Citrus Sinensis ID: 002663

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-----

MAEAAVNFALETLGPLLVEEIRLFGGVRKEVQSIKSELESLRSFLKDADTRAAVEELEGGGEESVRTWVKQLRDEAYRIEDFIDEYALMVAKLPHESGLVGVLHRISRFIKKLRRRRGVATEIQDSESALADIKRRGESYRFRSIDEPSRSGTRNVIPHDSPVRSFFVEDDEVVGIESIKDKLIDLMVNGRSKSSVVAVVGEGGLGKTTLAGKLFNNEGLKTHFSCRAWVTVGKEYNKNDLLRTIIKEFHRLSKHGRDGPDRHAEGPLEGQKDVEHALLDNKKCSRIIVTTRHMNVAKFCKSSSSVRIHELETLPPDEAWKLFCRKAFGPSSGGCCPSELKEFFIVALGGLLSTKNRIVSEWKKLFDSDPHLKDCNRVLSEGYYDLPHHLKSCLLYFGLFPESCKINRGRLIRLWIAEGFVQYRKRLTSEQVAAEYLDELIDRSLVQVSNREIPGRAIICQVHDLMHEIIIRKTEELGFGRLLNGEDSSHCSKTRRITIQRSIDDGALESIKDWKVRSVILFNVDKLPDSFMKSCIANFKLMKVLDLEDSPINYLPEGVGNLFNLHLLNARNTKLKIIPKSIGNLLSLEILVLARTFVSELPEEIRNLKKLRSLIVFHYKYITGSIIPTEVAAKIHRGFGSLRGLLVLSTIEADSQVLKELMMLRQLRMLSIRPQNGNGRDLCALIANLENVETLGVLMTSKEEILDLQSLSSPPQHLRYLSLRGNMKKLPDWILKLKNLIGLRLILSGLTEDPISILQALPNLLELMLHGGYDYELFHFEAGWFPKLRKLVLLNFEAVKLVIIEKGAMPDIRELWSGPCPLLMEIPIGIEHLRNLELFTFHDMSKQVCCMTKNEKWEVTEHIPDVRVTYIDAGQLFYCPKKVLSSLSCRFRAIC

cHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccEEEEccccHHHHHHHHHccccccEEEEEEccccccHHHHHHHHccccccccccccEEEEEEcccccHHHHHHHHHHHHHHHHcccccccEEEccccHHHHHHHHHHccccccccEEEEEcccHHHHHHccccccccEEccccccHHHHHHHHHHHHcccccccccccccccHHHHHHHHHcccccccHHHHHHHHHccccHHHHHHHHHcccccccccHHHHHcccccccccccccHHHHHHHHHHcccccccccccHHHHHHHHHHHHHccccEEEEEccccccccEEEEcHHHHHHHHHHHHHHccEEEEccccccccccEEEEEEEcccccccccccccccEEEEEEEcccccccHHHHHccccccEEEEEEEccccccccccccccccccccccccccccccccccccccccccEEEccccccccccHHHHccccccEEEEcccccccccccccccccccccccccccccccccEEEccHHHHHHHHccccccEEEEEEcccccHHHHHHHHccccccEEEEEEcccccccccccccccccccEEEEEEEEcccccccccccccccEEEEEEEcccccccccccccccccEEEEEEcccccEEEEcccccccccEEEEcccccccEEEEcccccccccEEEEEcccccccccccccccccccEEEEEcccHHHHHHcccccccccccccEEEEEEEEcccEEEccHHHcccccccHHccc

cHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccHHcEccccccHHHHHHHHHccccccEEEEEEccccccHHHHHHHHcccHHHHccccEEEEEEEcccccHHHHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHccccccccEEEEEEcHHHHHHHHccccccEEEEcccccHHHHHHHHHHHHccccccccccHHccHHHHHHHHHHHHcccccHHHHHHHHHccccHHHHHHHHHccHHHcccccccHEEEEEEccccccccHHHHHHHHHHHccEcccccccHHHHHHHHHHHHHHcccEEEEEEcccccEEEEEHHHHHHHHHHHHHHHccEEEEEccccccccccEEEEEEEEccccccccccccccEEEEEEEccccccHHHHHHHHHHccEEEEEEcccccHHHccHHHHHHHHHHHccccccccccccHHHHHHHcccEEcccccccccccHHHHHHHHHHHEEEcccccccccccccccccccccccccHHHHHHccEEcccHHHHHHHHHHHHHHHEEEccccccHHHHHHHHHHcccccEEEEEEcccccEccHHccccccHHHHEEEEcccHHHccHHHccccccEEEEEEcccccccHHHHHHHccccEEEEEEccccccEEEEccccccccEEEEEcccccccEEEEcccccccccEEEEcccHHHcccccHHHHHHHHcEEEEccccHHHHHHccccccEEEEcccEEEEEEcccccccHHHHHHHHHcHHHHEEcc

MAEAAVNFALETLGPLLVEEIRLFGGVRKEVQSIKSELESLRSFLKDADTRAAVEELEGGGEESVRTWVKQLRDEAYRIEDFIDEYALMVAKlphesglvGVLHRISRFIKKLRRRRGVATEIQDSESALADIKRRgesyrfrsidepsrsgtrnviphdspvrsffveddevvgIESIKDKLIDLMVNGRSKSSVVAVVgegglgkttlagklfnneglkthfSCRAWVTvgkeynknDLLRTIIKEFHRLskhgrdgpdrhaegplegqkDVEHALldnkkcsrIIVTTRHMNVAKFckssssvriheletlppdeAWKLFcrkafgpssggccpseLKEFFIVALGGLLSTKNRIVSEWKklfdsdphlkdcnrvlsegyydlphhLKSCLLyfglfpesckinrgRLIRLWIAEGFVQYRKRLTSEQVAAEYLDELIDrslvqvsnreipgraIICQVHDLMHEIIIRKTEelgfgrllngedsshcsktrRITIQRSIDDGALESIKDWKVRSVILFNvdklpdsfMKSCIANfklmkvldledspinylpegvgnlfNLHLLNARNTKLKIIPKSIGNLLSLEILVLARTFVSELPEEIRNLKKLRSLIVFHYKYitgsiiptEVAAKIHRGFGSLRGLLVLSTIEADSQVLKELMMLRQLRMlsirpqngngrDLCALIANLENVETLGVLMTSKeeildlqslssppqhlryLSLRGNMKKLPDWILKLKNLIGLRLIlsgltedpiSILQALPNLLELMLhggydyelfhfeagwfpklRKLVLLNFEAVKLVIIekgampdirelwsgpcpllmeipiGIEHlrnlelftfhdmskqvccmtknekwevtehipdvrvtyidagqlfycpkkvlsslscrfraic

MAEAAVNFaletlgpllVEEIRLFGGVRKEVQSIKSELESLRSFLKDADTRAAVEelegggeesvrtwVKQLRDEAYRIEDFIDEYALMVAKLPhesglvgvLHRISRFIKklrrrrgvateiqdsesaladikrrgesyrfrsidepsrsgtrnviphdspvrsffveddevVGIESIKDKLIDLMVNGRSKSSVVAVVGEGGLGKTTLAGKLFNNEGLKTHFSCRAWVTvgkeynkndLLRTIIKEFHrlskhgrdgpdrhaegplegQKDVEHALLDNKKCSRIIVTTRHMNVAKfckssssvriheLETLPPDEAWKLFCRKAFGPSSGGCCPSELKEFFIVALGGLLSTKNRIVSEwkklfdsdphlKDCNRVLSEGYYDLPHHLKSCLLYFGLFPESCKINRGRLIRLWIAEGFVQYRKRLTSEQVAAEYLDELIDRSLVQVSNREIPGRAIICQVHDLMHEIIIRKTEelgfgrllngedsshcsktrritiqrsiddgalesikdwkvrSVILFNVDKLPDSFMKSCIANFKLMKVLDLEDSPINYLPEGVGNLFNLHLLNARNTKLKIIPKSIGNLLSLEILVLARTFVSELPEEIRNLKKLRSLIVFHYKYITGSIIPTEVAAKIHRGFGSLRGLLVLSTIEADSQVLKELMMLRQLRMLSIRPQNGNGRDLCALIANLENVETLGVLMTSKEEILDLQSLSSPPQHLRYLSLRGNMKKLPDWILKLKNLIGLRLILSGLTEDPISILQALPNLLELMLHGGYDYELFHFEAGWFPKLRKLVLLNFEAVKLVIiekgampdiRELWSGPCPLLMEIPIGIEHLRNLELFTFHDMSKQVCCMTKNEKWEVTEHIPDVRVTYIDAGQLFYCPKkvlsslscrfraic

MAEAAVNFALETLGPLLVEEIRLFGGVRKEVQSIKSELESLRSFLKDADTRAAVeelegggeeSVRTWVKQLRDEAYRIEDFIDEYALMVAKLPHESGLVGVLHRISRFIKKLRRRRGVATEIQDSESALADIKRRGESYRFRSIDEPSRSGTRNVIPHDSPVRSFFVEDDEVVGIESIKDKLIDLMVNGRSKSSVVAVVgegglgkttlagklFNNEGLKTHFSCRAWVTVGKEYNKNDLLRTIIKEFHRLSKHGRDGPDRHAEGPLEGQKDVEHALLDNKKCSRIIVTTRHMNVAKFCKSSSSVRIHELETLPPDEAWKLFCRKAFGPSSGGCCPSELKEFFIVALGGLLSTKNRIVSEWKKLFDSDPHLKDCNRVLSEGYYDLPHHLKSCLLYFGLFPESCKINRGRLIRLWIAEGFVQYRKRLTSEQVAAEYLDELIDRSLVQVSNREIPGRAIICQVHDLMHEIIIRKTEELGFGRLLNGEDSSHCSKTRRITIQRSIDDGALESIKDWKVRSVILFNVDKLPDSFMKSCIANFKLMKVLDLEDSPINYLPEGVGNLFNLHLLNARNTKLKIIPKSIGNLLSLEILVLARTFVSELPEEIRNLKKLRSLIVFHYKYITGSIIPTEVAAKIHRGFGSLRGLLVLSTIEADSQVLKELMMLRQLRMLSIRPQNGNGRDLCALIANLENVETLGVLMTSKEEILDLQSLSSPPQHLRYLSLRGNMKKLPDWILKLKNLIGLRLILSGLTEDPISILQALPNLLELMLHGGYDYELFHFEAGWFPKLRKLVLLNFEAVKLVIIEKGAMPDIRELWSGPCPLLMEIPIGIEHLRNLELFTFHDMSKQVCCMTKNEKWEVTEHIPDVRVTYIDAGQLFYCPKKVLSSLSCRFRAIC

*****VNFALETLGPLLVEEIRLFGGVRKEVQSI*****************************SVRTWVKQLRDEAYRIEDFIDEYALMVAKLPHESGLVGVLHRISRFIKKLRRRRGV*******************************************VRSFFVEDDEVVGIESIKDKLIDLMVNGRSKSSVVAVVGEGGLGKTTLAGKLFNNEGLKTHFSCRAWVTVGKEYNKNDLLRTIIKEFHR*************************ALLDNKKCSRIIVTTRHMNVAKFCKSSSSVRIHELETLPPDEAWKLFCR*************ELKEFFIVALGGLLSTKNRIVSEWKKLFDSDPHLKDCNRVLSEGYYDLPHHLKSCLLYFGLFPESCKINRGRLIRLWIAEGFVQYRKRLTSEQVAAEYLDELIDRSLVQVSNREIPGRAIICQVHDLMHEIIIRKTEELGFGRLLNGEDSSHCSKTRRITIQRSIDDGALESIKDWKVRSVILFNVDKLPDSFMKSCIANFKLMKVLDLEDSPINYLPEGVGNLFNLHLLNARNTKLKIIPKSIGNLLSLEILVLARTFVSELPEEIRNLKKLRSLIVFHYKYITGSIIPTEVAAKIHRGFGSLRGLLVLSTIEADSQVLKELMMLRQLRMLSIRPQNGNGRDLCALIANLENVETLGVLMTSKEEILDLQ*******HLRYLSLRGNMKKLPDWILKLKNLIGLRLILSGLTEDPISILQALPNLLELMLHGGYDYELFHFEAGWFPKLRKLVLLNFEAVKLVIIEKGAMPDIRELWSGPCPLLMEIPIGIEHLRNLELFTFHDMSKQVCCMTKNEKWEVTEHIPDVRVTYIDAGQLFYCPKKVLSSLSCRFRA**

MAEAAVNFALETLGPLLVEEIRLFGGVRKEVQSIKSELESLRSFLKDADTRAAVEELEGGGEESVRTWVKQLRDEAYRIEDFIDEYALMV**************RISRFIKKLRRRRGVATEIQDSESALADIKRRGE**************************SFFVEDDEVVGIESIKDKLIDLMVNGRSKSSVVAVVGEGGLGKTTLAGKLFNNEGLKTHFSCRAWVTVGKEYNKNDLLRTIIKEFHRLSKHGRDGPDRHAEGPLEGQKDVEHALLDNKKCSRIIVTTRHMNVAKFCKSSSSVRIHELETLPPDEAWKLFCRKAFGPSSGGCCPSELKEFFIVALGGLLSTKNRIVSEWKKLFDSDPHLKDCNRVLSEGYYDLPHHLKSCLLYFGLFPESCKINRGRLIRLWIAEGFVQYRKRLTSEQVAAEYLDELIDRSLVQVSNREIPGRAIICQVHDLMHEIIIRKTEELGFGRLL*********KTRRITIQRSIDDGALESIKDWKVRSVILFNVDKLPDSFMKSCIANFKLMKVLDLEDSPINYLPEGVGNLFNLHLLNARNTKLKIIPKSIGNLLSLEILVLARTFVSELPEEIRNLKKLRSLIVFHYKYITGSIIPTEVAAKIHRGFGSLRGLLVLSTIEADSQVLKELMMLRQLRMLSIRPQNGNGRDLCALIANLENVETLGVLMTSKEEILDLQSLSSPPQHLRYLSLRGNMKKLPDWILKLKNLIGLRLILSGLTEDPISILQALPNLLELMLHGGYDYELFHFEAGWFPKLRKLVLLNFEAVKLVIIEKGAMPDIRELWSGPCPLLMEIPIGIEHLRNLELFTFHDMSKQVCCMTKNEKWEVTEHIPDVRVTYIDAGQLFYCPKKVLSSLSCRFRAIC

MAEAAVNFALETLGPLLVEEIRLFGGVRKEVQSIKSELESLRSFLKDADTRAAV**********VRTWVKQLRDEAYRIEDFIDEYALMVAKLPHESGLVGVLHRISRFIK**********EIQDSESALADIKRRGESYRFRSIDEPSRSGTRNVIPHDSPVRSFFVEDDEVVGIESIKDKLIDLMVNGRSKSSVVAVVGEGGLGKTTLAGKLFNNEGLKTHFSCRAWVTVGKEYNKNDLLRTIIKEFHRLSKHGRDGPDRHAEGPLEGQKDVEHALLDNKKCSRIIVTTRHMNVAKFCKSSSSVRIHELETLPPDEAWKLFCRKAFGPSSGGCCPSELKEFFIVALGGLLSTKNRIVSEWKKLFDSDPHLKDCNRVLSEGYYDLPHHLKSCLLYFGLFPESCKINRGRLIRLWIAEGFVQYRKRLTSEQVAAEYLDELIDRSLVQVSNREIPGRAIICQVHDLMHEIIIRKTEELGFGRLLNGEDSSHCSKTRRITIQRSIDDGALESIKDWKVRSVILFNVDKLPDSFMKSCIANFKLMKVLDLEDSPINYLPEGVGNLFNLHLLNARNTKLKIIPKSIGNLLSLEILVLARTFVSELPEEIRNLKKLRSLIVFHYKYITGSIIPTEVAAKIHRGFGSLRGLLVLSTIEADSQVLKELMMLRQLRMLSIRPQNGNGRDLCALIANLENVETLGVLMTSKEEILDLQSLSSPPQHLRYLSLRGNMKKLPDWILKLKNLIGLRLILSGLTEDPISILQALPNLLELMLHGGYDYELFHFEAGWFPKLRKLVLLNFEAVKLVIIEKGAMPDIRELWSGPCPLLMEIPIGIEHLRNLELFTFHDMSKQVCCMTKNEKWEVTEHIPDVRVTYIDAGQLFYCPKKVLSSLSCRFRAIC

MAEAAVNFALETLGPLLVEEIRLFGGVRKEVQSIKSELESLRSFLKDADTRAAVEELEGGGEESVRTWVKQLRDEAYRIEDFIDEYALMVAKLPHESGLVGVLHRISRFIKKLRRRRGVATEIQDSESALADIKRRGESYRFR*******************VRSFFVEDDEVVGIESIKDKLIDLMVNGRSKSSVVAVVGEGGLGKTTLAGKLFNNEGLKTHFSCRAWVTVGKEYNKNDLLRTIIKEFHRLSKHGRDGPDRHAEGPLEGQKDVEHALLDNKKCSRIIVTTRHMNVAKFCKSSSSVRIHELETLPPDEAWKLFCRKAFGPSSGGCCPSELKEFFIVALGGLLSTKNRIVSEWKKLFDSDPHLKDCNRVLSEGYYDLPHHLKSCLLYFGLFPESCKINRGRLIRLWIAEGFVQYRKRLTSEQVAAEYLDELIDRSLVQVSNREIPGRAIICQVHDLMHEIIIRKTEELGFGRLLNGEDSSHCSKTRRITIQRSIDDGALESIKDWKVRSVILFNVDKLPDSFMKSCIANFKLMKVLDLEDSPINYLPEGVGNLFNLHLLNARNTKLKIIPKSIGNLLSLEILVLARTFVSELPEEIRNLKKLRSLIVFHYKYITGSIIPTEVAAKIHRGFGSLRGLLVLSTIEADSQVLKELMMLRQLRMLSIRPQNGNGRDLCALIANLENVETLGVLMTSKEEILDLQSLSSPPQHLRYLSLRGNMKKLPDWILKLKNLIGLRLILSGLTEDPISILQALPNLLELMLHGGYDYELFHFEAGWFPKLRKLVLLNFEAVKLVIIEKGAMPDIRELWSGPCPLLMEIPIGIEHLRNLELFTFHDMSKQVCCMTKNEKWEVTEHIPDVRVTYIDAGQLFYCPKKVLSSLSCRFRAIC

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		895	2.2.26 [Sep-21-2011]
Q39214		926	Disease resistance protei	yes	no	0.941	0.910	0.297	7e-93
Q9M667		835	Disease resistance protei	no	no	0.849	0.910	0.282	2e-65
Q8W4J9		908	Disease resistance protei	no	no	0.927	0.914	0.266	3e-63
Q9FJK8		908	Probable disease resistan	no	no	0.909	0.896	0.275	9e-63
Q9STE7		847	Putative disease resistan	no	no	0.655	0.693	0.295	2e-62
Q9FJB5		901	Disease resistance RPP8-l	no	no	0.920	0.914	0.263	3e-61
P59584		910	Disease resistance protei	no	no	0.912	0.897	0.265	1e-60
Q8W474		907	Probable disease resistan	no	no	0.918	0.906	0.272	3e-59
Q9LQ54		870	Probable disease resistan	no	no	0.897	0.922	0.265	3e-57
P0C8S1		906	Probable disease resistan	no	no	0.919	0.908	0.249	2e-55

>sp\|Q39214\|RPM1_ARATH Disease resistance protein RPM1 OS=Arabidopsis thaliana GN=RPM1 PE=1 SV=1	Back alignment and function desciption

 Score =  342 bits (878), Expect = 7e-93,   Method: Compositional matrix adjust.
 Identities = 284/956 (29%), Positives = 467/956 (48%), Gaps = 113/956 (11%)

Query: 1   MAEAAVNFALETLGPLLVEEIRLFGGVRKEVQSIKSELESLRSFLKDADTRAAVEELEGG 60
           MA A V+F +  +  +L  E  L  GV  E+  +K EL  ++SFL+D           G 
Sbjct: 1   MASATVDFGIGRILSVLENETLLLSGVHGEIDKMKKELLIMKSFLEDTHKHG------GN 54

Query: 61  GEESVRTW-----VKQLRDEAYRIEDFIDEYALMVAKLPHESGLVGVLHRISRFIKKLRR 115
           G  +  T      V   RD AY+IED +DE+   +    H       + R   F + +  
Sbjct: 55  GSTTTTTQLFQTFVANTRDLAYQIEDILDEFGYHI----HGYRSCAKIWRAFHFPRYMWA 110

Query: 116 RRGVATEIQDSESALADI----KRRGESYRFRS-----IDEPSRSGTRNVIPHDSPVRSF 166
           R  +A ++      +  I    KR   S  +++     ID+       N+        S 
Sbjct: 111 RHSIAQKLGMVNVMIQSISDSMKRYYHSENYQAALLPPIDDGDAKWVNNI-----SESSL 165

Query: 167 FVEDDEVVGIESIKDKLIDLMVNGRSKSSVVAVVGEGGLGKTTLAGKLFNNEGLKTHFSC 226
           F  ++ +VGI++ K KLI  +++   +  VVAVVG GG GKTTL+  +F ++ ++ HF  
Sbjct: 166 FFSENSLVGIDAPKGKLIGRLLSPEPQRIVVAVVGMGGSGKTTLSANIFKSQSVRRHFES 225

Query: 227 RAWVTVGKEYNKNDLLRTIIKEFHR----------LSKHGRDGPDRHAEGPLEGQK---- 272
            AWVT+ K Y   D+ RT+IKEF++           S   R+  ++  E  L+ ++    
Sbjct: 226 YAWVTISKSYVIEDVFRTMIKEFYKEADTQIPAELYSLGYRELVEKLVEY-LQSKRYIVV 284

Query: 273 -----------DVEHALLDNKKCSRIIVTTRHMNVAKFCKSSSSVRIHELETLPPDEAWK 321
                      ++  AL D    SR+++TTR MNVA F     S + HE+E L  DEAW 
Sbjct: 285 LDDVWTTGLWREISIALPDGIYGSRVMMTTRDMNVASFPYGIGSTK-HEIELLKEDEAWV 343

Query: 322 LFCRKAFGPSSGGCCPSELKE-------------FFIVALGGLLSTKNRIVSEWKKLF-- 366
           LF  KAF  S   C    L+                I +LG ++STK +  SEWKK++  
Sbjct: 344 LFSNKAFPASLEQCRTQNLEPIARKLVERCQGLPLAIASLGSMMSTK-KFESEWKKVYST 402

Query: 367 -----DSDPHLKDCNRVLSEGYYDLPHHLKSCLLYFGLFPESCKINRGRLIRLWIAEGFV 421
                +++  LK    ++   + DLP+ LK C LY  LFP + ++ R RLIR+W+A+ FV
Sbjct: 403 LNWELNNNHELKIVRSIMFLSFNDLPYPLKRCFLYCSLFPVNYRMKRKRLIRMWMAQRFV 462

Query: 422 QYRKRLTSEQVAAEYLDELIDRSLVQVSNREIPGRAIICQVHDLMHEIIIRKTEELGFGR 481
           +  + + +E+VA  YL+EL+ R+++QV      GR    ++HD++ EI +  ++   F  
Sbjct: 463 EPIRGVKAEEVADSYLNELVYRNMLQVILWNPFGRPKAFKMHDVIWEIALSVSKLERFCD 522

Query: 482 LLN----GEDSSHCSK---TRRITIQRSIDDGALESIKDWKVRSVILFNVDKLPDSFMKS 534
           + N    G+D++   +   +R + IQ+ +     +SI+   + S+++ +  K     + S
Sbjct: 523 VYNDDSDGDDAAETMENYGSRHLCIQKEMTP---DSIRATNLHSLLVCSSAKHKMELLPS 579

Query: 535 CIANFKLMKVLDLEDSPINYLPEGVGNLFNLHLLNARNTKLKIIPKSIGNLLSLEILVLA 594
                 L++ LDLEDS I+ LP+ +  +FNL  LN   T++K +PK+   L++LE L   
Sbjct: 580 ----LNLLRALDLEDSSISKLPDCLVTMFNLKYLNLSKTQVKELPKNFHKLVNLETLNTK 635

Query: 595 RTFVSELPEEIRNLKKLRSLIVF--------HYKYITGSIIPTEVAAKIHRGFGSLRGLL 646
            + + ELP  +  LKKLR LI F        ++ Y+ G    T V  KI +    L+ L 
Sbjct: 636 HSKIEELPLGMWKLKKLRYLITFRRNEGHDSNWNYVLG----TRVVPKIWQ----LKDLQ 687

Query: 647 VLSTIEADSQVLKELMMLRQLRMLS-IRPQNGNGRDLCALIANLENVETLGVLMTSKEEI 705
           V+    A+ +++K L  + QL  +S +  +  +GRDLC  +  ++ +  L +    +EE 
Sbjct: 688 VMDCFNAEDELIKNLGCMTQLTRISLVMVRREHGRDLCDSLNKIKRIRFLSLTSIDEEEP 747

Query: 706 LDLQSLSSPPQHLRYLSLRGNMKKLPDWILKLKNLIGLRLILSGLTEDPISILQALPNLL 765
           L++  L +    +  L L G ++++P W   L+NL  L L  S L E+ I  +Q LP L+
Sbjct: 748 LEIDDLIATAS-IEKLFLAGKLERVPSWFNTLQNLTYLGLRGSQLQENAILSIQTLPRLV 806

Query: 766 ELMLHGGYDYELFHFEAGWFPKLRKLVLLNFEAVKLVIIEKGAMPDIRELWSGPCPLLME 825
            L  +  Y      F  G F  L+ L ++  + +  V+IE GAM ++++L+   C  L  
Sbjct: 807 WLSFYNAYMGPRLRFAQG-FQNLKILEIVQMKHLTEVVIEDGAMFELQKLYVRACRGLEY 865

Query: 826 IPIGIEHLRNLELFTFHDMSKQVCCMTKNE---KWEVTEHIPDVRVTYIDAGQLFY 878
           +P GIE+L NL+      +S Q+    + E        +HIP ++  +      FY
Sbjct: 866 VPRGIENLINLQELHLIHVSNQLVERIRGEGSVDRSRVKHIPAIKHYFRTDNGSFY 921

Disease resistance (R) protein that specifically recognizes the AvrRpm1 type III effector avirulence protein from Pseudomonas syringae. Resistance proteins guard the plant against pathogens that contain an appropriate avirulence protein via an indirect interaction with this avirulence protein. That triggers a defense system including the hypersensitive response, which restricts the pathogen growth. Acts via its interaction with RIN4, and probably triggers the plant resistance when RIN4 is phosphorylated by AvrRpm1. It is then degraded at the onset of the hypersensitive response.
Arabidopsis thaliana (taxid: 3702)

>sp\|Q9M667\|RPP13_ARATH Disease resistance protein RPP13 OS=Arabidopsis thaliana GN=RPP13 PE=2 SV=2	Back alignment and function description

>sp\|Q8W4J9\|RPP8_ARATH Disease resistance protein RPP8 OS=Arabidopsis thaliana GN=RPP8 PE=1 SV=2	Back alignment and function description

>sp\|Q9FJK8\|RP8L4_ARATH Probable disease resistance RPP8-like protein 4 OS=Arabidopsis thaliana GN=RPP8L4 PE=2 SV=1	Back alignment and function description

>sp\|Q9STE7\|R13L3_ARATH Putative disease resistance RPP13-like protein 3 OS=Arabidopsis thaliana GN=RPP13L3 PE=3 SV=1	Back alignment and function description

>sp\|Q9FJB5\|RP8L3_ARATH Disease resistance RPP8-like protein 3 OS=Arabidopsis thaliana GN=RPP8L3 PE=2 SV=1	Back alignment and function description

>sp\|P59584\|RP8HA_ARATH Disease resistance protein RPH8A OS=Arabidopsis thaliana GN=RPH8A PE=3 SV=1	Back alignment and function description

>sp\|Q8W474\|DRL7_ARATH Probable disease resistance protein At1g58390 OS=Arabidopsis thaliana GN=At1g58390 PE=2 SV=4	Back alignment and function description

>sp\|Q9LQ54\|DRL12_ARATH Probable disease resistance protein At1g59620 OS=Arabidopsis thaliana GN=At1g59620 PE=2 SV=3	Back alignment and function description

>sp\|P0C8S1\|RP8L2_ARATH Probable disease resistance RPP8-like protein 2 OS=Arabidopsis thaliana GN=RPP8L2 PE=1 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		895
147771834		891	hypothetical protein VITISV_025806 [Viti	0.944	0.948	0.414	1e-172
356515318		943	PREDICTED: disease resistance protein RP	0.965	0.916	0.396	1e-171
225465431		919	PREDICTED: disease resistance protein RP	0.955	0.930	0.407	1e-171
356515316		944	PREDICTED: disease resistance protein RP	0.960	0.911	0.397	1e-171
224122320		926	cc-nbs-lrr resistance protein [Populus t	0.944	0.912	0.386	1e-170
255582947		935	Disease resistance protein RPM1, putativ	0.934	0.894	0.402	1e-170
359480122		934	PREDICTED: disease resistance protein RP	0.965	0.925	0.402	1e-167
359480124		924	PREDICTED: disease resistance protein RP	0.956	0.926	0.403	1e-167
225465433		908	PREDICTED: disease resistance protein RP	0.949	0.936	0.389	1e-166
356515314		926	PREDICTED: disease resistance protein RP	0.955	0.923	0.383	1e-160

>gi\|147771834\|emb\|CAN60255.1\| hypothetical protein VITISV_025806 [Vitis vinifera]	Back alignment and taxonomy information

 Score =  613 bits (1581), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 371/894 (41%), Positives = 529/894 (59%), Gaps = 49/894 (5%)

Query: 1   MAEAAVNFALETLGPLLVEEIRLFGGVRKEVQSIKSELESLRSFLKDADTRAAVEELEGG 60
           MAE AVN  ++ L PLL +E RL GGV  +V+ IK EL  +++FL DAD +    ++  G
Sbjct: 1   MAEIAVNLVIDKLLPLLDQEARLLGGVHTQVEDIKKELLYIQAFLMDADAKGEKADVSQG 60

Query: 61  GEESVRTWVKQLRDEAYRIEDFIDEYALMVAKLPHESGLVGVLHRISRFIKKLRRRRGVA 120
               ++TW++ LR+ AY IED IDEY L +         +G L ++ R IKKL+RRR VA
Sbjct: 61  ----LKTWIQDLRETAYSIEDVIDEYLLHLGNPSQRHRFIGFLCKVGRLIKKLKRRREVA 116

Query: 121 TEIQDSESALADIKRRGESYRFRSIDEPSRSGTRNVIP-HDSPVRSFFVEDDEVVGIESI 179
           ++I+D +  +  +K    ++ F S  +P   G     P HD  V S F++D E+VGIES 
Sbjct: 117 SKIRDIQKKVLKLKETSSTHGFISSVQPGSGGRSTSAPWHDPRVTSLFIDDAEIVGIESQ 176

Query: 180 KDKLIDLMVNGRSKSSVVAVVGEGGLGKTTLAGKLFNNEGLKTHFSCRAWVTVGKEYNKN 239
           K +L   +V G  K +V++VVG GGLGKTTLA K++ N+ L  HF C AW+TV + +   
Sbjct: 177 KIELTSRLVEGTPKRTVISVVGMGGLGKTTLANKIYENKXLVGHFDCSAWITVSQSFKME 236

Query: 240 DLLRTIIKEFHRLSKHGRDGPDRHAEGPLEGQKDVEHALLDNKKCSRIIVTTRHMNVAKF 299
           +LLR +  +F+           R    P +    +++ L +NKK SRII+TTR+  VA  
Sbjct: 237 ELLRNMSMKFYE---------ARKEPVPEDFWGFIKYVLPENKKGSRIIITTRNDEVASS 287

Query: 300 CKSSSSVRIHELETLPPDEAWKLFCRKAFGPSSGGCCPSELKEF-------------FIV 346
           CK SS   IH+L+ LPP  +W+LFC+KAF     G CP EL++               IV
Sbjct: 288 CKESSFDYIHKLQPLPPKSSWELFCKKAFQ----GGCPPELEKLSHDIVRRCGGLPLAIV 343

Query: 347 ALGGLLSTKNRIVSEWKKLFD-------SDPHLKDCNRVLSEGYYDLPHHLKSCLLYFGL 399
           A+GGLLS K ++VSEW+K  D       S+ HL+  N +L   Y+DLP++LKSC LY  +
Sbjct: 344 AIGGLLSRKEKLVSEWQKFNDTIGCELQSNSHLESINTILFLSYHDLPYYLKSCFLYLAI 403

Query: 400 FPESCKINRGRLIRLWIAEGFVQYRKRLTSEQVAAEYLDELIDRSLVQVSNREIPGRAII 459
           FPE   I  G L RLWIAEGFV+ ++ +T E+VA E+L EL  RSLVQVS     GR   
Sbjct: 404 FPEDYTIRCGPLTRLWIAEGFVKTKRGVTLEEVAEEFLTELRHRSLVQVSKVSADGRIKH 463

Query: 460 CQVHDLMHEIIIRKTEELGFGRLLNGEDSSHCSKTRRITIQRSIDDGALESIKDWKVRSV 519
           C VHDLM EII+ K EEL F  ++ G  SS   + RR+++  S ++ A  + K   +RS+
Sbjct: 464 CHVHDLMREIILTKAEELSFCCVMTGGTSSFDGRFRRLSVHNSPNNVANITGKKSYIRSI 523

Query: 520 ILFNVDKLPDSFMKSCIANFKLMKVLDLEDSPINYLPEGVGNLFNLHLLNARNTKLKIIP 579
            L++       F++   + F L+KVLD++DS ++ +PE +GNL +L  L+ RNTK++++P
Sbjct: 524 FLYDSQTF---FLEKWASRFNLLKVLDIDDSGLDSVPENLGNLLHLRYLSLRNTKVRMLP 580

Query: 580 KSIGNLLSLEILVLARTFVSELPEEIRNLKKLRSLIVFHYKY-ITGSIIPTEVAAKIHRG 638
           +SIG L +L+ L L  T V +LP EI  LKKL +++V +Y   +     P +    +  G
Sbjct: 581 RSIGKLQNLQTLDLRFTLVEDLPVEINRLKKLHNILVHNYDLGVDLGWFPFK-GVHVKEG 639

Query: 639 FGSLRGLLVLSTIEADS--QVLKELMMLRQLRMLSI-RPQNGNGRDLCALIANLENVETL 695
            G L  L  LS +EA+    V+KEL  LRQLR LSI +    NG+ L A I N+  +E+L
Sbjct: 640 IGCLEELQKLSCVEANHGVGVIKELGKLRQLRKLSITKLTRENGKHLXASITNMNRLESL 699

Query: 696 GVLMTSKEEILDLQSLSSPPQHLRYLSLRGNMKKLPDWILKLKNLIGLRLILSGLTEDPI 755
            +   S++EILDLQ +S PP  L  L L G ++KLPDWI +L+NL  + L  S L  DP+
Sbjct: 700 LISSLSEDEILDLQHVSYPPSCLTXLXLIGPLEKLPDWISELQNLSIVXLCGSNLMNDPV 759

Query: 756 SILQALPNLLELMLHGGYDYELFHFEAGWFPKLRKLVLLNFEAVKLVIIEKGAMPDIREL 815
            +LQALP+L  L L      E   FEA  F KL++LV+LN   VK V IE GA+P + +L
Sbjct: 760 QVLQALPSLQLLQLVRASAVEELCFEATGFQKLKRLVVLNLMGVKRVKIENGALPLLEKL 819

Query: 816 WSGPCPLLMEIPIGIEHLRNLELFTFHDMSKQV---CCMTKNEKWEVTEHIPDV 866
             GP P L E+P GI HL  L    F ++ +++      ++   +++ EHIP+V
Sbjct: 820 LVGPFPQLEELPPGIRHLTRLTTLEFINLQEELKLSMIPSRGRNYKIVEHIPNV 873

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|356515318\|ref\|XP_003526348.1\| PREDICTED: disease resistance protein RPM1-like [Glycine max]	Back alignment and taxonomy information

>gi\|225465431\|ref\|XP_002265419.1\| PREDICTED: disease resistance protein RPM1-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|356515316\|ref\|XP_003526347.1\| PREDICTED: disease resistance protein RPM1-like [Glycine max]	Back alignment and taxonomy information

>gi\|224122320\|ref\|XP_002330594.1\| cc-nbs-lrr resistance protein [Populus trichocarpa] gi\|222872152\|gb\|EEF09283.1\| cc-nbs-lrr resistance protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|255582947\|ref\|XP_002532244.1\| Disease resistance protein RPM1, putative [Ricinus communis] gi\|223528062\|gb\|EEF30138.1\| Disease resistance protein RPM1, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|359480122\|ref\|XP_002265617.2\| PREDICTED: disease resistance protein RPM1-like [Vitis vinifera] gi\|147771833\|emb\|CAN60254.1\| hypothetical protein VITISV_025805 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|359480124\|ref\|XP_003632405.1\| PREDICTED: disease resistance protein RPM1-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|225465433\|ref\|XP_002265568.1\| PREDICTED: disease resistance protein RPM1-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|356515314\|ref\|XP_003526346.1\| PREDICTED: disease resistance protein RPM1-like [Glycine max]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		895
TAIR\|locus:2077572		926	RPM1 "RESISTANCE TO P. SYRINGA	0.578	0.559	0.311	5.1e-87
TAIR\|locus:504956483		847	AT3G46730 [Arabidopsis thalian	0.577	0.610	0.274	2.7e-57
TAIR\|locus:2152536		908	AT5G48620 [Arabidopsis thalian	0.573	0.564	0.284	2.3e-55
TAIR\|locus:2176486		908	RPP8 "RECOGNITION OF PERONOSPO	0.573	0.564	0.282	5.8e-55
TAIR\|locus:2075170		835	RPP13 "RECOGNITION OF PERONOSP	0.465	0.499	0.286	7.5e-52
TAIR\|locus:2169523		901	AT5G35450 [Arabidopsis thalian	0.574	0.570	0.264	2.1e-51
TAIR\|locus:2037623		899	AT1G58410 [Arabidopsis thalian	0.530	0.528	0.273	1.2e-48
TAIR\|locus:2102857		847	AT3G46710 [Arabidopsis thalian	0.574	0.606	0.290	1.7e-48
TAIR\|locus:2037639		907	AT1G58390 "AT1G58390" [Arabido	0.560	0.553	0.276	8e-48
TAIR\|locus:2011982		857	AT1G50180 [Arabidopsis thalian	0.262	0.274	0.323	3.2e-47

TAIR\|locus:2077572 RPM1 "RESISTANCE TO P. SYRINGAE PV MACULICOLA 1" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 578 (208.5 bits), Expect = 5.1e-87, Sum P(3) = 5.1e-87
 Identities = 174/558 (31%), Positives = 294/558 (52%)

Query:   345 IVALGGLLSTKNRIVSEWKKLFDS------DPH-LKDCNRVLSEGYYDLPHHLKSCLLYF 397
             I +LG ++STK +  SEWKK++ +      + H LK    ++   + DLP+ LK C LY 
Sbjct:   380 IASLGSMMSTK-KFESEWKKVYSTLNWELNNNHELKIVRSIMFLSFNDLPYPLKRCFLYC 438

Query:   398 GLFPESCKINRGRLIRLWIAEGFVQYRKRLTSEQVAAEYLDELIDRSLVQVSNREIPGRA 457
              LFP + ++ R RLIR+W+A+ FV+  + + +E+VA  YL+EL+ R+++QV      GR 
Sbjct:   439 SLFPVNYRMKRKRLIRMWMAQRFVEPIRGVKAEEVADSYLNELVYRNMLQVILWNPFGRP 498

Query:   458 IICQVHDLMHEIIIRKTEELGFGRLLN----GEDSSHCSK---TRRITIQRSIDDGALES 510
                ++HD++ EI +  ++   F  + N    G+D++   +   +R + IQ+ +     +S
Sbjct:   499 KAFKMHDVIWEIALSVSKLERFCDVYNDDSDGDDAAETMENYGSRHLCIQKEMTP---DS 555

Query:   511 IKDWKVRSVILFNVDKLPDSFMKSCIANFKLMKVLDLEDSPINYLPEGVGNLFNLHLLNA 570
             I+   + S+++ +  K     + S      L++ LDLEDS I+ LP+ +  +FNL  LN 
Sbjct:   556 IRATNLHSLLVCSSAKHKMELLPS----LNLLRALDLEDSSISKLPDCLVTMFNLKYLNL 611

Query:   571 RNTKLKIIPKSIGNLLSLEILVLARTFVSELPEEIRNLKKLRSLIVFHYKYITGS----I 626
               T++K +PK+   L++LE L    + + ELP  +  LKKLR LI F       S    +
Sbjct:   612 SKTQVKELPKNFHKLVNLETLNTKHSKIEELPLGMWKLKKLRYLITFRRNEGHDSNWNYV 671

Query:   627 IPTEVAAKIHRGFGSLRGLLVLSTIEADSQVLKELMMLRQLRMLS-IRPQNGNGRDLCAL 685
             + T V  KI +    L+ L V+    A+ +++K L  + QL  +S +  +  +GRDLC  
Sbjct:   672 LGTRVVPKIWQ----LKDLQVMDCFNAEDELIKNLGCMTQLTRISLVMVRREHGRDLCDS 727

Query:   686 IANLENVETLGVLMTSKEEILDLQSLSSPPQHLRYLSLRGNMKKLPDWILKLKNLIGLRL 745
             +  ++ +  L +    +EE L++  L +    +  L L G ++++P W   L+NL  L L
Sbjct:   728 LNKIKRIRFLSLTSIDEEEPLEIDDLIATAS-IEKLFLAGKLERVPSWFNTLQNLTYLGL 786

Query:   746 ILSGLTEDPISILQALPNLLELMLHGGYDYELFHFEAGWFPKLRKLVLLNFEAVKLVIIE 805
               S L E+ I  +Q LP L+ L  +  Y      F  G F  L+ L ++  + +  V+IE
Sbjct:   787 RGSQLQENAILSIQTLPRLVWLSFYNAYMGPRLRFAQG-FQNLKILEIVQMKHLTEVVIE 845

Query:   806 KGAMPDIRELWSGPCPLLMEIPIGIEHLRNL-ELFTFHDMSKQVCCMTKNE---KWEVTE 861
              GAM ++++L+   C  L  +P GIE+L NL EL   H +S Q+    + E        +
Sbjct:   846 DGAMFELQKLYVRACRGLEYVPRGIENLINLQELHLIH-VSNQLVERIRGEGSVDRSRVK 904

Query:   862 HIPDVRVTY-IDAGQLFY 878
             HIP ++  +  D G  FY
Sbjct:   905 HIPAIKHYFRTDNGS-FY 921

GO:0006952 "defense response" evidence=IEA;ISS;TAS

GO:0043531 "ADP binding" evidence=IEA

GO:0005515 "protein binding" evidence=IPI

GO:0005886 "plasma membrane" evidence=IDA

GO:0000166 "nucleotide binding" evidence=ISS

GO:0009626 "plant-type hypersensitive response" evidence=IDA

TAIR\|locus:504956483 AT3G46730 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2152536 AT5G48620 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2176486 RPP8 "RECOGNITION OF PERONOSPORA PARASITICA 8" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2075170 RPP13 "RECOGNITION OF PERONOSPORA PARASITICA 13" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2169523 AT5G35450 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2037623 AT1G58410 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2102857 AT3G46710 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2037639 AT1G58390 "AT1G58390" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2011982 AT1G50180 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	grail3.0140004801	cc-nbs-lrr resistance protein (927 aa)
		(Populus trichocarpa)
Predicted Functional Partners:
		Sorry, there are no predicted associations at the current settings.

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		895
pfam00931		285	pfam00931, NB-ARC, NB-ARC domain	8e-42
COG4886		394	COG4886, COG4886, Leucine-rich repeat (LRR) protei	6e-08
COG4886		394	COG4886, COG4886, Leucine-rich repeat (LRR) protei	6e-07
COG4886		394	COG4886, COG4886, Leucine-rich repeat (LRR) protei	1e-04
PLN00113		968	PLN00113, PLN00113, leucine-rich repeat receptor-l	5e-04

>gnl\|CDD\|216202 pfam00931, NB-ARC, NB-ARC domain	Back alignment and domain information

 Score =  154 bits (391), Expect = 8e-42
 Identities = 95/292 (32%), Positives = 137/292 (46%), Gaps = 56/292 (19%)

Query: 176 IESIKDKLIDLMVNGRSKSSVVAVVGEGGLGKTTLAGKLFNNEGLKTHFSCRAWVTVGKE 235
            E + + LI+ ++       VV +VG GG+GKTTLA +++N++ +  HF   AWV V K 
Sbjct: 1   REDMIEALIEKLLEMSDNLGVVGIVGMGGVGKTTLAKQIYNDDSVGGHFDSVAWVVVSKT 60

Query: 236 YNKNDLLRTIIKEFHRLSKHGRDGPDRHAEGPLEGQKDVEHALLDNK------------- 282
           Y +  L + I++E       G D  D   +   E    ++ ALL  +             
Sbjct: 61  YTEFRLQKDILQEL------GLDDSDWVEKNESELAVKIKEALLRKRFLLVLDDVWEKND 114

Query: 283 ------------KCSRIIVTTRHMNVAKFCKSSSSVRIHELETLPPDEAWKLFCRKAFGP 330
                         SR+IVTTR  +VA     +S    HE+E+L P+E+W+LF  K F  
Sbjct: 115 WDKIGVPFPDGENGSRVIVTTRSESVAGRMGGTSKP--HEVESLEPEESWELFSNKVFEK 172

Query: 331 SSGGCCPSELKE-------------FFIVALGGLLSTKNRIVSEWKKLFDS-------DP 370
               C   EL+E               +  LGGLL+ K+  V EW+ + +          
Sbjct: 173 ELPPC--PELEEVAKEIVEKCKGLPLALKVLGGLLAFKST-VQEWEHVLEQLNNELAGRD 229

Query: 371 HLKDCNRVLSEGYYDLPHHLKSCLLYFGLFPESCKINRGRLIRLWIAEGFVQ 422
            L +   +LS  Y +LP HLK C LY  LFPE   I + +LI+LWIAEGFV 
Sbjct: 230 GLNEVLSILSLSYDNLPMHLKRCFLYLALFPEDYNIRKEQLIKLWIAEGFVI 281

Length = 285

>gnl\|CDD\|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>gnl\|CDD\|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>gnl\|CDD\|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>gnl\|CDD\|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		895
KOG4658		889	consensus Apoptotic ATPase [Signal transduction me	100.0
PLN03210		1153	Resistant to P. syringae 6; Provisional	100.0
PF00931		287	NB-ARC: NB-ARC domain; InterPro: IPR002182 This is	99.97
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	99.93
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	99.93
KOG0444		1255	consensus Cytoskeletal regulator Flightless-I (con	99.88
KOG0444		1255	consensus Cytoskeletal regulator Flightless-I (con	99.88
KOG4194		873	consensus Membrane glycoprotein LIG-1 [Signal tran	99.86
PLN03210		1153	Resistant to P. syringae 6; Provisional	99.84
KOG4194		873	consensus Membrane glycoprotein LIG-1 [Signal tran	99.82
KOG0472		565	consensus Leucine-rich repeat protein [Function un	99.77
KOG0618		1081	consensus Serine/threonine phosphatase 2C containi	99.73
KOG0472		565	consensus Leucine-rich repeat protein [Function un	99.71
KOG0618		1081	consensus Serine/threonine phosphatase 2C containi	99.61
PRK15387		788	E3 ubiquitin-protein ligase SspH2; Provisional	99.6
PRK15370		754	E3 ubiquitin-protein ligase SlrP; Provisional	99.51
PRK15387		788	E3 ubiquitin-protein ligase SspH2; Provisional	99.5
PRK15370		754	E3 ubiquitin-protein ligase SlrP; Provisional	99.38
KOG0617		264	consensus Ras suppressor protein (contains leucine	99.37
KOG4658		889	consensus Apoptotic ATPase [Signal transduction me	99.34
KOG0617		264	consensus Ras suppressor protein (contains leucine	99.33
KOG4237		498	consensus Extracellular matrix protein slit, conta	99.32
cd00116		319	LRR_RI Leucine-rich repeats (LRRs), ribonuclease i	99.32
cd00116		319	LRR_RI Leucine-rich repeats (LRRs), ribonuclease i	99.27
KOG4237		498	consensus Extracellular matrix protein slit, conta	99.15
KOG4341		483	consensus F-box protein containing LRR [General fu	98.99
KOG3207		505	consensus Beta-tubulin folding cofactor E [Posttra	98.86
KOG2120		419	consensus SCF ubiquitin ligase, Skp2 component [Po	98.82
KOG3207		505	consensus Beta-tubulin folding cofactor E [Posttra	98.76
KOG1909		382	consensus Ran GTPase-activating protein [RNA proce	98.68
PF14580		175	LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ	98.68
KOG2120		419	consensus SCF ubiquitin ligase, Skp2 component [Po	98.68
COG4886		394	Leucine-rich repeat (LRR) protein [Function unknow	98.67
KOG1909		382	consensus Ran GTPase-activating protein [RNA proce	98.66
KOG1259		490	consensus Nischarin, modulator of integrin alpha5	98.64
KOG0532		722	consensus Leucine-rich repeat (LRR) protein, conta	98.61
KOG1259		490	consensus Nischarin, modulator of integrin alpha5	98.61
KOG0532		722	consensus Leucine-rich repeat (LRR) protein, conta	98.51
KOG4341		483	consensus F-box protein containing LRR [General fu	98.5
PRK00411		394	cdc6 cell division control protein 6; Reviewed	98.44
COG4886		394	Leucine-rich repeat (LRR) protein [Function unknow	98.42
PF14580		175	LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ	98.33
PRK04841		903	transcriptional regulator MalT; Provisional	98.33
PF13855		61	LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF	98.31
PF05729		166	NACHT: NACHT domain	98.3
KOG2982		418	consensus Uncharacterized conserved protein [Funct	98.27
PRK00080		328	ruvB Holliday junction DNA helicase RuvB; Reviewed	98.25
TIGR00635		305	ruvB Holliday junction DNA helicase, RuvB subunit.	98.22
PTZ00202		550	tuzin; Provisional	98.21
PF13855		61	LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF	98.18
PLN03150		623	hypothetical protein; Provisional	98.11
KOG0531		414	consensus Protein phosphatase 1, regulatory subuni	98.07
PRK06893		229	DNA replication initiation factor; Validated	98.06
PF12799		44	LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_	98.04
COG2256		436	MGS1 ATPase related to the helicase subunit of the	98.04
PF13173		128	AAA_14: AAA domain	98.04
PLN03150		623	hypothetical protein; Provisional	97.99
PF12799		44	LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_	97.94
COG2909		894	MalT ATP-dependent transcriptional regulator [Tran	97.92
KOG0531		414	consensus Protein phosphatase 1, regulatory subuni	97.91
KOG3665		699	consensus ZYG-1-like serine/threonine protein kina	97.89
KOG2982		418	consensus Uncharacterized conserved protein [Funct	97.87
KOG2028		554	consensus ATPase related to the helicase subunit o	97.84
PRK09376		416	rho transcription termination factor Rho; Provisio	97.8
cd01128		249	rho_factor Transcription termination factor rho is	97.77
TIGR02928		365	orc1/cdc6 family replication initiation protein. M	97.76
PRK15386		426	type III secretion protein GogB; Provisional	97.75
PF13191		185	AAA_16: AAA ATPase domain; PDB: 2V1U_A.	97.71
PRK12402		337	replication factor C small subunit 2; Reviewed	97.68
KOG1859		1096	consensus Leucine-rich repeat proteins [General fu	97.66
PRK07003		830	DNA polymerase III subunits gamma and tau; Validat	97.65
PRK13342		413	recombination factor protein RarA; Reviewed	97.64
PRK14960		702	DNA polymerase III subunits gamma and tau; Provisi	97.63
COG5238		388	RNA1 Ran GTPase-activating protein (RanGAP) involv	97.62
PLN03025		319	replication factor C subunit; Provisional	97.59
KOG1859		1096	consensus Leucine-rich repeat proteins [General fu	97.59
PRK14961		363	DNA polymerase III subunits gamma and tau; Provisi	97.53
PRK08727		233	hypothetical protein; Validated	97.52
PRK00440		319	rfc replication factor C small subunit; Reviewed	97.5
PRK14949		944	DNA polymerase III subunits gamma and tau; Provisi	97.43
PRK08084		235	DNA replication initiation factor; Provisional	97.42
PRK08691		709	DNA polymerase III subunits gamma and tau; Validat	97.42
TIGR01242		364	26Sp45 26S proteasome subunit P45 family. Many pro	97.41
PRK05564		313	DNA polymerase III subunit delta'; Validated	97.4
PRK06645		507	DNA polymerase III subunits gamma and tau; Validat	97.4
PRK04195		482	replication factor C large subunit; Provisional	97.39
TIGR03420		226	DnaA_homol_Hda DnaA regulatory inactivator Hda. Me	97.39
PRK14957		546	DNA polymerase III subunits gamma and tau; Provisi	97.38
KOG3665		699	consensus ZYG-1-like serine/threonine protein kina	97.38
COG1222		406	RPT1 ATP-dependent 26S proteasome regulatory subun	97.38
PRK12323		700	DNA polymerase III subunits gamma and tau; Provisi	97.35
PRK14963		504	DNA polymerase III subunits gamma and tau; Provisi	97.34
PRK14964		491	DNA polymerase III subunits gamma and tau; Provisi	97.32
TIGR02903		615	spore_lon_C ATP-dependent protease, Lon family. Me	97.32
PRK08118		167	topology modulation protein; Reviewed	97.31
KOG4579		177	consensus Leucine-rich repeat (LRR) protein associ	97.31
PRK13341		725	recombination factor protein RarA/unknown domain f	97.3
KOG2004		906	consensus Mitochondrial ATP-dependent protease PIM	97.3
PRK11331		459	5-methylcytosine-specific restriction enzyme subun	97.29
PRK15386		426	type III secretion protein GogB; Provisional	97.29
PRK14962		472	DNA polymerase III subunits gamma and tau; Provisi	97.27
COG5238		388	RNA1 Ran GTPase-activating protein (RanGAP) involv	97.27
KOG4579		177	consensus Leucine-rich repeat (LRR) protein associ	97.27
KOG1947		482	consensus Leucine rich repeat proteins, some prote	97.27
PF01637		234	Arch_ATPase: Archaeal ATPase; InterPro: IPR011579	97.26
PRK09087		226	hypothetical protein; Validated	97.23
PRK14958		509	DNA polymerase III subunits gamma and tau; Provisi	97.23
PRK05896		605	DNA polymerase III subunits gamma and tau; Validat	97.22
PRK14956		484	DNA polymerase III subunits gamma and tau; Provisi	97.21
PRK14951		618	DNA polymerase III subunits gamma and tau; Provisi	97.21
cd00009		151	AAA The AAA+ (ATPases Associated with a wide varie	97.2
PRK03992		389	proteasome-activating nucleotidase; Provisional	97.19
PF05496		233	RuvB_N: Holliday junction DNA helicase ruvB N-term	97.16
TIGR03015		269	pepcterm_ATPase putative secretion ATPase, PEP-CTE	97.16
TIGR00767		415	rho transcription termination factor Rho. Members	97.15
PRK05642		234	DNA replication initiation factor; Validated	97.04
PRK14969		527	DNA polymerase III subunits gamma and tau; Provisi	97.04
PRK14955		397	DNA polymerase III subunits gamma and tau; Provisi	97.04
TIGR02397		355	dnaX_nterm DNA polymerase III, subunit gamma and t	97.02
PRK14952		584	DNA polymerase III subunits gamma and tau; Provisi	97.02
PRK06620		214	hypothetical protein; Validated	97.01
PRK07940		394	DNA polymerase III subunit delta'; Validated	96.99
KOG1644		233	consensus U2-associated snRNP A' protein [RNA proc	96.99
PRK07994		647	DNA polymerase III subunits gamma and tau; Validat	96.94
PTZ00361		438	26 proteosome regulatory subunit 4-like protein; P	96.93
PHA02544		316	44 clamp loader, small subunit; Provisional	96.93
PRK09111		598	DNA polymerase III subunits gamma and tau; Validat	96.92
TIGR03689		512	pup_AAA proteasome ATPase. In the Actinobacteria,	96.88
TIGR02881		261	spore_V_K stage V sporulation protein K. Members o	96.86
PRK14970		367	DNA polymerase III subunits gamma and tau; Provisi	96.86
PRK07764		824	DNA polymerase III subunits gamma and tau; Validat	96.85
PRK14954		620	DNA polymerase III subunits gamma and tau; Provisi	96.85
smart00763		361	AAA_PrkA PrkA AAA domain. This is a family of PrkA	96.81
PRK14959		624	DNA polymerase III subunits gamma and tau; Provisi	96.77
PTZ00112		1164	origin recognition complex 1 protein; Provisional	96.74
CHL00181		287	cbbX CbbX; Provisional	96.72
PF00308		219	Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013	96.72
PF05659		147	RPW8: Arabidopsis broad-spectrum mildew resistance	96.7
PRK08451		535	DNA polymerase III subunits gamma and tau; Validat	96.7
COG1474		366	CDC6 Cdc6-related protein, AAA superfamily ATPase	96.7
TIGR03345		852	VI_ClpV1 type VI secretion ATPase, ClpV1 family. M	96.69
TIGR02880		284	cbbX_cfxQ probable Rubsico expression protein CbbX	96.68
PRK06305		451	DNA polymerase III subunits gamma and tau; Validat	96.68
PF13207		121	AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6	96.68
PF13401		131	AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S	96.67
PRK14971		614	DNA polymerase III subunits gamma and tau; Provisi	96.66
PRK07133		725	DNA polymerase III subunits gamma and tau; Validat	96.6
KOG1644		233	consensus U2-associated snRNP A' protein [RNA proc	96.58
PTZ00454		398	26S protease regulatory subunit 6B-like protein; P	96.57
PRK07261		171	topology modulation protein; Provisional	96.55
PRK06696		223	uridine kinase; Validated	96.54
TIGR02639		731	ClpA ATP-dependent Clp protease ATP-binding subuni	96.52
TIGR00678		188	holB DNA polymerase III, delta' subunit. At positi	96.45
KOG1947		482	consensus Leucine rich repeat proteins, some prote	96.43
COG0466		782	Lon ATP-dependent Lon protease, bacterial type [Po	96.4
PRK07667		193	uridine kinase; Provisional	96.37
PRK14950		585	DNA polymerase III subunits gamma and tau; Provisi	96.36
COG3903		414	Predicted ATPase [General function prediction only	96.32
PRK14953		486	DNA polymerase III subunits gamma and tau; Provisi	96.32
PRK14965		576	DNA polymerase III subunits gamma and tau; Provisi	96.31
PRK14948		620	DNA polymerase III subunits gamma and tau; Provisi	96.26
KOG0726		440	consensus 26S proteasome regulatory complex, ATPas	96.25
PRK06647		563	DNA polymerase III subunits gamma and tau; Validat	96.24
PRK15455		644	PrkA family serine protein kinase; Provisional	96.23
PF12061		402	DUF3542: Protein of unknown function (DUF3542); In	96.17
PRK11034		758	clpA ATP-dependent Clp protease ATP-binding subuni	96.17
PRK07471		365	DNA polymerase III subunit delta'; Validated	96.13
COG2255		332	RuvB Holliday junction resolvasome, helicase subun	96.06
TIGR00763		775	lon ATP-dependent protease La. This protein is ind	96.06
PRK12422		445	chromosomal replication initiation protein; Provis	96.03
PRK05563		559	DNA polymerase III subunits gamma and tau; Validat	95.99
PRK14087		450	dnaA chromosomal replication initiation protein; P	95.99
KOG2739		260	consensus Leucine-rich acidic nuclear protein [Cel	95.94
COG1618		179	Predicted nucleotide kinase [Nucleotide transport	95.9
COG3899		849	Predicted ATPase [General function prediction only	95.89
KOG2123		388	consensus Uncharacterized conserved protein [Funct	95.88
PRK09112		351	DNA polymerase III subunit delta'; Validated	95.88
PRK08903		227	DnaA regulatory inactivator Hda; Validated	95.87
COG0593		408	DnaA ATPase involved in DNA replication initiation	95.83
PF00560		22	LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le	95.83
TIGR00362		405	DnaA chromosomal replication initiator protein Dna	95.82
CHL00095		821	clpC Clp protease ATP binding subunit	95.81
KOG2543		438	consensus Origin recognition complex, subunit 5 [R	95.71
PF13238		129	AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB	95.7
PF00485		194	PRK: Phosphoribulokinase / Uridine kinase family;	95.7
PRK14088		440	dnaA chromosomal replication initiation protein; P	95.62
PRK00149		450	dnaA chromosomal replication initiation protein; R	95.59
PRK13531		498	regulatory ATPase RavA; Provisional	95.55
COG1373		398	Predicted ATPase (AAA+ superfamily) [General funct	95.51
TIGR02237		209	recomb_radB DNA repair and recombination protein R	95.5
PRK08058		329	DNA polymerase III subunit delta'; Validated	95.48
PF05621		302	TniB: Bacterial TniB protein; InterPro: IPR008868	95.47
PRK10865		857	protein disaggregation chaperone; Provisional	95.44
KOG2123		388	consensus Uncharacterized conserved protein [Funct	95.43
PRK09270		229	nucleoside triphosphate hydrolase domain-containin	95.42
cd02019		69	NK Nucleoside/nucleotide kinase (NK) is a protein	95.4
KOG2739		260	consensus Leucine-rich acidic nuclear protein [Cel	95.39
PRK06547		172	hypothetical protein; Provisional	95.37
TIGR00235		207	udk uridine kinase. Model contains a number of lon	95.36
PRK05541		176	adenylylsulfate kinase; Provisional	95.32
PRK05480		209	uridine/cytidine kinase; Provisional	95.27
PRK08233		182	hypothetical protein; Provisional	95.26
PRK10787		784	DNA-binding ATP-dependent protease La; Provisional	95.26
TIGR00150		133	HI0065_YjeE ATPase, YjeE family. Members of this f	95.23
PRK09361		225	radB DNA repair and recombination protein RadB; Pr	95.22
PF07726		131	AAA_3: ATPase family associated with various cellu	95.22
PHA00729		226	NTP-binding motif containing protein	95.21
COG0572		218	Udk Uridine kinase [Nucleotide transport and metab	95.15
KOG0730		693	consensus AAA+-type ATPase [Posttranslational modi	95.15
PTZ00301		210	uridine kinase; Provisional	95.11
PRK14086		617	dnaA chromosomal replication initiation protein; P	95.09
cd01123		235	Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r	95.09
PRK06762		166	hypothetical protein; Provisional	95.08
smart00382		148	AAA ATPases associated with a variety of cellular	95.08
cd01394		218	radB RadB. The archaeal protein radB shares simila	95.08
PF13671		143	AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1	95.08
PF00004		132	AAA: ATPase family associated with various cellula	95.0
TIGR00390		441	hslU ATP-dependent protease HslVU, ATPase subunit.	94.96
KOG0989		346	consensus Replication factor C, subunit RFC4 [Repl	94.94
COG1428		216	Deoxynucleoside kinases [Nucleotide transport and	94.93
PF00560		22	LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le	94.93
cd01393		226	recA_like RecA is a bacterial enzyme which has rol	94.92
TIGR03346		852	chaperone_ClpB ATP-dependent chaperone ClpB. Membe	94.92
KOG0991		333	consensus Replication factor C, subunit RFC2 [Repl	94.88
PRK04040		188	adenylate kinase; Provisional	94.81
PF01583		156	APS_kinase: Adenylylsulphate kinase; InterPro: IPR	94.81
TIGR01360		188	aden_kin_iso1 adenylate kinase, isozyme 1 subfamil	94.77
PF07728		139	AAA_5: AAA domain (dynein-related subfamily); Inte	94.75
PF05673		249	DUF815: Protein of unknown function (DUF815); Inte	94.75
PRK03839		180	putative kinase; Provisional	94.72
PF00158		168	Sigma54_activat: Sigma-54 interaction domain; Inte	94.61
COG1936		180	Predicted nucleotide kinase (related to CMP and AM	94.61
PRK05201		443	hslU ATP-dependent protease ATP-binding subunit Hs	94.6
PRK00625		173	shikimate kinase; Provisional	94.57
COG1223		368	Predicted ATPase (AAA+ superfamily) [General funct	94.57
PF00910		107	RNA_helicase: RNA helicase; InterPro: IPR000605 He	94.56
cd02024		187	NRK1 Nicotinamide riboside kinase (NRK) is an enzy	94.56
CHL00195		489	ycf46 Ycf46; Provisional	94.53
cd02023		198	UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1.	94.53
cd02025		220	PanK Pantothenate kinase (PanK) catalyzes the phos	94.52
PF13177		162	DNA_pol3_delta2: DNA polymerase III, delta subunit	94.52
KOG0727		408	consensus 26S proteasome regulatory complex, ATPas	94.5
PRK07399		314	DNA polymerase III subunit delta'; Validated	94.38
COG2019		189	AdkA Archaeal adenylate kinase [Nucleotide transpo	94.35
PLN02318		656	phosphoribulokinase/uridine kinase	94.31
TIGR02322		179	phosphon_PhnN phosphonate metabolism protein/1,5-b	94.22
COG0470		325	HolB ATPase involved in DNA replication [DNA repli	94.21
COG0003		322	ArsA Predicted ATPase involved in chromosome parti	94.19
PRK13765		637	ATP-dependent protease Lon; Provisional	94.15
PRK00889		175	adenylylsulfate kinase; Provisional	94.14
PRK05707		328	DNA polymerase III subunit delta'; Validated	94.11
PRK00131		175	aroK shikimate kinase; Reviewed	94.11
PRK12726		407	flagellar biosynthesis regulator FlhF; Provisional	94.07
KOG0731		774	consensus AAA+-type ATPase containing the peptidas	94.07
TIGR00764		608	lon_rel lon-related putative ATP-dependent proteas	94.02
cd02028		179	UMPK_like Uridine monophosphate kinase_like (UMPK_	94.01
PRK10536		262	hypothetical protein; Provisional	94.01
TIGR03263		180	guanyl_kin guanylate kinase. Members of this famil	93.99
TIGR01359		183	UMP_CMP_kin_fam UMP-CMP kinase family. This subfam	93.97
cd00227		175	CPT Chloramphenicol (Cm) phosphotransferase (CPT).	93.95
PRK12377		248	putative replication protein; Provisional	93.92
COG1102		179	Cmk Cytidylate kinase [Nucleotide transport and me	93.9
cd02021		150	GntK Gluconate kinase (GntK) catalyzes the phospho	93.9
PRK05439		311	pantothenate kinase; Provisional	93.83
PRK06217		183	hypothetical protein; Validated	93.82
COG1703		323	ArgK Putative periplasmic protein kinase ArgK and	93.82
PRK13947		171	shikimate kinase; Provisional	93.77
TIGR03877		237	thermo_KaiC_1 KaiC domain protein, Ph0284 family.	93.76
KOG0744		423	consensus AAA+-type ATPase [Posttranslational modi	93.76
cd02020		147	CMPK Cytidine monophosphate kinase (CMPK) catalyze	93.7
PRK10751		173	molybdopterin-guanine dinucleotide biosynthesis pr	93.69
PRK14738		206	gmk guanylate kinase; Provisional	93.69
TIGR02640		262	gas_vesic_GvpN gas vesicle protein GvpN. Members o	93.67
TIGR02236		310	recomb_radA DNA repair and recombination protein R	93.67
PRK04301		317	radA DNA repair and recombination protein RadA; Va	93.66
PF03205		140	MobB: Molybdopterin guanine dinucleotide synthesis	93.62
KOG0652		424	consensus 26S proteasome regulatory complex, ATPas	93.6
COG0714		329	MoxR-like ATPases [General function prediction onl	93.59
PRK07952		244	DNA replication protein DnaC; Validated	93.56
COG1419		407	FlhF Flagellar GTP-binding protein [Cell motility	93.56
PF00448		196	SRP54: SRP54-type protein, GTPase domain; InterPro	93.55
PF03308		266	ArgK: ArgK protein; InterPro: IPR005129 Bacterial	93.53
PRK13949		169	shikimate kinase; Provisional	93.53
COG0467		260	RAD55 RecA-superfamily ATPases implicated in signa	93.5
PRK11889		436	flhF flagellar biosynthesis regulator FlhF; Provis	93.49
PF14532		138	Sigma54_activ_2: Sigma-54 interaction domain; PDB:	93.48
TIGR00554		290	panK_bact pantothenate kinase, bacterial type. Sho	93.45
COG1124		252	DppF ABC-type dipeptide/oligopeptide/nickel transp	93.41
TIGR00064		272	ftsY signal recognition particle-docking protein F	93.41
KOG0728		404	consensus 26S proteasome regulatory complex, ATPas	93.4
PF01078		206	Mg_chelatase: Magnesium chelatase, subunit ChlI; I	93.4
COG0468		279	RecA RecA/RadA recombinase [DNA replication, recom	93.4
TIGR02012		321	tigrfam_recA protein RecA. This model describes or	93.36
PRK12339		197	2-phosphoglycerate kinase; Provisional	93.35
PRK08181		269	transposase; Validated	93.35
TIGR02238		313	recomb_DMC1 meiotic recombinase Dmc1. This model d	93.34
PRK00300		205	gmk guanylate kinase; Provisional	93.33
cd00983		325	recA RecA is a bacterial enzyme which has roles in	93.32
PRK10078		186	ribose 1,5-bisphosphokinase; Provisional	93.32
cd01120		165	RecA-like_NTPases RecA-like NTPases. This family i	93.32
cd00071		137	GMPK Guanosine monophosphate kinase (GMPK, EC 2.7.	93.3
TIGR03878		259	thermo_KaiC_2 KaiC domain protein, AF_0795 family.	93.3
COG0563		178	Adk Adenylate kinase and related kinases [Nucleoti	93.27
PF08298		358	AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 Thi	93.26
cd00464		154	SK Shikimate kinase (SK) is the fifth enzyme in th	93.26
cd00820		107	PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC	93.23
PRK06761		282	hypothetical protein; Provisional	93.22
PRK10463		290	hydrogenase nickel incorporation protein HypB; Pro	93.21
COG3640		255	CooC CO dehydrogenase maturation factor [Cell divi	93.19
PRK03846		198	adenylylsulfate kinase; Provisional	93.19
KOG0473		326	consensus Leucine-rich repeat protein [Function un	93.12
PF02374		305	ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_	93.11
PLN02348		395	phosphoribulokinase	93.11
PRK14530		215	adenylate kinase; Provisional	93.1
TIGR02902		531	spore_lonB ATP-dependent protease LonB. Members of	93.09
TIGR01313		163	therm_gnt_kin carbohydrate kinase, thermoresistant	93.07
PF03193		161	DUF258: Protein of unknown function, DUF258; Inter	93.05
PLN03187		344	meiotic recombination protein DMC1 homolog; Provis	93.03
TIGR00602		637	rad24 checkpoint protein rad24. This family is bas	93.02
TIGR01241		495	FtsH_fam ATP-dependent metalloprotease FtsH. HflB(	93.0
PF13504		17	LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO	92.99
PRK13948		182	shikimate kinase; Provisional	92.98
KOG1969		877	consensus DNA replication checkpoint protein CHL12	92.98
PF02562		205	PhoH: PhoH-like protein; InterPro: IPR003714 PhoH	92.97
KOG3347		176	consensus Predicted nucleotide kinase/nuclear prot	92.97
PF08423		256	Rad51: Rad51; InterPro: IPR013632 This domain is f	92.97
PRK13975		196	thymidylate kinase; Provisional	92.96
PRK05057		172	aroK shikimate kinase I; Reviewed	92.94
KOG1532		366	consensus GTPase XAB1, interacts with DNA repair p	92.91
PF08477		119	Miro: Miro-like protein; InterPro: IPR013684 Mitoc	92.9
PRK09435		332	membrane ATPase/protein kinase; Provisional	92.9
cd02027		149	APSK Adenosine 5'-phosphosulfate kinase (APSK) cat	92.9
PRK06067		234	flagellar accessory protein FlaH; Validated	92.85
KOG2228		408	consensus Origin recognition complex, subunit 4 [R	92.84
cd01133		274	F1-ATPase_beta F1 ATP synthase beta subunit, nucle	92.84
TIGR02239		316	recomb_RAD51 DNA repair protein RAD51. This eukary	92.84
TIGR01243		733	CDC48 AAA family ATPase, CDC48 subfamily. This sub	92.81
PF00625		183	Guanylate_kin: Guanylate kinase; InterPro: IPR0081	92.81
PRK14737		186	gmk guanylate kinase; Provisional	92.78
PLN03186		342	DNA repair protein RAD51 homolog; Provisional	92.78
COG1224		450	TIP49 DNA helicase TIP49, TBP-interacting protein	92.77
KOG3864		221	consensus Uncharacterized conserved protein [Funct	92.77
PRK13946		184	shikimate kinase; Provisional	92.72
COG1100		219	GTPase SAR1 and related small G proteins [General	92.71
PRK09354		349	recA recombinase A; Provisional	92.7
cd01672		200	TMPK Thymidine monophosphate kinase (TMPK), also k	92.68
COG0194		191	Gmk Guanylate kinase [Nucleotide transport and met	92.64
COG0542		786	clpA ATP-binding subunits of Clp protease and DnaK	92.63
COG0703		172	AroK Shikimate kinase [Amino acid transport and me	92.63
PRK13768		253	GTPase; Provisional	92.63
TIGR00073		207	hypB hydrogenase accessory protein HypB. HypB is i	92.61
TIGR01287		275	nifH nitrogenase iron protein. This model describe	92.6
PF04665		241	Pox_A32: Poxvirus A32 protein; InterPro: IPR006758	92.58
PF03266		168	NTPase_1: NTPase; InterPro: IPR004948 This entry r	92.58
TIGR03881		229	KaiC_arch_4 KaiC domain protein, PAE1156 family. M	92.57
PRK05342		412	clpX ATP-dependent protease ATP-binding subunit Cl	92.57
COG0237		201	CoaE Dephospho-CoA kinase [Coenzyme metabolism]	92.53
COG0542		786	clpA ATP-binding subunits of Clp protease and DnaK	92.52
COG1126		240	GlnQ ABC-type polar amino acid transport system, A	92.52
CHL00176		638	ftsH cell division protein; Validated	92.48
KOG0733		802	consensus Nuclear AAA ATPase (VCP subfamily) [Post	92.46
TIGR00176		155	mobB molybdopterin-guanine dinucleotide biosynthes	92.39
PF00005		137	ABC_tran: ABC transporter This structure is on hol	92.38
PRK10865		857	protein disaggregation chaperone; Provisional	92.37
TIGR00750		300	lao LAO/AO transport system ATPase. Mutations have	92.35
TIGR03499		282	FlhF flagellar biosynthetic protein FlhF.	92.33
PF13245		76	AAA_19: Part of AAA domain	92.31
PF13521		163	AAA_28: AAA domain; PDB: 1LW7_A.	92.28
PRK14527		191	adenylate kinase; Provisional	92.27
PRK09825		176	idnK D-gluconate kinase; Provisional	92.26
PRK08533		230	flagellar accessory protein FlaH; Reviewed	92.25
PRK08356		195	hypothetical protein; Provisional	92.25
TIGR02173		171	cyt_kin_arch cytidylate kinase, putative. Proteins	92.24
cd01130		186	VirB11-like_ATPase Type IV secretory pathway compo	92.22
cd01878		204	HflX HflX subfamily. A distinct conserved domain w	92.21
KOG2227		529	consensus Pre-initiation complex, subunit CDC6, AA	92.2
TIGR02030		337	BchI-ChlI magnesium chelatase ATPase subunit I. Th	92.18
PLN02796		347	D-glycerate 3-kinase	92.17
TIGR00041		195	DTMP_kinase thymidylate kinase. Function: phosphor	92.16
cd03222		177	ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi	92.15
PRK04182		180	cytidylate kinase; Provisional	92.14
PLN02200		234	adenylate kinase family protein	92.13
PF13504		17	LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO	92.12
PRK04328		249	hypothetical protein; Provisional	92.09
) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309		127	Torsin: Torsin; InterPro: IPR010448 This family co	92.07
cd01983		99	Fer4_NifH The Fer4_NifH superfamily contains a var	92.06
PRK14493		274	putative bifunctional molybdopterin-guanine dinucl	92.06
cd03269		210	ABC_putative_ATPase This subfamily is involved in	92.04
TIGR01166		190	cbiO cobalt transport protein ATP-binding subunit.	92.03
TIGR00382		413	clpX endopeptidase Clp ATP-binding regulatory subu	92.03
cd03229		178	ABC_Class3 This class is comprised of all BPD (Bin	92.02
TIGR00960		216	3a0501s02 Type II (General) Secretory Pathway (IIS	92.02
TIGR03574		249	selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem	92.01
PF06068		398	TIP49: TIP49 C-terminus; InterPro: IPR010339 This	92.01
PTZ00494		664	tuzin-like protein; Provisional	92.0
PLN00020		413	ribulose bisphosphate carboxylase/oxygenase activa	91.99
cd03221		144	ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is	91.99
cd02022		179	DPCK Dephospho-coenzyme A kinase (DPCK, EC 2.7.1.2	91.99
PRK15453		290	phosphoribulokinase; Provisional	91.98
cd04139		164	RalA_RalB RalA/RalB subfamily. The Ral (Ras-like)	91.98
PRK13407		334	bchI magnesium chelatase subunit I; Provisional	91.96
PF01926		116	MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I	91.94
cd01858		157	NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei	91.9
PRK03731		171	aroL shikimate kinase II; Reviewed	91.9
cd03297		214	ABC_ModC_molybdenum_transporter ModC is an ABC-typ	91.88
cd03255		218	ABC_MJ0796_Lo1CDE_FtsE This family is comprised of	91.87
TIGR02673		214	FtsE cell division ATP-binding protein FtsE. This	91.87
cd02117		212	NifH_like This family contains the NifH (iron prot	91.86
PRK09183		259	transposase/IS protein; Provisional	91.85
COG1084		346	Predicted GTPase [General function prediction only	91.85
PF13306		129	LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_	91.84
PRK06835		329	DNA replication protein DnaC; Validated	91.83
PRK05973		237	replicative DNA helicase; Provisional	91.82
PF10662		143	PduV-EutP: Ethanolamine utilisation - propanediol	91.8
cd01124		187	KaiC KaiC is a circadian clock protein primarily f	91.79
KOG0738		491	consensus AAA+-type ATPase [Posttranslational modi	91.77
CHL00081		350	chlI Mg-protoporyphyrin IX chelatase	91.73
PRK13230		279	nitrogenase reductase-like protein; Reviewed	91.7
TIGR01817		534	nifA Nif-specific regulatory protein. This model r	91.7
cd03225		211	ABC_cobalt_CbiO_domain1 Domain I of the ABC compon	91.7
PRK10416		318	signal recognition particle-docking protein FtsY;	91.68
cd03265		220	ABC_DrrA DrrA is the ATP-binding protein component	91.67
COG1120		258	FepC ABC-type cobalamin/Fe3+-siderophores transpor	91.66
COG0464		494	SpoVK ATPases of the AAA+ class [Posttranslational	91.62
COG4088		261	Predicted nucleotide kinase [Nucleotide transport	91.59
PTZ00035		337	Rad51 protein; Provisional	91.58
PF00142		273	Fer4_NifH: 4Fe-4S iron sulfur cluster binding prot	91.57
cd03114		148	ArgK-like The function of this protein family is u	91.56
cd03116		159	MobB Molybdenum is an essential trace element in t	91.56
KOG0729		435	consensus 26S proteasome regulatory complex, ATPas	91.52
PF03029		238	ATP_bind_1: Conserved hypothetical ATP binding pro	91.51
PRK08099		399	bifunctional DNA-binding transcriptional repressor	91.5
cd03263		220	ABC_subfamily_A The ABCA subfamily mediates the tr	91.49
PRK08116		268	hypothetical protein; Validated	91.47
PRK11608		326	pspF phage shock protein operon transcriptional ac	91.47
PRK10646		153	ADP-binding protein; Provisional	91.46
PRK13540		200	cytochrome c biogenesis protein CcmA; Provisional	91.45
PF02367		123	UPF0079: Uncharacterised P-loop hydrolase UPF0079;	91.44
PTZ00088		229	adenylate kinase 1; Provisional	91.44
PRK05537		568	bifunctional sulfate adenylyltransferase subunit 1	91.44
PRK14722		374	flhF flagellar biosynthesis regulator FlhF; Provis	91.43
COG4240		300	Predicted kinase [General function prediction only	91.41
cd01428		194	ADK Adenylate kinase (ADK) catalyzes the reversibl	91.41
cd03293		220	ABC_NrtD_SsuB_transporters NrtD and SsuB are the A	91.4
cd03235		213	ABC_Metallic_Cations ABC component of the metal-ty	91.39
cd03264		211	ABC_drug_resistance_like ABC-type multidrug transp	91.38
TIGR03864		236	PQQ_ABC_ATP ABC transporter, ATP-binding subunit,	91.37
PRK14974		336	cell division protein FtsY; Provisional	91.32
PRK01184		184	hypothetical protein; Provisional	91.32
cd02040		270	NifH NifH gene encodes component II (iron protein)	91.31
cd01121		372	Sms Sms (bacterial radA) DNA repair protein. This	91.3
TIGR01618		220	phage_P_loop phage nucleotide-binding protein. Thi	91.29
PRK13541		195	cytochrome c biogenesis protein CcmA; Provisional	91.26
PHA02244		383	ATPase-like protein	91.24
TIGR01425		429	SRP54_euk signal recognition particle protein SRP5	91.24
PRK14532		188	adenylate kinase; Provisional	91.24
PRK13236		296	nitrogenase reductase; Reviewed	91.24
cd03230		173	ABC_DR_subfamily_A This family of ATP-binding prot	91.22
PRK13232		273	nifH nitrogenase reductase; Reviewed	91.21
KOG0735		952	consensus AAA+-type ATPase [Posttranslational modi	91.21
PRK00771		437	signal recognition particle protein Srp54; Provisi	91.2
cd01131		198	PilT Pilus retraction ATPase PilT. PilT is a nucle	91.2
COG4608		268	AppF ABC-type oligopeptide transport system, ATPas	91.2
smart00072		184	GuKc Guanylate kinase homologues. Active enzymes c	91.19
COG0529		197	CysC Adenylylsulfate kinase and related kinases [I	91.17
PRK14531		183	adenylate kinase; Provisional	91.16
PRK12724		432	flagellar biosynthesis regulator FlhF; Provisional	91.15
cd03224		222	ABC_TM1139_LivF_branched LivF (TM1139) is part of	91.15
cd03226		205	ABC_cobalt_CbiO_domain2 Domain II of the ABC compo	91.14
TIGR03880		224	KaiC_arch_3 KaiC domain protein, AF_0351 family. T	91.12
PRK10584		228	putative ABC transporter ATP-binding protein YbbA;	91.1
cd03256		241	ABC_PhnC_transporter ABC-type phosphate/phosphonat	91.08
smart00173		164	RAS Ras subfamily of RAS small GTPases. Similar in	91.08
TIGR02211		221	LolD_lipo_ex lipoprotein releasing system, ATP-bin	91.07
TIGR02315		243	ABC_phnC phosphonate ABC transporter, ATP-binding	91.06
TIGR02639		731	ClpA ATP-dependent Clp protease ATP-binding subuni	91.06
PRK06526		254	transposase; Provisional	91.02
PRK13695		174	putative NTPase; Provisional	91.02
COG1763		161	MobB Molybdopterin-guanine dinucleotide biosynthes	91.0
KOG0733		802	consensus Nuclear AAA ATPase (VCP subfamily) [Post	91.0
TIGR01184		230	ntrCD nitrate transport ATP-binding subunits C and	91.0
cd01862		172	Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th	91.0
cd03301		213	ABC_MalK_N The N-terminal ATPase domain of the mal	90.99
PRK06921		266	hypothetical protein; Provisional	90.99
TIGR01277		213	thiQ thiamine ABC transporter, ATP-binding protein	90.98
COG1121		254	ZnuC ABC-type Mn/Zn transport systems, ATPase comp	90.98
cd02026		273	PRK Phosphoribulokinase (PRK) is an enzyme involve	90.97
PRK08699		325	DNA polymerase III subunit delta'; Validated	90.97
PLN02165		334	adenylate isopentenyltransferase	90.95
PF13086		236	AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV	90.95
cd03261		235	ABC_Org_Solvent_Resistant ABC (ATP-binding cassett	90.93
PRK11034		758	clpA ATP-dependent Clp protease ATP-binding subuni	90.92
PRK05703		424	flhF flagellar biosynthesis regulator FlhF; Valida	90.9
cd03259		213	ABC_Carb_Solutes_like ABC Carbohydrate and Solute	90.89
cd03238		176	ABC_UvrA The excision repair protein UvrA; Nucleot	90.89
cd02034		116	CooC The accessory protein CooC, which contains a	90.88
PRK11629		233	lolD lipoprotein transporter ATP-binding subunit;	90.88
KOG0734		752	consensus AAA+-type ATPase containing the peptidas	90.87
cd03296		239	ABC_CysA_sulfate_importer Part of the ABC transpor	90.85
cd04155		173	Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f	90.84

>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms]	Back alignment and domain information

Probab=100.00  E-value=1.5e-78  Score=702.84  Aligned_cols=790  Identities=26%  Similarity=0.367  Sum_probs=570.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHhhhhHHHHHHHHHHHHHHHHHHHHHhhhhhhhhccCCChhHHHHHHHHHHHHhhhhHHH
Q 002663            3 EAAVNFALETLGPLLVEEIRLFGGVRKEVQSIKSELESLRSFLKDADTRAAVEELEGGGEESVRTWVKQLRDEAYRIEDF   82 (895)
Q Consensus         3 ~~~v~~~~~kl~~~l~~~~~~~~~~~~~~~~l~~~l~~i~~~l~~~~~~~~~~~~~~~~~~~~~~wl~~l~~~~~~~ed~   82 (895)
                      ++.++..++|+.+++.++...+.+.++++..|+++|..++++++|+++++. ..      ..+..|.+.+++++|++||.
T Consensus         2 ~~~~s~~~~~~~~~l~~~~~~~~~~~~~i~~Lk~~L~~l~~~l~d~~a~~~-~~------~~~~~~~e~~~~~~~~~e~~   74 (889)
T KOG4658|consen    2 GACVSFGVEKLDQLLNRESECLDGKDNYILELKENLKALQSALEDLDAKRD-DL------ERRVNWEEDVGDLVYLAEDI   74 (889)
T ss_pred             CeEEEEehhhHHHHHHHHHHHHhchHHHHHHHHHHHHHHHHHHHHHHhhcc-hH------HHHHHHHHHHHHHHHHHHHH
Confidence            445667788999999999999999999999999999999999999999976 55      78999999999999999999


Q ss_pred             HHHHHHHHhcCCCCCCcch-h--hhhHHHHHHhhhHHHHHHHHHHHHHHHHHHHHhccCCccccccCCCCCCCccccccC
Q 002663           83 IDEYALMVAKLPHESGLVG-V--LHRISRFIKKLRRRRGVATEIQDSESALADIKRRGESYRFRSIDEPSRSGTRNVIPH  159 (895)
Q Consensus        83 ld~~~~~~~~~~~~~~~~~-~--~~~~~~~~~~~~~r~~~~~~i~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  159 (895)
                      ++.|....... +..+... .  ..+..   +-..+++..+..+..+.+++.++.+....+.........+...   .+.
T Consensus        75 ~~~~~v~~~~~-~~~~~l~~~~~~~~~~---c~~~~~~~~~~~~~~~~~rv~~~l~~ve~l~~~~~~~~~~~~~---~~~  147 (889)
T KOG4658|consen   75 IWLFLVEEIER-KANDLLSTRSVERQRL---CLCGFCSKNVSDSYKYGKRVSKVLREVESLGSKGVFEVVGESL---DPR  147 (889)
T ss_pred             HHHHHHHHHHH-HHhHHhhhhHHHHHHH---hhhhhHhHhhhhhHhHHHHHHHHHHHHHHhccccceecccccc---cch
Confidence            99999876652 1111110 0  11111   1113444555555555555555555554444332111100000   011


Q ss_pred             CCCCCCCCCCCCceeechhhHHHHHHHHhcCCCCceEEEEEcCCCchhhHHHHHHhcccc-ccCCCCceEEEEeCCCCCH
Q 002663          160 DSPVRSFFVEDDEVVGIESIKDKLIDLMVNGRSKSSVVAVVGEGGLGKTTLAGKLFNNEG-LKTHFSCRAWVTVGKEYNK  238 (895)
Q Consensus       160 ~~~~~~~~~~~~~~vGr~~~~~~l~~~L~~~~~~~~vv~I~G~gGiGKTtLA~~v~~~~~-~~~~F~~~~wv~~~~~~~~  238 (895)
                      ..+...+.....+ ||.++.++++.+.|..++  ..+|||+||||+||||||+.++|+.. +..+||.++||.||+.++.
T Consensus       148 ~~~e~~~~~~~~~-VG~e~~~~kl~~~L~~d~--~~iv~i~GMGGvGKTTL~~qi~N~~~~v~~~Fd~~iWV~VSk~f~~  224 (889)
T KOG4658|consen  148 EKVETRPIQSESD-VGLETMLEKLWNRLMEDD--VGIVGIYGMGGVGKTTLARQIFNKFDEVGNHFDGVIWVVVSKEFTT  224 (889)
T ss_pred             hhcccCCCCcccc-ccHHHHHHHHHHHhccCC--CCEEEEECCCcccHHHHHHHHhcccchhcccCceEEEEEEcccccH
Confidence            1223333333444 999999999999999866  48999999999999999999999977 9999999999999999999


Q ss_pred             HHHHHHHHHHHHhccCCCCCCC-CccC---cCc---------cc------cHHHHHHhcCCCCCCcEEEEEcCchhhhhh
Q 002663          239 NDLLRTIIKEFHRLSKHGRDGP-DRHA---EGP---------LE------GQKDVEHALLDNKKCSRIIVTTRHMNVAKF  299 (895)
Q Consensus       239 ~~l~~~i~~~l~~~~~~~~~~~-~~~~---~~~---------L~------~~~~l~~~l~~~~~gs~iivTTR~~~v~~~  299 (895)
                      .+++.+|++.++.......... +...   .+.         |+      +|+.+..++|...+||||++|||++.|+..
T Consensus       225 ~~iq~~Il~~l~~~~~~~~~~~~~~~~~~i~~~L~~krfllvLDDIW~~~dw~~I~~~~p~~~~g~KvvlTTRs~~V~~~  304 (889)
T KOG4658|consen  225 RKIQQTILERLGLLDEEWEDKEEDELASKLLNLLEGKRFLLVLDDIWEEVDWDKIGVPFPSRENGSKVVLTTRSEEVCGR  304 (889)
T ss_pred             HhHHHHHHHHhccCCcccchhhHHHHHHHHHHHhccCceEEEEecccccccHHhcCCCCCCccCCeEEEEEeccHhhhhc
Confidence            9999999998887533321211 0000   001         11      788899999999999999999999999998


Q ss_pred             -hccCCCcceeeccCCChhhHHHHHHHhhcCCCCCC-CCchhHHHH----------HHHHHHhhhccCCCCHHHHHhhhh
Q 002663          300 -CKSSSSVRIHELETLPPDEAWKLFCRKAFGPSSGG-CCPSELKEF----------FIVALGGLLSTKNRIVSEWKKLFD  367 (895)
Q Consensus       300 -~~~~~~~~~~~l~~L~~~es~~Lf~~~a~~~~~~~-~~~~~l~~~----------ai~~~g~~l~~~~~~~~~w~~~~~  367 (895)
                       +++.   ..+++++|+++|||.||++.||...... ...+++.+.          |+.++|+.|+.|.. .++|+++.+
T Consensus       305 ~m~~~---~~~~v~~L~~~eaW~LF~~~v~~~~~~~~~~i~~lak~v~~kC~GLPLAl~viG~~ma~K~t-~~eW~~~~~  380 (889)
T KOG4658|consen  305 AMGVD---YPIEVECLTPEEAWDLFQKKVGPNTLGSHPDIEELAKEVAEKCGGLPLALNVLGGLLACKKT-VQEWRRALN  380 (889)
T ss_pred             cccCC---ccccccccCccccHHHHHHhhccccccccccHHHHHHHHHHHhCChHHHHHHHHHHhcCCCc-HHHHHHHHc
Confidence             6543   7999999999999999999999884322 222344332          99999999999987 889999985


Q ss_pred             c---------CCChHHHHHHHhcccCCCChhhhhHhcccccCCCCcccchhhHHHHHHHcCcccc-cCCCCHHHHHHHHH
Q 002663          368 S---------DPHLKDCNRVLSEGYYDLPHHLKSCLLYFGLFPESCKINRGRLIRLWIAEGFVQY-RKRLTSEQVAAEYL  437 (895)
Q Consensus       368 ~---------~~~~~~i~~~l~~sy~~L~~~~k~~fl~~a~fp~~~~i~~~~li~~w~a~g~~~~-~~~~~~~~~~~~~l  437 (895)
                      .         ......+++++++||+.||++.|.||+|||+||+||.|+++.|+.+|+||||+.+ ..+..+++.|..|+
T Consensus       381 ~l~s~~~~~~~~~~~~i~~iLklSyd~L~~~lK~CFLycalFPED~~I~~e~Li~yWiaEGfi~~~~~~~~~~d~G~~~i  460 (889)
T KOG4658|consen  381 VLKSSLAADFSGMEESILPILKLSYDNLPEELKSCFLYCALFPEDYEIKKEKLIEYWIAEGFIDPLDGGETAEDVGYDYI  460 (889)
T ss_pred             cccccccCCCCchhhhhHHhhhccHhhhhHHHHHHHHhhccCCcccccchHHHHHHHHhccCcCccccccchhcchHHHH
Confidence            3         1235678999999999999889999999999999999999999999999999987 44678899999999


Q ss_pred             HHHhhCCceeeeecCCCCceeEEEecHHHHHHHHHHhh-----hcCcEEEeC-----CCCCCCCCCceEEEEeccCCccc
Q 002663          438 DELIDRSLVQVSNREIPGRAIICQVHDLMHEIIIRKTE-----ELGFGRLLN-----GEDSSHCSKTRRITIQRSIDDGA  507 (895)
Q Consensus       438 ~~L~~~sll~~~~~~~~~~~~~~~mhdli~~~~~~~~~-----~~~~~~~~~-----~~~~~~~~~~~~l~l~~~~~~~~  507 (895)
                      .+|++++|+......  ++..+|+|||+||++|.++++     +++++...+     ......+...|+++++.+.....
T Consensus       461 ~~LV~~~Ll~~~~~~--~~~~~~kmHDvvRe~al~ias~~~~~~e~~iv~~~~~~~~~~~~~~~~~~rr~s~~~~~~~~~  538 (889)
T KOG4658|consen  461 EELVRASLLIEERDE--GRKETVKMHDVVREMALWIASDFGKQEENQIVSDGVGLSEIPQVKSWNSVRRMSLMNNKIEHI  538 (889)
T ss_pred             HHHHHHHHHhhcccc--cceeEEEeeHHHHHHHHHHhccccccccceEEECCcCccccccccchhheeEEEEeccchhhc
Confidence            999999999987754  566789999999999999999     666333322     11222445689999999988887


Q ss_pred             ccccCCcceeEEEEEccCCCCccchhcccCCCceeeEEecCCCC-CCcCccccccccCCCeEeecCCCcccccccccCcC
Q 002663          508 LESIKDWKVRSVILFNVDKLPDSFMKSCIANFKLMKVLDLEDSP-INYLPEGVGNLFNLHLLNARNTKLKIIPKSIGNLL  586 (895)
Q Consensus       508 ~~~~~~~~lr~l~~~~~~~~~~~~~~~~~~~~~~L~~L~L~~~~-~~~l~~~i~~l~~Lr~L~L~~~~l~~lp~~i~~l~  586 (895)
                      .....++++++|.+..+..........+|..++.|++|||++|. +..+|++|+.|.|||||+++++.+..+|..+++|+
T Consensus       539 ~~~~~~~~L~tLll~~n~~~l~~is~~ff~~m~~LrVLDLs~~~~l~~LP~~I~~Li~LryL~L~~t~I~~LP~~l~~Lk  618 (889)
T KOG4658|consen  539 AGSSENPKLRTLLLQRNSDWLLEISGEFFRSLPLLRVLDLSGNSSLSKLPSSIGELVHLRYLDLSDTGISHLPSGLGNLK  618 (889)
T ss_pred             cCCCCCCccceEEEeecchhhhhcCHHHHhhCcceEEEECCCCCccCcCChHHhhhhhhhcccccCCCccccchHHHHHH
Confidence            78888889999999987642234555678999999999999865 67999999999999999999999999999999999


Q ss_pred             CCcEEEcCcc-cccccchhhhccccCCeEEeecccccccccccccccccccccccCcccceEEeeeecChHHHHHhhccc
Q 002663          587 SLEILVLART-FVSELPEEIRNLKKLRSLIVFHYKYITGSIIPTEVAAKIHRGFGSLRGLLVLSTIEADSQVLKELMMLR  665 (895)
Q Consensus       587 ~L~~L~L~~~-~l~~lp~~i~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~p~~i~~l~~L~~L~~~~~~~~~~~~l~~l~  665 (895)
                      +|.+||+..+ .+..+|.....|++||+|.+.....        ......-..+.+|.+|+.+.....+......+..+.
T Consensus       619 ~L~~Lnl~~~~~l~~~~~i~~~L~~Lr~L~l~~s~~--------~~~~~~l~el~~Le~L~~ls~~~~s~~~~e~l~~~~  690 (889)
T KOG4658|consen  619 KLIYLNLEVTGRLESIPGILLELQSLRVLRLPRSAL--------SNDKLLLKELENLEHLENLSITISSVLLLEDLLGMT  690 (889)
T ss_pred             hhheeccccccccccccchhhhcccccEEEeecccc--------ccchhhHHhhhcccchhhheeecchhHhHhhhhhhH
Confidence            9999999998 6666666666799999999987431        111122223455555555555444443445555555


Q ss_pred             cCcEEEEEec--CCCcchHHHHhhccCCCCEEEEEecCcccccc--cccC-cC-CCcCccEEEEecc-CCCCCcccccCC
Q 002663          666 QLRMLSIRPQ--NGNGRDLCALIANLENVETLGVLMTSKEEILD--LQSL-SS-PPQHLRYLSLRGN-MKKLPDWILKLK  738 (895)
Q Consensus       666 ~L~~L~l~~~--~~~~~~l~~~l~~l~~L~~L~l~~~~~~~~~~--l~~~-~~-~~~~L~~L~l~~~-~~~lp~~~~~l~  738 (895)
                      +|+.+...-.  ..........+..+.+|+.|.+..|...+...  .... .. ..+++..+.+.++ ....+.|....+
T Consensus       691 ~L~~~~~~l~~~~~~~~~~~~~~~~l~~L~~L~i~~~~~~e~~~~~~~~~~~~~~f~~l~~~~~~~~~~~r~l~~~~f~~  770 (889)
T KOG4658|consen  691 RLRSLLQSLSIEGCSKRTLISSLGSLGNLEELSILDCGISEIVIEWEESLIVLLCFPNLSKVSILNCHMLRDLTWLLFAP  770 (889)
T ss_pred             HHHHHhHhhhhcccccceeecccccccCcceEEEEcCCCchhhcccccccchhhhHHHHHHHHhhccccccccchhhccC
Confidence            5553222110  11222355677788999999999987754321  0000 00 0113444444444 345677777789


Q ss_pred             CcceEEEEeccCCCcchhhhccCccccceeeccccCCCe-EEEecCCCcccceeeeccCCCceeeEEccCcccccceEEE
Q 002663          739 NLIGLRLILSGLTEDPISILQALPNLLELMLHGGYDYEL-FHFEAGWFPKLRKLVLLNFEAVKLVIIEKGAMPDIRELWS  817 (895)
Q Consensus       739 ~L~~L~L~~~~l~~~~~~~l~~l~~L~~L~L~~~~~~~~-~~~~~~~~~~L~~L~l~~~~~l~~l~~~~~~~~~L~~L~l  817 (895)
                      +|+.|.+..|....++++....+..++.+.+..+..... .....++|+++..+.+              .+++|+.+.+
T Consensus       771 ~L~~l~l~~~~~~e~~i~~~k~~~~l~~~i~~f~~~~~l~~~~~l~~l~~i~~~~l--------------~~~~l~~~~v  836 (889)
T KOG4658|consen  771 HLTSLSLVSCRLLEDIIPKLKALLELKELILPFNKLEGLRMLCSLGGLPQLYWLPL--------------SFLKLEELIV  836 (889)
T ss_pred             cccEEEEecccccccCCCHHHHhhhcccEEecccccccceeeecCCCCceeEeccc--------------Cccchhheeh
Confidence            999999999998888887777777776644433322222 2233333333333333              3444666666


Q ss_pred             ccCCCCcccCccccccccCcEEEEEcC
Q 002663          818 GPCPLLMEIPIGIEHLRNLELFTFHDM  844 (895)
Q Consensus       818 ~~c~~l~~lp~~~~~l~~L~~L~l~~c  844 (895)
                      ..|+.+..+|       .+.++.+.+|
T Consensus       837 e~~p~l~~~P-------~~~~~~i~~~  856 (889)
T KOG4658|consen  837 EECPKLGKLP-------LLSTLTIVGC  856 (889)
T ss_pred             hcCcccccCc-------cccccceecc
Confidence            6666655444       4555555555

>PLN03210 Resistant to P	Back alignment and domain information

>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals []	Back alignment and domain information

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton]	Back alignment and domain information

>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton]	Back alignment and domain information

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms]	Back alignment and domain information

>PLN03210 Resistant to P	Back alignment and domain information

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms]	Back alignment and domain information

>KOG0472 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms]	Back alignment and domain information

>KOG0472 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms]	Back alignment and domain information

>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms]	Back alignment and domain information

>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms]	Back alignment and domain information

>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms]	Back alignment and domain information

>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms]	Back alignment and domain information

>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms]	Back alignment and domain information

>KOG4341 consensus F-box protein containing LRR [General function prediction only]	Back alignment and domain information

>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms]	Back alignment and domain information

>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A	Back alignment and domain information

>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG4886 Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms]	Back alignment and domain information

>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton]	Back alignment and domain information

>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton]	Back alignment and domain information

>KOG4341 consensus F-box protein containing LRR [General function prediction only]	Back alignment and domain information

>PRK00411 cdc6 cell division control protein 6; Reviewed	Back alignment and domain information

>COG4886 Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A	Back alignment and domain information

>PRK04841 transcriptional regulator MalT; Provisional	Back alignment and domain information

>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A	Back alignment and domain information

>PF05729 NACHT: NACHT domain	Back alignment and domain information

>KOG2982 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed	Back alignment and domain information

>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit	Back alignment and domain information

>PTZ00202 tuzin; Provisional	Back alignment and domain information

>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A	Back alignment and domain information

>PLN03150 hypothetical protein; Provisional	Back alignment and domain information

>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms]	Back alignment and domain information

>PRK06893 DNA replication initiation factor; Validated	Back alignment and domain information

>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B	Back alignment and domain information

>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair]	Back alignment and domain information

>PF13173 AAA_14: AAA domain	Back alignment and domain information

>PLN03150 hypothetical protein; Provisional	Back alignment and domain information

>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B	Back alignment and domain information

>COG2909 MalT ATP-dependent transcriptional regulator [Transcription]	Back alignment and domain information

>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms]	Back alignment and domain information

>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only]	Back alignment and domain information

>KOG2982 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair]	Back alignment and domain information

>PRK09376 rho transcription termination factor Rho; Provisional	Back alignment and domain information

>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase	Back alignment and domain information

>TIGR02928 orc1/cdc6 family replication initiation protein	Back alignment and domain information

>PRK15386 type III secretion protein GogB; Provisional	Back alignment and domain information

>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A	Back alignment and domain information

>PRK12402 replication factor C small subunit 2; Reviewed	Back alignment and domain information

>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only]	Back alignment and domain information

>PRK07003 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK13342 recombination factor protein RarA; Reviewed	Back alignment and domain information

>PRK14960 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification]	Back alignment and domain information

>PLN03025 replication factor C subunit; Provisional	Back alignment and domain information

>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only]	Back alignment and domain information

>PRK14961 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK08727 hypothetical protein; Validated	Back alignment and domain information

>PRK00440 rfc replication factor C small subunit; Reviewed	Back alignment and domain information

>PRK14949 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK08084 DNA replication initiation factor; Provisional	Back alignment and domain information

>PRK08691 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>TIGR01242 26Sp45 26S proteasome subunit P45 family	Back alignment and domain information

>PRK05564 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK06645 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK04195 replication factor C large subunit; Provisional	Back alignment and domain information

>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda	Back alignment and domain information

>PRK14957 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only]	Back alignment and domain information

>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK12323 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14963 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14964 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR02903 spore_lon_C ATP-dependent protease, Lon family	Back alignment and domain information

>PRK08118 topology modulation protein; Reviewed	Back alignment and domain information

>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only]	Back alignment and domain information

>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed	Back alignment and domain information

>KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional	Back alignment and domain information

>PRK15386 type III secretion protein GogB; Provisional	Back alignment and domain information

>PRK14962 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification]	Back alignment and domain information

>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only]	Back alignment and domain information

>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only]	Back alignment and domain information

>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP	Back alignment and domain information

>PRK09087 hypothetical protein; Validated	Back alignment and domain information

>PRK14958 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK05896 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14956 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14951 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold	Back alignment and domain information

>PRK03992 proteasome-activating nucleotidase; Provisional	Back alignment and domain information

>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair	Back alignment and domain information

>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily	Back alignment and domain information

>TIGR00767 rho transcription termination factor Rho	Back alignment and domain information

>PRK05642 DNA replication initiation factor; Validated	Back alignment and domain information

>PRK14969 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14955 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau	Back alignment and domain information

>PRK14952 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK06620 hypothetical protein; Validated	Back alignment and domain information

>PRK07940 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification]	Back alignment and domain information

>PRK07994 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional	Back alignment and domain information

>PHA02544 44 clamp loader, small subunit; Provisional	Back alignment and domain information

>PRK09111 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>TIGR03689 pup_AAA proteasome ATPase	Back alignment and domain information

>TIGR02881 spore_V_K stage V sporulation protein K	Back alignment and domain information

>PRK14970 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK07764 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14954 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>smart00763 AAA_PrkA PrkA AAA domain	Back alignment and domain information

>PRK14959 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PTZ00112 origin recognition complex 1 protein; Provisional	Back alignment and domain information

>CHL00181 cbbX CbbX; Provisional	Back alignment and domain information

>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication	Back alignment and domain information

>PF05659 RPW8: Arabidopsis broad-spectrum mildew resistance protein RPW8; InterPro: IPR008808 This entry represents the RPW8 domain found in several broad-spectrum mildew resistance proteins from Arabidopsis thaliana and other dicots	Back alignment and domain information

>PRK08451 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family	Back alignment and domain information

>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX	Back alignment and domain information

>PRK06305 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A	Back alignment and domain information

>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B	Back alignment and domain information

>PRK14971 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK07133 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification]	Back alignment and domain information

>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional	Back alignment and domain information

>PRK07261 topology modulation protein; Provisional	Back alignment and domain information

>PRK06696 uridine kinase; Validated	Back alignment and domain information

>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA	Back alignment and domain information

>TIGR00678 holB DNA polymerase III, delta' subunit	Back alignment and domain information

>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only]	Back alignment and domain information

>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK07667 uridine kinase; Provisional	Back alignment and domain information

>PRK14950 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>COG3903 Predicted ATPase [General function prediction only]	Back alignment and domain information

>PRK14953 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14965 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14948 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>KOG0726 consensus 26S proteasome regulatory complex, ATPase RPT2 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK06647 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK15455 PrkA family serine protein kinase; Provisional	Back alignment and domain information

>PF12061 DUF3542: Protein of unknown function (DUF3542); InterPro: IPR021929 R1 is a gene for resistance to late blight, the most destructive disease in potato cultivation worldwide	Back alignment and domain information

>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional	Back alignment and domain information

>PRK07471 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair]	Back alignment and domain information

>TIGR00763 lon ATP-dependent protease La	Back alignment and domain information

>PRK12422 chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PRK05563 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14087 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>COG3899 Predicted ATPase [General function prediction only]	Back alignment and domain information

>KOG2123 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PRK09112 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK08903 DnaA regulatory inactivator Hda; Validated	Back alignment and domain information

>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair]	Back alignment and domain information

>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape []	Back alignment and domain information

>TIGR00362 DnaA chromosomal replication initiator protein DnaA	Back alignment and domain information

>CHL00095 clpC Clp protease ATP binding subunit	Back alignment and domain information

>KOG2543 consensus Origin recognition complex, subunit 5 [Replication, recombination and repair]	Back alignment and domain information

>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C	Back alignment and domain information

>PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2	Back alignment and domain information

>PRK14088 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PRK00149 dnaA chromosomal replication initiation protein; Reviewed	Back alignment and domain information

>PRK13531 regulatory ATPase RavA; Provisional	Back alignment and domain information

>COG1373 Predicted ATPase (AAA+ superfamily) [General function prediction only]	Back alignment and domain information

>TIGR02237 recomb_radB DNA repair and recombination protein RadB	Back alignment and domain information

>PRK08058 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins	Back alignment and domain information

>PRK10865 protein disaggregation chaperone; Provisional	Back alignment and domain information

>KOG2123 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed	Back alignment and domain information

>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars	Back alignment and domain information

>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>PRK06547 hypothetical protein; Provisional	Back alignment and domain information

>TIGR00235 udk uridine kinase	Back alignment and domain information

>PRK05541 adenylylsulfate kinase; Provisional	Back alignment and domain information

>PRK05480 uridine/cytidine kinase; Provisional	Back alignment and domain information

>PRK08233 hypothetical protein; Provisional	Back alignment and domain information

>PRK10787 DNA-binding ATP-dependent protease La; Provisional	Back alignment and domain information

>TIGR00150 HI0065_YjeE ATPase, YjeE family	Back alignment and domain information

>PRK09361 radB DNA repair and recombination protein RadB; Provisional	Back alignment and domain information

>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model	Back alignment and domain information

>PHA00729 NTP-binding motif containing protein	Back alignment and domain information

>COG0572 Udk Uridine kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PTZ00301 uridine kinase; Provisional	Back alignment and domain information

>PRK14086 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B	Back alignment and domain information

>PRK06762 hypothetical protein; Provisional	Back alignment and domain information

>smart00382 AAA ATPases associated with a variety of cellular activities	Back alignment and domain information

>cd01394 radB RadB	Back alignment and domain information

>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B	Back alignment and domain information

>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport	Back alignment and domain information

>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit	Back alignment and domain information

>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair]	Back alignment and domain information

>COG1428 Deoxynucleoside kinases [Nucleotide transport and metabolism]	Back alignment and domain information

>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape []	Back alignment and domain information

>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response	Back alignment and domain information

>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB	Back alignment and domain information

>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair]	Back alignment and domain information

>PRK04040 adenylate kinase; Provisional	Back alignment and domain information

>PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases	Back alignment and domain information

>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily	Back alignment and domain information

>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids []	Back alignment and domain information

>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function	Back alignment and domain information

>PRK03839 putative kinase; Provisional	Back alignment and domain information

>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor	Back alignment and domain information

>COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism]	Back alignment and domain information

>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional	Back alignment and domain information

>PRK00625 shikimate kinase; Provisional	Back alignment and domain information

>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only]	Back alignment and domain information

>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5)	Back alignment and domain information

>cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+)	Back alignment and domain information

>CHL00195 ycf46 Ycf46; Provisional	Back alignment and domain information

>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2	Back alignment and domain information

>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway	Back alignment and domain information

>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A	Back alignment and domain information

>KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK07399 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>COG2019 AdkA Archaeal adenylate kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>PLN02318 phosphoribulokinase/uridine kinase	Back alignment and domain information

>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN	Back alignment and domain information

>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair]	Back alignment and domain information

>COG0003 ArsA Predicted ATPase involved in chromosome partitioning [Cell division and chromosome partitioning]	Back alignment and domain information

>PRK13765 ATP-dependent protease Lon; Provisional	Back alignment and domain information

>PRK00889 adenylylsulfate kinase; Provisional	Back alignment and domain information

>PRK05707 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK00131 aroK shikimate kinase; Reviewed	Back alignment and domain information

>PRK12726 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR00764 lon_rel lon-related putative ATP-dependent protease	Back alignment and domain information

>cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2	Back alignment and domain information

>PRK10536 hypothetical protein; Provisional	Back alignment and domain information

>TIGR03263 guanyl_kin guanylate kinase	Back alignment and domain information

>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family	Back alignment and domain information

>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT)	Back alignment and domain information

>PRK12377 putative replication protein; Provisional	Back alignment and domain information

>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate	Back alignment and domain information

>PRK05439 pantothenate kinase; Provisional	Back alignment and domain information

>PRK06217 hypothetical protein; Validated	Back alignment and domain information

>COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism]	Back alignment and domain information

>PRK13947 shikimate kinase; Provisional	Back alignment and domain information

>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family	Back alignment and domain information

>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor	Back alignment and domain information

>PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional	Back alignment and domain information

>PRK14738 gmk guanylate kinase; Provisional	Back alignment and domain information

>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN	Back alignment and domain information

>TIGR02236 recomb_radA DNA repair and recombination protein RadA	Back alignment and domain information

>PRK04301 radA DNA repair and recombination protein RadA; Validated	Back alignment and domain information

>PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A	Back alignment and domain information

>KOG0652 consensus 26S proteasome regulatory complex, ATPase RPT5 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG0714 MoxR-like ATPases [General function prediction only]	Back alignment and domain information

>PRK07952 DNA replication protein DnaC; Validated	Back alignment and domain information

>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion]	Back alignment and domain information

>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ]	Back alignment and domain information

>PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components	Back alignment and domain information

>PRK13949 shikimate kinase; Provisional	Back alignment and domain information

>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms]	Back alignment and domain information

>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H	Back alignment and domain information

>TIGR00554 panK_bact pantothenate kinase, bacterial type	Back alignment and domain information

>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism]	Back alignment and domain information

>TIGR00064 ftsY signal recognition particle-docking protein FtsY	Back alignment and domain information

>KOG0728 consensus 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX	Back alignment and domain information

>COG0468 RecA RecA/RadA recombinase [DNA replication, recombination, and repair]	Back alignment and domain information

>TIGR02012 tigrfam_recA protein RecA	Back alignment and domain information

>PRK12339 2-phosphoglycerate kinase; Provisional	Back alignment and domain information

>PRK08181 transposase; Validated	Back alignment and domain information

>TIGR02238 recomb_DMC1 meiotic recombinase Dmc1	Back alignment and domain information

>PRK00300 gmk guanylate kinase; Provisional	Back alignment and domain information

>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response	Back alignment and domain information

>PRK10078 ribose 1,5-bisphosphokinase; Provisional	Back alignment and domain information

>cd01120 RecA-like_NTPases RecA-like NTPases	Back alignment and domain information

>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2	Back alignment and domain information

>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family	Back alignment and domain information

>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism]	Back alignment and domain information

>PF08298 AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 This is entry is found at the N terminus of PrkA proteins - bacterial and archaeal serine kinases approximately 630 residues in length	Back alignment and domain information

>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants	Back alignment and domain information

>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis	Back alignment and domain information

>PRK06761 hypothetical protein; Provisional	Back alignment and domain information

>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional	Back alignment and domain information

>COG3640 CooC CO dehydrogenase maturation factor [Cell division and chromosome partitioning]	Back alignment and domain information

>PRK03846 adenylylsulfate kinase; Provisional	Back alignment and domain information

>KOG0473 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>PF02374 ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_A 3IBG_B 3SJA_A 3H84_B 3SJD_A 3ZS9_A 3A37_A 2WOJ_A 3SJC_B 3A36_B	Back alignment and domain information

>PLN02348 phosphoribulokinase	Back alignment and domain information

>PRK14530 adenylate kinase; Provisional	Back alignment and domain information

>TIGR02902 spore_lonB ATP-dependent protease LonB	Back alignment and domain information

>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family	Back alignment and domain information

>PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis	Back alignment and domain information

>PLN03187 meiotic recombination protein DMC1 homolog; Provisional	Back alignment and domain information

>TIGR00602 rad24 checkpoint protein rad24	Back alignment and domain information

>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH	Back alignment and domain information

>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D	Back alignment and domain information

>PRK13948 shikimate kinase; Provisional	Back alignment and domain information

>KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair]	Back alignment and domain information

>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli []	Back alignment and domain information

>KOG3347 consensus Predicted nucleotide kinase/nuclear protein involved oxidative stress response [Nucleotide transport and metabolism]	Back alignment and domain information

>PF08423 Rad51: Rad51; InterPro: IPR013632 This domain is found at the C terminus of the DNA repair and recombination protein Rad51	Back alignment and domain information

>PRK13975 thymidylate kinase; Provisional	Back alignment and domain information

>PRK05057 aroK shikimate kinase I; Reviewed	Back alignment and domain information

>KOG1532 consensus GTPase XAB1, interacts with DNA repair protein XPA [Replication, recombination and repair]	Back alignment and domain information

>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases	Back alignment and domain information

>PRK09435 membrane ATPase/protein kinase; Provisional	Back alignment and domain information

>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS)	Back alignment and domain information

>PRK06067 flagellar accessory protein FlaH; Validated	Back alignment and domain information

>KOG2228 consensus Origin recognition complex, subunit 4 [Replication, recombination and repair]	Back alignment and domain information

>cd01133 F1-ATPase_beta F1 ATP synthase beta subunit, nucleotide-binding domain	Back alignment and domain information

>TIGR02239 recomb_RAD51 DNA repair protein RAD51	Back alignment and domain information

>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily	Back alignment and domain information

>PF00625 Guanylate_kin: Guanylate kinase; InterPro: IPR008144 Guanylate kinase (2	Back alignment and domain information

>PRK14737 gmk guanylate kinase; Provisional	Back alignment and domain information

>PLN03186 DNA repair protein RAD51 homolog; Provisional	Back alignment and domain information

>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription]	Back alignment and domain information

>KOG3864 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PRK13946 shikimate kinase; Provisional	Back alignment and domain information

>COG1100 GTPase SAR1 and related small G proteins [General function prediction only]	Back alignment and domain information

>PRK09354 recA recombinase A; Provisional	Back alignment and domain information

>cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor	Back alignment and domain information

>COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG0703 AroK Shikimate kinase [Amino acid transport and metabolism]	Back alignment and domain information

>PRK13768 GTPase; Provisional	Back alignment and domain information

>TIGR00073 hypB hydrogenase accessory protein HypB	Back alignment and domain information

>TIGR01287 nifH nitrogenase iron protein	Back alignment and domain information

>PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein	Back alignment and domain information

>PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency []	Back alignment and domain information

>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family	Back alignment and domain information

>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional	Back alignment and domain information

>COG0237 CoaE Dephospho-CoA kinase [Coenzyme metabolism]	Back alignment and domain information

>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism]	Back alignment and domain information

>CHL00176 ftsH cell division protein; Validated	Back alignment and domain information

>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB	Back alignment and domain information

>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems	Back alignment and domain information

>PRK10865 protein disaggregation chaperone; Provisional	Back alignment and domain information

>TIGR00750 lao LAO/AO transport system ATPase	Back alignment and domain information

>TIGR03499 FlhF flagellar biosynthetic protein FlhF	Back alignment and domain information

>PF13245 AAA_19: Part of AAA domain	Back alignment and domain information

>PF13521 AAA_28: AAA domain; PDB: 1LW7_A	Back alignment and domain information

>PRK14527 adenylate kinase; Provisional	Back alignment and domain information

>PRK09825 idnK D-gluconate kinase; Provisional	Back alignment and domain information

>PRK08533 flagellar accessory protein FlaH; Reviewed	Back alignment and domain information

>PRK08356 hypothetical protein; Provisional	Back alignment and domain information

>TIGR02173 cyt_kin_arch cytidylate kinase, putative	Back alignment and domain information

>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases	Back alignment and domain information

>cd01878 HflX HflX subfamily	Back alignment and domain information

>KOG2227 consensus Pre-initiation complex, subunit CDC6, AAA+ superfamily ATPase [Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I	Back alignment and domain information

>PLN02796 D-glycerate 3-kinase	Back alignment and domain information

>TIGR00041 DTMP_kinase thymidylate kinase	Back alignment and domain information

>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids	Back alignment and domain information

>PRK04182 cytidylate kinase; Provisional	Back alignment and domain information

>PLN02200 adenylate kinase family protein	Back alignment and domain information

>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D	Back alignment and domain information

>PRK04328 hypothetical protein; Provisional	Back alignment and domain information

>PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins	Back alignment and domain information

>cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain	Back alignment and domain information

>PRK14493 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MoaE; Provisional	Back alignment and domain information

>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity	Back alignment and domain information

>TIGR01166 cbiO cobalt transport protein ATP-binding subunit	Back alignment and domain information

>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX)	Back alignment and domain information

>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment	Back alignment and domain information

>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein	Back alignment and domain information

>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal	Back alignment and domain information

>PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins	Back alignment and domain information

>PTZ00494 tuzin-like protein; Provisional	Back alignment and domain information

>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional	Back alignment and domain information

>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth	Back alignment and domain information

>cd02022 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2	Back alignment and domain information

>PRK15453 phosphoribulokinase; Provisional	Back alignment and domain information

>cd04139 RalA_RalB RalA/RalB subfamily	Back alignment and domain information

>PRK13407 bchI magnesium chelatase subunit I; Provisional	Back alignment and domain information

>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse	Back alignment and domain information

>cd01858 NGP_1 NGP-1	Back alignment and domain information

>PRK03731 aroL shikimate kinase II; Reviewed	Back alignment and domain information

>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB	Back alignment and domain information

>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE)	Back alignment and domain information

>TIGR02673 FtsE cell division ATP-binding protein FtsE	Back alignment and domain information

>cd02117 NifH_like This family contains the NifH (iron protein) of nitrogenase, L subunit (BchL/ChlL) of the protochlorophyllide reductase and the BchX subunit of the Chlorophyllide reductase	Back alignment and domain information

>PRK09183 transposase/IS protein; Provisional	Back alignment and domain information

>COG1084 Predicted GTPase [General function prediction only]	Back alignment and domain information

>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A	Back alignment and domain information

>PRK06835 DNA replication protein DnaC; Validated	Back alignment and domain information

>PRK05973 replicative DNA helicase; Provisional	Back alignment and domain information

>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways	Back alignment and domain information

>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs	Back alignment and domain information

>KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>CHL00081 chlI Mg-protoporyphyrin IX chelatase	Back alignment and domain information

>PRK13230 nitrogenase reductase-like protein; Reviewed	Back alignment and domain information

>TIGR01817 nifA Nif-specific regulatory protein	Back alignment and domain information

>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota	Back alignment and domain information

>PRK10416 signal recognition particle-docking protein FtsY; Provisional	Back alignment and domain information

>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin	Back alignment and domain information

>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism]	Back alignment and domain information

>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>PTZ00035 Rad51 protein; Provisional	Back alignment and domain information

>PF00142 Fer4_NifH: 4Fe-4S iron sulfur cluster binding proteins, NifH/frxC family; InterPro: IPR000392 This entry represents members of the NifH/BchL/ChlL family	Back alignment and domain information

>cd03114 ArgK-like The function of this protein family is unkown	Back alignment and domain information

>cd03116 MobB Molybdenum is an essential trace element in the form of molybdenum cofactor (Moco) which is associated with the metabolism of nitrogen, carbon and sulfur by redox active enzymes	Back alignment and domain information

>KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity	Back alignment and domain information

>PRK08099 bifunctional DNA-binding transcriptional repressor/ NMN adenylyltransferase; Provisional	Back alignment and domain information

>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds	Back alignment and domain information

>PRK08116 hypothetical protein; Validated	Back alignment and domain information

>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional	Back alignment and domain information

>PRK10646 ADP-binding protein; Provisional	Back alignment and domain information

>PRK13540 cytochrome c biogenesis protein CcmA; Provisional	Back alignment and domain information

>PF02367 UPF0079: Uncharacterised P-loop hydrolase UPF0079; InterPro: IPR003442 This group consists of bacterial proteins, which contain a P-loop	Back alignment and domain information

>PTZ00088 adenylate kinase 1; Provisional	Back alignment and domain information

>PRK05537 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Validated	Back alignment and domain information

>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>COG4240 Predicted kinase [General function prediction only]	Back alignment and domain information

>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP)	Back alignment and domain information

>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively	Back alignment and domain information

>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters	Back alignment and domain information

>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component	Back alignment and domain information

>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system	Back alignment and domain information

>PRK14974 cell division protein FtsY; Provisional	Back alignment and domain information

>PRK01184 hypothetical protein; Provisional	Back alignment and domain information

>cd02040 NifH NifH gene encodes component II (iron protein) of nitrogenase	Back alignment and domain information

>cd01121 Sms Sms (bacterial radA) DNA repair protein	Back alignment and domain information

>TIGR01618 phage_P_loop phage nucleotide-binding protein	Back alignment and domain information

>PRK13541 cytochrome c biogenesis protein CcmA; Provisional	Back alignment and domain information

>PHA02244 ATPase-like protein	Back alignment and domain information

>TIGR01425 SRP54_euk signal recognition particle protein SRP54	Back alignment and domain information

>PRK14532 adenylate kinase; Provisional	Back alignment and domain information

>PRK13236 nitrogenase reductase; Reviewed	Back alignment and domain information

>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity	Back alignment and domain information

>PRK13232 nifH nitrogenase reductase; Reviewed	Back alignment and domain information

>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK00771 signal recognition particle protein Srp54; Provisional	Back alignment and domain information

>cd01131 PilT Pilus retraction ATPase PilT	Back alignment and domain information

>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism]	Back alignment and domain information

>smart00072 GuKc Guanylate kinase homologues	Back alignment and domain information

>COG0529 CysC Adenylylsulfate kinase and related kinases [Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK14531 adenylate kinase; Provisional	Back alignment and domain information

>PRK12724 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids	Back alignment and domain information

>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota	Back alignment and domain information

>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family	Back alignment and domain information

>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional	Back alignment and domain information

>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system	Back alignment and domain information

>smart00173 RAS Ras subfamily of RAS small GTPases	Back alignment and domain information

>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein	Back alignment and domain information

>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein	Back alignment and domain information

>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA	Back alignment and domain information

>PRK06526 transposase; Provisional	Back alignment and domain information

>PRK13695 putative NTPase; Provisional	Back alignment and domain information

>COG1763 MobB Molybdopterin-guanine dinucleotide biosynthesis protein [Coenzyme metabolism]	Back alignment and domain information

>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D	Back alignment and domain information

>cd01862 Rab7 Rab7 subfamily	Back alignment and domain information

>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK	Back alignment and domain information

>PRK06921 hypothetical protein; Provisional	Back alignment and domain information

>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein	Back alignment and domain information

>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>cd02026 PRK Phosphoribulokinase (PRK) is an enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes	Back alignment and domain information

>PRK08699 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PLN02165 adenylate isopentenyltransferase	Back alignment and domain information

>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A	Back alignment and domain information

>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules	Back alignment and domain information

>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional	Back alignment and domain information

>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated	Back alignment and domain information

>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup	Back alignment and domain information

>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion	Back alignment and domain information

>cd02034 CooC The accessory protein CooC, which contains a nucleotide-binding domain (P-loop) near the N-terminus, participates in the maturation of the nickel center of carbon monoxide dehydrogenase (CODH)	Back alignment and domain information

>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional	Back alignment and domain information

>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import	Back alignment and domain information

>cd04155 Arl3 Arl3 subfamily	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		895
3qfl_A		115	Coiled-Coil Domain-Dependent Homodimerization Of In		8e-06

>pdb|3QFL|A Chain A, Coiled-Coil Domain-Dependent Homodimerization Of Intracellular Mla Immune Receptors Defines A Minimal Functional Module For Triggering Cell Death Length = 115

Back alignment and structure

Iteration: 1

Score = 49.7 bits (117), Expect = 8e-06, Method: Compositional matrix adjust. Identities = 32/121 (26%), Positives = 60/121 (49%), Gaps = 10/121 (8%) Query: 4 AAVNFALETLGPLLVEEIRLFGGVRKEVQSIKSELESLRSFLKDADTRAAVXXXXXXXXX 63 AA++ + LG LL EE +L GV+K ++ + ELES + L + Sbjct: 1 AAISNLIPKLGELLTEEFKLHKGVKKNIEDLGKELESXNAAL------IKIGEVPREQLD 54 Query: 64 SV-RTWVKQLRDEAYRIEDFIDEYALMVAKLPHESG---LVGVLHRISRFIKKLRRRRGV 119 S + W ++R+ +Y IED +D++ + V + + G+ R + +KK++ + G+ Sbjct: 55 SQDKLWADEVRELSYVIEDVVDKFLVQVDGIKSDDNNNKFKGLXKRTTELLKKVKHKHGI 114 Query: 120 A 120 A Sbjct: 115 A 115

PyMOL of 3qfl

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		895
1z6t_A		591	APAF-1, apoptotic protease activating factor 1; ca	2e-83
2a5y_B		549	CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis	9e-68
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	3e-42
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	8e-09
3qfl_A		115	MLA10; coiled-coil, (CC) domain, NLRS, nucleotide-	6e-28
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	2e-20
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	1e-14
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	5e-13
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	9e-13
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	6e-08
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	2e-16
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	4e-15
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	1e-09
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	1e-08
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	4e-16
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	8e-15
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	3e-09
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	4e-15
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	1e-12
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	2e-10
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	2e-09
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	4e-08
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	4e-07
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	1e-14
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	2e-13
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	3e-12
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	3e-09
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	1e-08
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	9e-08
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	4e-07
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	2e-13
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	2e-11
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	7e-11
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	3e-08
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	1e-05
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	3e-13
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	3e-09
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	1e-05
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	9e-13
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	6e-11
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	2e-10
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	3e-08
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	1e-04
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	1e-12
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	4e-11
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	1e-08
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	2e-08
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	3e-05
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	3e-12
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	3e-06
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	6e-05
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	6e-12
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	6e-10
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	1e-08
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	2e-04
1o6v_A		466	Internalin A; bacterial infection, extracellular r	7e-12
1o6v_A		466	Internalin A; bacterial infection, extracellular r	2e-11
1o6v_A		466	Internalin A; bacterial infection, extracellular r	7e-10
1o6v_A		466	Internalin A; bacterial infection, extracellular r	1e-09
1o6v_A		466	Internalin A; bacterial infection, extracellular r	7e-06
1o6v_A		466	Internalin A; bacterial infection, extracellular r	6e-04
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	1e-11
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	1e-10
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	2e-10
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	7e-09
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	4e-07
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	2e-05
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	1e-11
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	1e-05
3sfz_A		1249	APAF-1, apoptotic peptidase activating factor 1; a	2e-11
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	3e-11
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	1e-10
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	5e-11
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	4e-09
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	1e-08
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	6e-07
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	8e-06
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	1e-10
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	5e-10
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	4e-09
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	2e-08
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	1e-10
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	5e-07
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	3e-04
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	3e-10
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	3e-10
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	3e-09
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	3e-10
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	5e-08
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	5e-10
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	2e-07
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	3e-07
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	8e-10
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	2e-07
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	4e-05
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	5e-04
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	1e-09
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	1e-08
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	1e-05
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	2e-08
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	5e-08
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	2e-06
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	8e-08
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	1e-07
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	2e-07
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	7e-07
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	1e-07
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	6e-06
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	1e-07
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	4e-07
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	3e-06
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	8e-05
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	5e-07
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	6e-07
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	8e-05
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	7e-07
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	1e-06
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	2e-06
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	3e-06
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	4e-06
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	1e-05
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	3e-05
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	1e-04
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	3e-04
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	3e-05
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	8e-05
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	2e-04
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	3e-04
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	4e-04
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	9e-04

>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591	Back alignment and structure

 Score =  278 bits (713), Expect = 2e-83
 Identities = 77/569 (13%), Positives = 165/569 (28%), Gaps = 90/569 (15%)

Query: 65  VRTWVKQLRD--EAYRIEDFIDEYALMVAKLPHESGLVGVLHRISRFIKKLRRRRGVATE 122
           ++      +D   +Y ++  I +  L +++            R +  IK + ++   +  
Sbjct: 10  LQHREALEKDIKTSYIMDHMISDGFLTISEEEKVRNEPTQQQRAAMLIKMILKKDNDSYV 69

Query: 123 I---QDSESALADIKRRGESYRFR---SIDEPSRSGTRNVIPHDSPVRSFFVEDDEVVGI 176
                       D+             S  + S SG  + +                V  
Sbjct: 70  SFYNALLHEGYKDLAALLHDGIPVVSSSSGKDSVSGITSYVRTVLCEGGVPQRPVVFVTR 129

Query: 177 ESIKDKLIDLMVNGRSKSSVVAVVGEGGLGKTTLAGKLFNNEGL-KTHFSCR-AWVTVGK 234
           + + + +   +   + +   V + G  G GK+ LA +   +  L +  F     WV+VGK
Sbjct: 130 KKLVNAIQQKLSKLKGEPGWVTIHGMAGCGKSVLAAEAVRDHSLLEGCFPGGVHWVSVGK 189

Query: 235 EYNKNDL--LRTIIKEFHRLSKHGRDGPDRHAEG--------PLEGQK------DV--EH 276
           +     L  L+ +     +     +  P    E           +  +      DV    
Sbjct: 190 QDKSGLLMKLQNLCTRLDQDESFSQRLPLNIEEAKDRLRILMLRKHPRSLLILDDVWDSW 249

Query: 277 ALLDNKKCSRIIVTTRHMNVAKFCKSSSSVRIHELETLPPDEAWKLFCRKAFGPSSGGCC 336
            L       +I++TTR  +V         V +    +L  ++  ++              
Sbjct: 250 VLKAFDSQCQILLTTRDKSVTDSVMGPKYV-VPVESSLGKEKGLEILSLFVNM------K 302

Query: 337 PSELKEFF-------------IVALGGLLSTKNRIVSEWKK----------LFDSDPHLK 373
            ++L E               +  +G LL         + K             S    +
Sbjct: 303 KADLPEQAHSIIKECKGSPLVVSLIGALLRDFPNRWEYYLKQLQNKQFKRIRKSSSYDYE 362

Query: 374 DCNRVLSEGYYDLPHHLKSCLLYFGLFPESCKINRGRLIRLWIAEGFVQYRKRLTSEQVA 433
             +  +S     L   +K       +  +  K+    L  LW  E            +  
Sbjct: 363 ALDEAMSISVEMLREDIKDYYTDLSILQKDVKVPTKVLCILWDME-----------TEEV 411

Query: 434 AEYLDELIDRSLVQVSNREIPGRAIICQVHDLMHEIIIRKTEELGFGRLLNGEDSSHCSK 493
            + L E +++SL+        G++    +HDL  + +  K       +L +         
Sbjct: 412 EDILQEFVNKSLLFCDRN---GKSFRYYLHDLQVDFLTEKNCS----QLQDLHKKIITQF 464

Query: 494 TRRITIQRSIDDGA------------LESIKDWKVRSVILFNVDKLPDSFMKSCIAN--F 539
            R         D              + S K  K    ++F++D +         A+   
Sbjct: 465 QRYHQPHTLSPDQEDCMYWYNFLAYHMASAKMHKELCALMFSLDWIKAKTELVGPAHLIH 524

Query: 540 KLMKVLDLEDSPINYLPEGVGNLFNLHLL 568
           + ++   + D     + E      +L+  
Sbjct: 525 EFVEYRHILDEKDCAVSENFQEFLSLNGH 553

PyMOL of 1z6t

>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>3qfl_A MLA10; coiled-coil, (CC) domain, NLRS, nucleotide-binding domain, L rich repeat containing receptors, protein binding; 2.00A {Hordeum vulgare} Length = 115	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

No hit with probability above 80.00

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		895
d2a5yb3		277	c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenor	6e-33
d1jl5a_		353	c.10.2.6 (A:) Leucine rich effector protein YopM {	2e-06
d2omza2		384	c.10.2.1 (A:33-416) Internalin A {Listeria monocyt	2e-06
d2omza2		384	c.10.2.1 (A:33-416) Internalin A {Listeria monocyt	4e-05
d1xkua_		305	c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99	4e-05
d1xkua_		305	c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99	3e-04
d1xkua_		305	c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99	0.004
d1ogqa_		313	c.10.2.8 (A:) Polygalacturonase inhibiting protein	0.001

>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Length = 277	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]

 Score =  126 bits (317), Expect = 6e-33
 Identities = 34/257 (13%), Positives = 74/257 (28%), Gaps = 39/257 (15%)

Query: 173 VVGIESIKDKLIDLMVNGRSK-SSVVAVVGEGGLGKTTLAGKLFNN--EGLKTHFSCRAW 229
               E   D++I  +       S  + + G  G GK+ +A +  +   + +  ++    W
Sbjct: 22  CYIREYHVDRVIKKLDEMCDLDSFFLFLHGRAGSGKSVIASQALSKSDQLIGINYDSIVW 81

Query: 230 VTVGKEYNKNDLLRTIIKEFHRLSK-HGRDGPDRHAEGPLEGQKDVEHALLDNKKC---- 284
           +       K+             S+    + P       +  ++ + +AL+D        
Sbjct: 82  LKDSGTAPKSTFDLFTDILLMLKSEDDLLNFPSVEHVTSVVLKRMICNALIDRPNTLFVF 141

Query: 285 ----------------SRIIVTTRHMNVAKFCKSSSSVRIHELETLPPDEAWKLFCRKAF 328
                            R +VTTR + ++       +    E+ +L  DE +        
Sbjct: 142 DDVVQEETIRWAQELRLRCLVTTRDVEISNAAS--QTCEFIEVTSLEIDECYDFLEAYGM 199

Query: 329 GPSSGGCCPSELKEFF---------IVALGGLLSTKNRIVSEWKKLFDS--DPHLKDCNR 377
               G      L +           ++        K     +  +L +      L     
Sbjct: 200 PMPVGEKEEDVLNKTIELSSGNPATLMMFFKSCEPKTF--EKMAQLNNKLESRGLVGVEC 257

Query: 378 VLSEGYYDLPHHLKSCL 394
           +    Y  L   L+ C+
Sbjct: 258 ITPYSYKSLAMALQRCV 274

PyMOL of d2a5yb3

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		895
d2a5yb3		277	CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI	100.0
d2omza2		384	Internalin A {Listeria monocytogenes [TaxId: 1639]	99.91
d2omza2		384	Internalin A {Listeria monocytogenes [TaxId: 1639]	99.85
d1xkua_		305	Decorin {Cow (Bos taurus) [TaxId: 9913]}	99.83
d1ogqa_		313	Polygalacturonase inhibiting protein PGIP {Kidney	99.8
d1xkua_		305	Decorin {Cow (Bos taurus) [TaxId: 9913]}	99.77
d1ogqa_		313	Polygalacturonase inhibiting protein PGIP {Kidney	99.77
d1ozna_		284	Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma	99.65
d1p9ag_		266	von Willebrand factor binding domain of glycoprote	99.64
d1jl5a_		353	Leucine rich effector protein YopM {Yersinia pesti	99.63
d1p9ag_		266	von Willebrand factor binding domain of glycoprote	99.6
d1jl5a_		353	Leucine rich effector protein YopM {Yersinia pesti	99.58
d2astb2		284	Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa	99.56
d1h6ua2		227	Internalin H {Listeria monocytogenes [TaxId: 1639]	99.55
d1ozna_		284	Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma	99.53
d1h6ua2		227	Internalin H {Listeria monocytogenes [TaxId: 1639]	99.53
d2astb2		284	Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa	99.52
d1xwdc1		242	Follicle-stimulating hormone receptor {Human (Homo	99.46
d1h6ta2		210	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.44
d1z7xw1		460	Ribonuclease inhibitor {Human (Homo sapiens) [TaxI	99.41
d2omxa2		199	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.4
d1h6ta2		210	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.37
d2omxa2		199	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.34
d1xwdc1		242	Follicle-stimulating hormone receptor {Human (Homo	99.28
d1z7xw1		460	Ribonuclease inhibitor {Human (Homo sapiens) [TaxI	99.23
d1a9na_		162	Splicesomal U2A' protein {Human (Homo sapiens) [Ta	99.18
d1dcea3		124	Rab geranylgeranyltransferase alpha-subunit, C-ter	99.09
d2ca6a1		344	Rna1p (RanGAP1), N-terminal domain {Fission yeast	99.03
d1a9na_		162	Splicesomal U2A' protein {Human (Homo sapiens) [Ta	99.0
d2ca6a1		344	Rna1p (RanGAP1), N-terminal domain {Fission yeast	98.98
d1dcea3		124	Rab geranylgeranyltransferase alpha-subunit, C-ter	98.86
d1m9la_		198	Outer arm dynein light chain 1 {Green algae (Chlam	98.85
d1w8aa_		192	Slit {Fruit fly (Drosophila melanogaster) [TaxId:	98.8
d1w8aa_		192	Slit {Fruit fly (Drosophila melanogaster) [TaxId:	98.8
d1m9la_		198	Outer arm dynein light chain 1 {Green algae (Chlam	98.77
d2ifga3		156	High affinity nerve growth factor receptor, N-term	98.42
d2ifga3		156	High affinity nerve growth factor receptor, N-term	98.37
d2fnaa2		283	Archaeal ATPase SSO1545 {Sulfolobus solfataricus [	98.29
d1fnna2		276	CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T	98.27
d1sxjc2		227	Replication factor C3 {Baker's yeast (Saccharomyce	98.24
d1sxjb2		224	Replication factor C4 {Baker's yeast (Saccharomyce	98.15
d1r6bx2		268	ClpA, an Hsp100 chaperone, AAA+ modules {Escherich	98.12
d1sxjd2		237	Replication factor C2 {Baker's yeast (Saccharomyce	97.97
d1in4a2		238	Holliday junction helicase RuvB {Thermotoga mariti	97.89
d1qvra2		387	ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2	97.88
d1iqpa2		231	Replication factor C {Archaeon Pyrococcus furiosus	97.87
d1sxje2		252	Replication factor C5 {Baker's yeast (Saccharomyce	97.81
d1sxja2		253	Replication factor C1 {Baker's yeast (Saccharomyce	97.8
d1w5sa2		287	CDC6-like protein APE0152, N-terminal domain {Aero	97.75
d1njfa_		239	delta prime subunit of DNA polymerase III, N-domai	97.75
d1ixza_		247	AAA domain of cell division protein FtsH {Thermus	97.68
d1ixsb2		239	Holliday junction helicase RuvB {Thermus thermophi	97.47
d1e32a2		258	Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu	97.4
d1koha1		162	mRNA export factor tap {Human (Homo sapiens) [TaxI	97.36
d1jbka_		195	ClpB, AAA+ modules {Escherichia coli [TaxId: 562]}	97.33
d1lv7a_		256	AAA domain of cell division protein FtsH {Escheric	97.32
d1l8qa2		213	Chromosomal replication initiation factor DnaA {Aq	97.18
d1a5ta2		207	delta prime subunit of DNA polymerase III, N-domai	96.98
d1pgva_		167	Tropomodulin C-terminal domain {nematode (Caenorha	96.7
d1gvnb_		273	Plasmid maintenance system epsilon/zeta, toxin zet	96.63
d1lw7a2		192	Transcriptional regulator NadR, ribosylnicotinamid	96.49
d1rz3a_		198	Hypothetical protein rbstp0775 {Bacillus stearothe	96.45
d1koha1		162	mRNA export factor tap {Human (Homo sapiens) [TaxI	96.4
d1d2na_		246	Hexamerization domain of N-ethylmalemide-sensitive	96.24
d1ofha_		309	HslU {Haemophilus influenzae [TaxId: 727]}	96.24
d2p67a1		327	LAO/AO transport system kinase ArgK {Escherichia c	96.21
d1pgva_		167	Tropomodulin C-terminal domain {nematode (Caenorha	96.18
d1io0a_		166	Tropomodulin C-terminal domain {Chicken (Gallus ga	96.11
d2bdta1		176	Hypothetical protein BH3686 {Bacillus halodurans [	96.11
d1r7ra3		265	Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu	96.09
d1m8pa3		183	ATP sulfurylase C-terminal domain {Fungus (Penicil	96.09
d1np6a_		170	Molybdopterin-guanine dinucleotide biosynthesis pr	96.05
d1ukza_		196	Uridylate kinase {Baker's yeast (Saccharomyces cer	96.02
d2qm8a1		323	Metallochaperone MeaB {Methylobacterium extorquens	96.0
d1kaga_		169	Shikimate kinase (AroK) {Escherichia coli [TaxId:	95.95
d1io0a_		166	Tropomodulin C-terminal domain {Chicken (Gallus ga	95.92
d1g8pa_		333	ATPase subunit of magnesium chelatase, BchI {Rhodo	95.91
d1ly1a_		152	Polynucleotide kinase, kinase domain {Bacteriophag	95.91
d1x6va3		195	Adenosine-5'phosphosulfate kinase (APS kinase) {Hu	95.85
d2i3ba1		189	Cancer-related NTPase, C1orf57 {Human (Homo sapien	95.83
d1qf9a_		194	UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4	95.81
d1svma_		362	Papillomavirus large T antigen helicase domain {Si	95.76
d1r6bx3		315	ClpA, an Hsp100 chaperone, AAA+ modules {Escherich	95.74
d1rkba_		173	Adenylate kinase {Human (Homo sapiens), isoenzyme	95.7
d1khta_		190	Adenylate kinase {Archaeon Methanococcus voltae [T	95.64
d1y63a_		174	Probable kinase LmjF30.1890 {Leishmania major [Tax	95.59
d1bifa1		213	6-phosphofructo-2-kinase/fructose-2,6-bisphosphata	95.58
d1knqa_		171	Gluconate kinase {Escherichia coli [TaxId: 562]}	95.57
d1cp2a_		269	Nitrogenase iron protein {Clostridium pasteurianum	95.56
d1zp6a1		176	Hypothetical protein Atu3015 {Agrobacterium tumefa	95.45
d1qhxa_		178	Chloramphenicol phosphotransferase {Streptomyces v	95.44
d1ihua2		279	Arsenite-translocating ATPase ArsA {Escherichia co	95.42
d1ckea_		225	CMP kinase {Escherichia coli [TaxId: 562]}	95.38
d1yj5a2		172	5' polynucleotide kinase-3' phosphatase, C-termina	95.37
d1viaa_		161	Shikimate kinase (AroK) {Campylobacter jejuni [Tax	95.34
d1uj2a_		213	Uridine-cytidine kinase 2 {Human (Homo sapiens) [T	95.31
d2iyva1		165	Shikimate kinase (AroK) {Mycobacterium tuberculosi	95.27
d1xjca_		165	Molybdopterin-guanine dinucleotide biosynthesis pr	95.13
d1e6ca_		170	Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax	95.1
d1ak2a1		190	Adenylate kinase {Cow (Bos taurus), mitochondrial	94.95
d1nksa_		194	Adenylate kinase {Archaeon Sulfolobus acidocaldari	94.93
d1ye8a1		178	Hypothetical kinase-like protein Aq_1292 {Aquifex	94.92
d1sq5a_		308	Pantothenate kinase PanK {Escherichia coli [TaxId:	94.84
d1teva_		194	UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]	94.76
d1q3ta_		223	CMP kinase {Streptococcus pneumoniae [TaxId: 1313]	94.64
d2afhe1		289	Nitrogenase iron protein {Azotobacter vinelandii [	94.62
d1ihua1		296	Arsenite-translocating ATPase ArsA {Escherichia co	94.57
d1zaka1		189	Adenylate kinase {Maize (Zea mays) [TaxId: 4577]}	94.56
d1odfa_		286	Hypothetical protein Ygr205W {Baker's yeast (Sacch	94.54
d2ak3a1		189	Adenylate kinase {Cow (Bos taurus), mitochondrial	94.5
d1szpa2		251	DNA repair protein Rad51, catalytic domain {Baker'	94.39
d1uf9a_		191	Dephospho-CoA kinase {Thermus thermophilus [TaxId:	94.29
d2vp4a1		197	Deoxyribonucleoside kinase {Fruit fly (Drosophila	94.29
d1pzna2		254	DNA repair protein Rad51, catalytic domain {Archae	94.28
d1ny5a2		247	Transcriptional activator sigm54 (NtrC1), C-termin	94.27
d3adka_		194	Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]}	94.09
d1zina1		182	Adenylate kinase {Bacillus stearothermophilus [Tax	94.02
d1m7ga_		208	Adenosine-5'phosphosulfate kinase (APS kinase) {Fu	93.96
d2cdna1		181	Adenylate kinase {Mycobacterium tuberculosis [TaxI	93.86
d2ocpa1		241	Deoxyguanosine kinase {Human (Homo sapiens) [TaxId	93.84
d1qvra3		315	ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2	93.83
d1s3ga1		182	Adenylate kinase {Bacillus globisporus [TaxId: 145	93.82
d1tf7a2		242	Circadian clock protein KaiC {Synechococcus sp. st	93.75
d1b0ua_		258	ATP-binding subunit of the histidine permease {Sal	93.68
d1znwa1		182	Guanylate kinase {Mycobacterium tuberculosis [TaxI	93.65
d1l2ta_		230	MJ0796 {Archaeon Methanococcus jannaschii [TaxId:	93.58
d1p5zb_		241	Deoxycytidine kinase {Human (Homo sapiens) [TaxId:	93.57
d1lvga_		190	Guanylate kinase {Mouse (Mus musculus) [TaxId: 100	93.48
d1akya1		180	Adenylate kinase {Baker's yeast (Saccharomyces cer	93.41
d1ls1a2		207	GTPase domain of the signal sequence recognition p	93.38
d1g2912		240	Maltose transport protein MalK, N-terminal domain	93.37
d1okkd2		207	GTPase domain of the signal recognition particle r	93.37
d1gkya_		186	Guanylate kinase {Baker's yeast (Saccharomyces cer	93.31
d1hyqa_		232	Cell division regulator MinD {Archaeon Archaeoglob	93.29
d1a7ja_		288	Phosphoribulokinase {Rhodobacter sphaeroides [TaxI	93.28
d2gnoa2		198	gamma subunit of DNA polymerase III, N-domain {The	93.28
d3b60a1		253	Multidrug resistance ABC transporter MsbA, C-termi	93.27
d1yrba1		244	ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss	93.24
d1jj7a_		251	Peptide transporter Tap1, C-terminal ABC domain {H	93.17
d1sgwa_		200	Putative ABC transporter PF0895 {Pyrococcus furios	93.14
d2onka1		240	Molybdate/tungstate import ATP-binding protein Wtp	93.11
d1e4va1		179	Adenylate kinase {Escherichia coli [TaxId: 562]}	92.99
d1nn5a_		209	Thymidylate kinase {Human (Homo sapiens) [TaxId: 9	92.77
d1kgda_		178	Guanylate kinase-like domain of Cask {Human (Homo	92.77
d1v43a3		239	Hypothetical protein PH0022, N-terminal domain {Py	92.77
d2qy9a2		211	GTPase domain of the signal recognition particle r	92.73
d1r0wa_		281	Cystic fibrosis transmembrane conductance regulato	92.73
d3dhwc1		240	Methionine import ATP-binding protein MetN {Escher	92.56
d2i1qa2		258	DNA repair protein Rad51, catalytic domain {Archae	92.47
d1mv5a_		242	Multidrug resistance ABC transporter LmrA, C-termi	92.46
d2pmka1		241	Haemolysin B ATP-binding protein {Escherichia coli	92.45
d1s96a_		205	Guanylate kinase {Escherichia coli [TaxId: 562]}	92.42
d1g3qa_		237	Cell division regulator MinD {Archaeon Pyrococcus	92.4
d1gsia_		208	Thymidylate kinase {Mycobacterium tuberculosis [Ta	92.34
d4tmka_		210	Thymidylate kinase {Escherichia coli [TaxId: 562]}	92.32
d1v5wa_		258	Meiotic recombination protein DMC1/LIM15 homolog {	92.23
d2awna2		232	Maltose transport protein MalK, N-terminal domain	92.22
d1u94a1		263	RecA protein, ATPase-domain {Escherichia coli [Tax	92.09
d1vmaa2		213	GTPase domain of the signal recognition particle r	92.06
d1vhta_		208	Dephospho-CoA kinase {Escherichia coli [TaxId: 562	92.03
d1w44a_		321	NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]}	91.93
d1g41a_		443	HslU {Haemophilus influenzae [TaxId: 727]}	91.82
d3d31a2		229	Sulfate/molybdate ABC transporter, ATP-binding pro	91.7
d1mo6a1		269	RecA protein, ATPase-domain {Mycobacterium tubercu	91.67
d1um8a_		364	ClpX {Helicobacter pylori [TaxId: 210]}	91.66
d1oxxk2		242	Glucose transport protein GlcV, N-terminal domain	91.65
d1svia_		195	Probable GTPase EngB {Bacillus subtilis [TaxId: 14	91.57
d1tmka_		214	Thymidylate kinase {Baker's yeast (Saccharomyces c	91.56
d1n0wa_		242	DNA repair protein Rad51, catalytic domain {Human	91.38
d1p6xa_		333	Thymidine kinase {Equine herpesvirus type 4 [TaxId	91.37
d1f6ba_		186	SAR1 {Chinese hamster (Cricetulus griseus) [TaxId:	91.34
d1jjva_		205	Dephospho-CoA kinase {Haemophilus influenzae [TaxI	91.22
d1j8yf2		211	GTPase domain of the signal sequence recognition p	91.11
d1g6ha_		254	MJ1267 {Archaeon Methanococcus jannaschii [TaxId:	91.08
d1vpla_		238	Putative ABC transporter TM0544 {Thermotoga mariti	91.0
d1ji0a_		240	Branched chain aminoacid ABC transporter {Thermoto	90.88
d1fzqa_		176	ADP-ribosylation factor {Mouse (Mus musculus), ARL	90.74
d1xp8a1		268	RecA protein, ATPase-domain {Deinococcus radiodura	90.73
d1wf3a1		178	GTPase Era, N-terminal domain {Thermus thermophilu	90.17
d1upta_		169	ADP-ribosylation factor {Human (Homo sapiens), ARL	89.99
d1z2aa1		164	Rab23 {Mouse (Mus musculus) [TaxId: 10090]}	89.93
d2jdid3		276	Central domain of beta subunit of F1 ATP synthase	89.91
d1nija1		222	Hypothetical protein YjiA, N-terminal domain {Esch	89.87
d1z0fa1		166	Rab14 {Human (Homo sapiens) [TaxId: 9606]}	89.86
d1h65a_		257	Chloroplast protein translocon GTPase Toc34 {Garde	89.86
d2hyda1		255	Putative multidrug export ATP-binding/permease pro	89.85
d2a5ja1		173	Rab2b {Human (Homo sapiens) [TaxId: 9606]}	89.78
d1osna_		331	Thymidine kinase {Varicella-zoster virus [TaxId: 1	89.74
d1r8sa_		160	ADP-ribosylation factor {Human (Homo sapiens), ARF	89.72
d2erxa1		171	di-Ras2 {Human (Homo sapiens) [TaxId: 9606]}	89.69
d1moza_		182	ADP-ribosylation factor {Baker's yeast (Saccharomy	89.68
d2bv3a2		276	Elongation factor G (EF-G), N-terminal (G) domain	89.65
d1z06a1		165	Rab-33b {Mouse (Mus musculus) [TaxId: 10090]}	89.64
d2f7sa1		186	Rab27b {Human (Homo sapiens) [TaxId: 9606]}	89.52
d1deka_		241	Deoxynucleoside monophosphate kinase {Bacteriophag	89.52
d1mkya1		171	Probable GTPase Der, N-terminal and middle domains	89.41
d1z0ja1		167	Rab-22a {Mouse (Mus musculus) [TaxId: 10090]}	89.27
d2ew1a1		171	Rab30 {Human (Homo sapiens) [TaxId: 9606]}	89.16
d2fh5b1		207	Signal recognition particle receptor beta-subunit	89.16
d2bcgy1		194	GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi	89.16
d2atva1		168	Ras-like estrogen-regulated growth inhibitor, RERG	89.09
d3raba_		169	Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]}	89.07
d1e2ka_		329	Thymidine kinase {Herpes simplex virus type 1, dif	89.04
d1yzqa1		164	Rab6 {Human (Homo sapiens) [TaxId: 9606]}	89.03
d1ksha_		165	ADP-ribosylation factor {Mouse (Mus musculus), ARL	89.02
d1ky3a_		175	Rab-related protein ypt7p {Baker's yeast (Saccharo	88.93
d2gjsa1		168	Rad {Human (Homo sapiens) [TaxId: 9606]}	88.8
d1z08a1		167	Rab21 {Human (Homo sapiens) [TaxId: 9606]}	88.8
d1nrjb_		209	Signal recognition particle receptor beta-subunit	88.72
d1r2qa_		170	Rab5a {Human (Homo sapiens) [TaxId: 9606]}	88.69
d1xpua3		289	Transcription termination factor Rho, ATPase domai	88.66
d2fn4a1		173	r-Ras {Human (Homo sapiens) [TaxId: 9606]}	88.39
d2erya1		171	r-Ras2 {Human (Homo sapiens) [TaxId: 9606]}	88.37
d2dy1a2		267	Elongation factor G (EF-G), N-terminal (G) domain	88.36
d2bmea1		174	Rab4a {Human (Homo sapiens) [TaxId: 9606]}	88.34
d1l7vc_		231	ABC transporter involved in vitamin B12 uptake, Bt	88.28
d1kaoa_		167	Rap2a {Human (Homo sapiens) [TaxId: 9606]}	88.25
d1zj6a1		177	ADP-ribosylation factor {Human (Homo sapiens), ARL	88.2
d1g16a_		166	Rab-related protein Sec4 {Baker's yeast (Saccharom	88.05
d1svsa1		195	Transducin (alpha subunit) {Rat (Rattus norvegicus	88.04
d1c1ya_		167	Rap1A {Human (Homo sapiens) [TaxId: 9606]}	88.01
d1egaa1		179	GTPase Era, N-terminal domain {Escherichia coli [T	88.01
d1xtqa1		167	GTP-binding protein RheB {Human (Homo sapiens) [Ta	87.98
d1zcba2		200	Transducin (alpha subunit) {Mouse (Mus musculus) [	87.97
d1udxa2		180	Obg GTP-binding protein middle domain {Thermus the	87.91
d2atxa1		185	RhoQ {Human (Homo sapiens) [TaxId: 9606]}	87.82
d1ctqa_		166	cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9	87.8
d1mh1a_		183	Rac {Human (Homo sapiens) [TaxId: 9606]}	87.73
d1w36d1		359	Exodeoxyribonuclease V alpha chain (RecD) {Escheri	87.73
d2g6ba1		170	Rab26 {Human (Homo sapiens) [TaxId: 9606]}	87.66
d1nlfa_		274	Hexameric replicative helicase repA {Escherichia c	87.6
d1kmqa_		177	RhoA {Human (Homo sapiens) [TaxId: 9606]}	87.56
d1byia_		224	Dethiobiotin synthetase {Escherichia coli [TaxId:	87.5
d1n0ua2		341	Elongation factor 2 (eEF-2), N-terminal (G) domain	87.46
d2f9la1		175	Rab11b {Human (Homo sapiens) [TaxId: 9606]}	87.43
d1cr2a_		277	Gene 4 protein (g4p, DNA primase), helicase domain	87.21
d1ek0a_		170	Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T	87.13
d2g3ya1		172	GTP-binding protein GEM {Human (Homo sapiens) [Tax	87.12
d2cxxa1		184	GTP-binding protein engB {Pyrococcus horikoshii [T	86.97
d1m7ba_		179	RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]}	86.97
d1x3sa1		177	Rab18 {Human (Homo sapiens) [TaxId: 9606]}	86.9
d1u8za_		168	Ras-related protein RalA {Cotton-top tamarin (Sagu	86.82
d1tf7a1		242	Circadian clock protein KaiC {Synechococcus sp. st	86.8
d1u0la2		225	Probable GTPase EngC (YjeQ), C-terminal domain {Th	86.79
d1htwa_		158	Hypothetical protein HI0065 {Haemophilus influenza	86.78
d1x1ra1		169	Ras-related protein M-Ras (XRas) {Mouse (Mus muscu	86.75
d2ngra_		191	CDC42 {Human (Homo sapiens) [TaxId: 9606]}	86.58
d1azta2		221	Transducin (alpha subunit) {Cow (Bos taurus) [TaxI	86.56
d1lnza2		185	Obg GTP-binding protein middle domain {Bacillus su	86.52
d1zd9a1		164	ADP-ribosylation factor {Human (Homo sapiens), ARL	86.35
d1e0sa_		173	ADP-ribosylation factor {Human (Homo sapiens), ARF	86.19
d2bmja1		175	Centaurin gamma 1, G domain {Human (Homo sapiens)	85.9
d1wmsa_		174	Rab9a {Human (Homo sapiens) [TaxId: 9606]}	85.78
d2bcjq2		200	Transducin (alpha subunit) {Mouse (Mus musculus) [	85.72
d1vg8a_		184	Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]}	85.47
d1i2ma_		170	Ran {Human (Homo sapiens) [TaxId: 9606]}	85.3
d1f5na2		277	Interferon-induced guanylate-binding protein 1 (GB	85.02
d2qtvb1		166	SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta	84.74
d1mkya2		186	Probable GTPase Der, N-terminal and middle domains	84.7
d1u0ja_		267	Rep 40 protein helicase domain {Adeno-associated v	84.61
d1puia_		188	Probable GTPase EngB {Escherichia coli [TaxId: 562	84.57
d2gj8a1		161	Probable tRNA modification GTPase TrmE (MnmE), G d	83.07
d1tuea_		205	Replication protein E1 helicase domain {Human papi	82.97
d1g6oa_		323	Hexameric traffic ATPase, HP0525 {Helicobacter pyl	82.75
d2fu5c1		173	Rab8a {Mouse (Mus musculus) [TaxId: 10090]}	82.44
d1g7sa4		227	Initiation factor IF2/eIF5b, N-terminal (G) domain	82.39
g1f2t.1		292	Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]}	81.2

>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]

Probab=100.00  E-value=5e-33  Score=230.63  Aligned_cols=223  Identities=14%  Similarity=0.149  Sum_probs=159.9

Q ss_pred             CCCCEEECHHHHHHHHHHHHC-CCCCCEEEEEECCCCCHHHHHHHHHHCCCC--CCCCCCCEEEEEECCCCCHHHHHHHH
Q ss_conf             887300022109999999964-999956999992898225689999742626--66888825899969999989999999
Q 002663          169 EDDEVVGIESIKDKLIDLMVN-GRSKSSVVAVVGEGGLGKTTLAGKLFNNEG--LKTHFSCRAWVTVGKEYNKNDLLRTI  245 (895)
Q Consensus       169 ~~~~~vG~~~~~~~l~~~L~~-~~~~~~vi~I~G~gGiGKTtLa~~v~~~~~--~~~~F~~~~wv~vs~~~~~~~l~~~i  245 (895)
                      ....++||+.++++|+++|.. .+.+.++|+|+||||+||||||+++|++..  ...+|++++||++++.++...+...+
T Consensus        18 ~~~~~~gR~~~~~~i~~~L~~~~~~~~~~v~I~GmgGiGKTtLA~~v~~~~~~~~~~~f~~~~Wv~vs~~~~~~~l~~~~   97 (277)
T d2a5yb3          18 KQMTCYIREYHVDRVIKKLDEMCDLDSFFLFLHGRAGSGKSVIASQALSKSDQLIGINYDSIVWLKDSGTAPKSTFDLFT   97 (277)
T ss_dssp             CCCCSCCCHHHHHHHHHHHHHHTTSSSEEEEEECSTTSSHHHHHHHHHHHCSSTBTTTBSEEEEEECCCCSTTHHHHHHH
T ss_pred             CCCCEECCHHHHHHHHHHHHHCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEEEECCCCCHHHHHHHH
T ss_conf             98862373999999999987346878408999779978889999999985565540127648999936877777899999


Q ss_pred             HHHHHHCCCCCC-CCCCCC-CC----------------CC---CC-CHHHHH-HHCCCCCCCCEEEEECCCHHHHHHHCC
Q ss_conf             999974037999-999866-75----------------74---11-178778-830799998089999274244432105
Q 002663          246 IKEFHRLSKHGR-DGPDRH-AE----------------GP---LE-GQKDVE-HALLDNKKCSRIIVTTRHMNVAKFCKS  302 (895)
Q Consensus       246 ~~~l~~~~~~~~-~~~~~~-~~----------------~~---L~-~~~~i~-~~l~~~~~gs~iivTTR~~~v~~~~~~  302 (895)
                      ...+........ ..+... ..                ..   |+ .|+... .++.  ..||+||||||++.++..+..
T Consensus        98 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~~kr~LlVLDDv~~~~~~~~~~--~~~srilvTTR~~~v~~~~~~  175 (277)
T d2a5yb3          98 DILLMLKSEDDLLNFPSVEHVTSVVLKRMICNALIDRPNTLFVFDDVVQEETIRWAQ--ELRLRCLVTTRDVEISNAASQ  175 (277)
T ss_dssp             HHHHHHTTTSCCTTCCCCTTCCHHHHHHHHHHHHTTSTTEEEEEEEECCHHHHHHHH--HTTCEEEEEESBGGGGGGCCS
T ss_pred             HHHHHHHCCHHHCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEECCHHHHHHHHHHHC--CCCCEEEEEEEHHHHHHHCCC
T ss_conf             999987220220278632123369999999999844688167525066776655520--457559999644899986378


Q ss_pred             CCCCCEEECCCCCHHHHHHHHHHHHCCCCCCCCCCHHHHHH---------HHHHHHHHHCCCCCCHHHHHHHHHC--CCC
Q ss_conf             99853242569994557999887524999999895468989---------9999975420487887899865504--999
Q 002663          303 SSSVRIHELETLPPDEAWKLFCRKAFGPSSGGCCPSELKEF---------FIVALGGLLSTKNRIVSEWKKLFDS--DPH  371 (895)
Q Consensus       303 ~~~~~~~~l~~L~~~~s~~Lf~~~a~~~~~~~~~~~~l~~~---------ai~~~~~~l~~~~~~~~~w~~~~~~--~~~  371 (895)
                      .  ...|++++|+.+|||+||..++|.........+...++         |++++|+.|+.+.  .+.|....+.  ...
T Consensus       176 ~--~~~~~l~~L~~~ea~~Lf~~~~~~~~~~~~~~~~~~~iv~~c~GlPLAl~~ig~~l~~k~--~~~~~~~~~~L~~~~  251 (277)
T d2a5yb3         176 T--CEFIEVTSLEIDECYDFLEAYGMPMPVGEKEEDVLNKTIELSSGNPATLMMFFKSCEPKT--FEKMAQLNNKLESRG  251 (277)
T ss_dssp             C--EEEEECCCCCHHHHHHHHHHTSCCCC--CHHHHHHHHHHHHHTTCHHHHHHHHTTCCSSS--HHHHHHHHHHHHHHC
T ss_pred             C--CCEEECCCCCHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHCCCC--HHHHHHHHHHHHCCC
T ss_conf             8--716877889979999999998477667425679999999995899899999999865598--999999999973486


Q ss_pred             HHHHHHHHHCCCCCCCHHHHHHHCCC
Q ss_conf             07799998601279981045676102
Q 002663          372 LKDCNRVLSEGYYDLPHHLKSCLLYF  397 (895)
Q Consensus       372 ~~~~~~~l~~sy~~L~~~~k~cfl~~  397 (895)
                      ..++..++.+||++||+++|.||-++
T Consensus       252 ~~~v~~il~~sY~~L~~~lk~c~~~l  277 (277)
T d2a5yb3         252 LVGVECITPYSYKSLAMALQRCVEVL  277 (277)
T ss_dssp             SSTTCCCSSSSSSSHHHHHHHHHHTS
T ss_pred             HHHHHHHHHHHHHCCCHHHHHHHHHC
T ss_conf             78899999998851269999999739

PyMOL of d2a5yb3

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]}	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]}	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]}	Back information, alignment and structure

>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]}	Back information, alignment and structure

>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]}	Back information, alignment and structure

>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]}	Back information, alignment and structure

>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]}	Back information, alignment and structure

>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]}	Back information, alignment and structure

>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]}	Back information, alignment and structure

>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]}	Back information, alignment and structure

>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]}	Back information, alignment and structure

>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]}	Back information, alignment and structure

>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]}	Back information, alignment and structure

>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]}	Back information, alignment and structure

>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]}	Back information, alignment and structure

>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]}	Back information, alignment and structure

>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]}	Back information, alignment and structure

>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]}	Back information, alignment and structure

>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]}	Back information, alignment and structure

>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]}	Back information, alignment and structure

>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]}	Back information, alignment and structure

>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]}	Back information, alignment and structure

>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]}	Back information, alignment and structure

>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]}	Back information, alignment and structure

>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]}	Back information, alignment and structure

>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]}	Back information, alignment and structure

>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]}	Back information, alignment and structure

>d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]}	Back information, alignment and structure

>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]}	Back information, alignment and structure

>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]}	Back information, alignment and structure

>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]}	Back information, alignment and structure

>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]}	Back information, alignment and structure

>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]}	Back information, alignment and structure

>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]}	Back information, alignment and structure

>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]}	Back information, alignment and structure

>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]}	Back information, alignment and structure

>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]}	Back information, alignment and structure

>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]}	Back information, alignment and structure

>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]}	Back information, alignment and structure

>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]}	Back information, alignment and structure

>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]}	Back information, alignment and structure

>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]}	Back information, alignment and structure

>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]}	Back information, alignment and structure

>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]}	Back information, alignment and structure

>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]}	Back information, alignment and structure

>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]}	Back information, alignment and structure

>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]}	Back information, alignment and structure

>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]}	Back information, alignment and structure

>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]}	Back information, alignment and structure

>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]}	Back information, alignment and structure

>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]}	Back information, alignment and structure

>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]}	Back information, alignment and structure

>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]}	Back information, alignment and structure

>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]}	Back information, alignment and structure

>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]}	Back information, alignment and structure

>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]}	Back information, alignment and structure

>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]}	Back information, alignment and structure

>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]}	Back information, alignment and structure

>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]}	Back information, alignment and structure

>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]}	Back information, alignment and structure

>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]}	Back information, alignment and structure

>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]}	Back information, alignment and structure

>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]}	Back information, alignment and structure

>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]}	Back information, alignment and structure

>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]}	Back information, alignment and structure

>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]}	Back information, alignment and structure

>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]}	Back information, alignment and structure

>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]}	Back information, alignment and structure

>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]}	Back information, alignment and structure

>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]}	Back information, alignment and structure

>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]}	Back information, alignment and structure

>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]}	Back information, alignment and structure

>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]}	Back information, alignment and structure

>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]}	Back information, alignment and structure

>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]}	Back information, alignment and structure