25
d1ihua1296 Arsenite-translocating ATPase ArsA {Escherichia co 96.24
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 96.24
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 96.21
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 96.17
d1xpua3289 Transcription termination factor Rho, ATPase domai 96.12
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 96.12
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 96.1
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 96.06
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 96.04
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 95.96
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 95.96
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 95.96
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 95.92
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 95.86
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 95.83
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 95.76
d1fx0a3276 Central domain of alpha subunit of F1 ATP synthase 95.7
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 95.65
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 95.58
d2afhe1289 Nitrogenase iron protein {Azotobacter vinelandii [ 95.56
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 95.48
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 95.47
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 95.47
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 95.46
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 95.43
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 95.41
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 95.41
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 95.38
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 95.33
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 95.32
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 95.27
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 95.26
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 95.23
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 94.93
d1hyqa_232 Cell division regulator MinD {Archaeon Archaeoglob 94.91
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 94.9
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 94.87
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 94.85
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 94.83
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 94.79
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 94.74
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 94.74
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 94.73
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 94.71
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 94.66
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 94.65
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 94.64
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 94.62
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 94.54
d2awna2232 Maltose transport protein MalK, N-terminal domain 94.48
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 94.48
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 94.46
d2jdia3285 Central domain of alpha subunit of F1 ATP synthase 94.38
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 94.32
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 94.31
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 94.25
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 94.01
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 93.95
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 93.9
d1g3qa_237 Cell division regulator MinD {Archaeon Pyrococcus 93.89
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 93.86
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 93.77
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 93.73
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 93.49
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 93.47
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 93.46
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 93.46
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 93.38
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 93.3
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 93.27
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 93.12
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 93.04
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 93.01
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 92.98
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 92.95
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 92.91
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 92.89
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 92.89
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 92.85
d1byia_224 Dethiobiotin synthetase {Escherichia coli [TaxId: 92.73
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 92.69
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 92.57
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 92.53
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 92.46
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 92.46
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 92.4
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 92.37
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 92.36
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 92.33
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 92.32
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 92.31
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 92.31
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 92.3
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 92.3
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 92.28
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 92.27
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 92.22
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 92.16
d2fh5b1207 Signal recognition particle receptor beta-subunit 92.15
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 92.13
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 91.93
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 91.9
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 91.88
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 91.88
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 91.88
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 91.87
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 91.85
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 91.81
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 91.79
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 91.78
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 91.77
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 91.75
d1nrjb_209 Signal recognition particle receptor beta-subunit 91.64
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 91.63
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 91.6
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 91.57
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 91.55
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 91.49
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 91.48
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 91.44
d1p6xa_333 Thymidine kinase {Equine herpesvirus type 4 [TaxId 91.34
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 91.34
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 91.3
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 91.15
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 91.13
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 91.11
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 91.02
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 90.99
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 90.95
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 90.91
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 90.9
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 90.9
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 90.9
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 90.87
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 90.69
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 90.65
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 90.65
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 90.64
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 90.55
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 90.38
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 90.32
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 90.29
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 89.76
d1f5na2277 Interferon-induced guanylate-binding protein 1 (GB 89.64
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 89.57
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 89.56
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 89.34
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 89.27
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 89.16
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 89.16
d1tq4a_400 Interferon-inducible GTPase {Mouse (Mus musculus) 89.14
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 89.12
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 89.0
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 88.55
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 88.38
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 87.57
d1tuea_205 Replication protein E1 helicase domain {Human papi 87.41
d1osna_331 Thymidine kinase {Varicella-zoster virus [TaxId: 1 87.38
d1e2ka_329 Thymidine kinase {Herpes simplex virus type 1, dif 87.37
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 87.29
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 86.65
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 86.41
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 84.61
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 84.4
d1n0ua2341 Elongation factor 2 (eEF-2), N-terminal (G) domain 84.02
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 83.25
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 82.31
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 81.64
d1e9ra_433 Bacterial conjugative coupling protein TrwB {Esche 81.27
g1qhh.1623 DEXX box DNA helicase {Bacillus stearothermophilus 80.27
d1g5ta_157 ATP:corrinoid adenosyltransferase CobA {Salmonella 80.15
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]

Probab=100.00  E-value=0  Score=305.35  Aligned_cols=251  Identities=16%  Similarity=0.154  Sum_probs=199.8

Q ss_pred             CCCCCCCCHHHHHHHHHHHHHC-CCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHCCCCCEEEEEEECCCCCHHHHHH
Q ss_conf             0244313446889999999630-689950999993898819999999994643321039987799999489999889999
Q 002655          154 ALERTVVGQESMLDQVWRCITD-QEKNRGIIGLYGTGGVGKTTLLKQVNNKFCIEQRQHHFDVVIWGVVSREPKLDKIQD  232 (896)
Q Consensus       154 ~~~~~~vGr~~~~~~l~~~L~~-~~~~~~vi~I~G~gGiGKTtLa~~v~~~~~~~~~~~~F~~~~wv~~s~~~~~~~~~~  232 (896)
                      |..+.++||+.++++|+++|.. .+.+.++|+|+||||+||||||+++|++.. ...+.+|+.++|+++++.++...+..
T Consensus        17 p~~~~~~gR~~~~~~i~~~L~~~~~~~~~~v~I~GmgGiGKTtLA~~v~~~~~-~~~~~~f~~~~Wv~vs~~~~~~~l~~   95 (277)
T d2a5yb3          17 PKQMTCYIREYHVDRVIKKLDEMCDLDSFFLFLHGRAGSGKSVIASQALSKSD-QLIGINYDSIVWLKDSGTAPKSTFDL   95 (277)
T ss_dssp             BCCCCSCCCHHHHHHHHHHHHHHTTSSSEEEEEECSTTSSHHHHHHHHHHHCS-STBTTTBSEEEEEECCCCSTTHHHHH
T ss_pred             CCCCCEECCHHHHHHHHHHHHHCCCCCCEEEEEECCCCCCHHHHHHHHHHHHH-HHHHHCCCEEEEEEECCCCCHHHHHH
T ss_conf             99886237399999999998734687840899977997888999999998556-55401276489999368777778999


Q ss_pred             HHHHHH---CCCCC-----CCCCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCEEEEECCCHHH
Q ss_conf             999870---98953-----3234698999999999925796799991567832410003686788999599994287110
Q 002655          233 AIGKRI---GLSAE-----SWMDKSLEEKALDISNILSRKKFVLLLDDIWQPIDLTELGIPLQSLNVSSKVVFTTRSLDV  304 (896)
Q Consensus       233 ~i~~~l---~~~~~-----~~~~~~~~~~~~~l~~~l~~k~~LlVlDdv~~~~~~~~~~~~~~~~~~gs~IiiTtR~~~v  304 (896)
                      .+...+   +....     .............+...+.++++|+||||||+...|..+.      ..||+||+|||+..+
T Consensus        96 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~~kr~LlVLDDv~~~~~~~~~~------~~~srilvTTR~~~v  169 (277)
T d2a5yb3          96 FTDILLMLKSEDDLLNFPSVEHVTSVVLKRMICNALIDRPNTLFVFDDVVQEETIRWAQ------ELRLRCLVTTRDVEI  169 (277)
T ss_dssp             HHHHHHHHTTTSCCTTCCCCTTCCHHHHHHHHHHHHTTSTTEEEEEEEECCHHHHHHHH------HTTCEEEEEESBGGG
T ss_pred             HHHHHHHHHCCHHHCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEECCHHHHHHHHHHHC------CCCCEEEEEEEHHHH
T ss_conf             99999987220220278632123369999999999844688167525066776655520------457559999644899


Q ss_pred             HCCCCCC-CEEEECCCCHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHCCCCHHHHHHHHHHHCCCCCHHHHHHHHHH
Q ss_conf             0247887-338823479588999999861786447991179999999999199604999999984379993289999998
Q 002655          305 CGSMEAD-EKIEVKYLVHDEAWRLFQEKVGEATLRCHSDILELAQTLARECCGLPLALKTIGRAMAYKKNPDEWKYATKV  383 (896)
Q Consensus       305 ~~~~~~~-~~~~l~~L~~~ea~~lf~~~~~~~~~~~~~~~~~~~~~i~~~c~glPlai~~~~~~l~~~~~~~~w~~~~~~  383 (896)
                      +..+... +.|++++|+.+|||+||.++++...  ..+..++++++|+++|+|+|||++++|+.++. ++.+.|.+..+.
T Consensus       170 ~~~~~~~~~~~~l~~L~~~ea~~Lf~~~~~~~~--~~~~~~~~~~~iv~~c~GlPLAl~~ig~~l~~-k~~~~~~~~~~~  246 (277)
T d2a5yb3         170 SNAASQTCEFIEVTSLEIDECYDFLEAYGMPMP--VGEKEEDVLNKTIELSSGNPATLMMFFKSCEP-KTFEKMAQLNNK  246 (277)
T ss_dssp             GGGCCSCEEEEECCCCCHHHHHHHHHHTSCCCC----CHHHHHHHHHHHHHTTCHHHHHHHHTTCCS-SSHHHHHHHHHH
T ss_pred             HHHCCCCCCEEECCCCCHHHHHHHHHHHHCCCC--CCHHHHHHHHHHHHHHCCCHHHHHHHHHHHCC-CCHHHHHHHHHH
T ss_conf             986378871687788997999999999847766--74256799999999958998999999998655-989999999999


Q ss_pred             HCCCCCCCCCCHHHHHHHHHHCCCCCCCHHHHHHHHHH
Q ss_conf             33798857997377996886401899961335898450
Q 002655          384 LSTSPEKFSGMEENVFARLKFSYDSLPNYIIRSCFLYC  421 (896)
Q Consensus       384 l~~~~~~~~~~~~~~~~~l~~sy~~L~~~~~k~cfl~~  421 (896)
                      +.....      .++..++.+||++||+ ++|.||.++
T Consensus       247 L~~~~~------~~v~~il~~sY~~L~~-~lk~c~~~l  277 (277)
T d2a5yb3         247 LESRGL------VGVECITPYSYKSLAM-ALQRCVEVL  277 (277)
T ss_dssp             HHHHCS------STTCCCSSSSSSSHHH-HHHHHHHTS
T ss_pred             HHCCCH------HHHHHHHHHHHHCCCH-HHHHHHHHC
T ss_conf             734867------8899999998851269-999999739
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} Back     information, alignment and structure
>d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g5ta_ c.37.1.11 (A:) ATP:corrinoid adenosyltransferase CobA {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure