Citrus Sinensis ID: 002679


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890---
MVLPNLKISLVIFSLFFLILFPVLDFPLIVYSDSTEEVHALLKWKTSLQNHDKGSLLPSWTLNNATKISPCAWFGIHCNHVGRVNSINLTNVGLKGTLHDFSFSSFPHLAYLDLQVNQIFGIIPPQIGNISKLKYLDLSSNSFSGTIPPQIGNLSMLKFLYLSANQFSGRIPPQIGHLSYIEALHLFKNQLSGPIPHEVGGLSSLNELALTSNFLKGSIPPSLGNLTNLAILYLHNNSLSGSIPSEIGNLKSLSSLALGNNKLCGSIPLFLGNLTNLDTLYLRNNSFSSSIPSEIGNLKSLSILELGENRLNGSIPLSLGNLTNLDTLYLYTNSLSGSIPSEIGNLKSLSGLELADNELSSSIPHYLGNLTNLAAFYLYKNSLSGSIPSEIGNLKSLSNLDLSENKLSGSIPHSLGNLTNLAILYLHSNTLLGSIPREIGNLKSLFELQLGDNKLSNSISHSLGNLTHMTLLALYDNALSGVIPEELGNLVKLTMLTLSDNQLQGSIPNLRNLTNLIRLRLNRNHLTCNISESFGIHPKLTFIDLSHNNFYGQISSDWGKCPNLGTFDVSVNNIIGSLPPEIGDSSQLHVIDLSANHIIGKIPSEIGKLSSLIKLILRRNQLFGQLPSELGSLIQLEYLDLSSNRLSNSIPRSLGNLVKLHYLNLSTNQFIQEIPIKLEKLIHLSELDLSHNFLGKEIPSQICNMRSLEMLNLSHNNLSDFIPRCFEEMNGLLYIDISYNELHGPIPNSTAFSDALMEALQGNEGLCGDIKGFQSCKASKSHKPASRKIWVVIVFPLLGTVALLISLIALFFIFRRRKNALQTLQSSPRGTRGFLSVLTFEGKIVYEEIIRQRMVLMMSTALEKVDKEVYTKLIYLLEKSLQSRNFIRHSQVR
cccccHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccccccccccccccccccccccccEEEEEEccccccEEEEEccccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccEEEcccccccccccccEEEcccccccccccHHHHccccccccccccccccccccccccccccccEEEccccccccccccccccccccccccccccccEEcccccccccccccEEEcccccccccccHHHHccccccEEEcccccccccccccccccccccEEEccccccccccccccccccccccEEcccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccEEEccccccEEEccccccccccccEEcccccccccccHHccccccccEEEccccEEEEEccccccccccccEEEcccccccccccccccccccccEEccccccccccccccHHccccccEEEcccccccccccHHHHccccccEEEcccccccccccHHHHccccccccccccccccccccHHHcccccccEEEcccccccccccHHHHccccccccccccccccccccccccccccccEEEccccccEEccccccccccccHHHHcccccccccccccccccccccccccccEEEEEEHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccEEEEEccccccEEEEEEcccEEEEEEEEEcccEEEEEHHHHHHccc
cccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHccccccHHHccccccccccccccccEEEEEEccccEEEEEEcccccccccccHHHHccccccEEEEccEccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccHHHHccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccEEccccccccccccEEEcccccccEEccccccccccccEEEccccccccccHHHHcccccccEEEccccccccccHHHHcccccccEEEcccccccccccccccccccEEEEEccccccccccHHHccccccEEEEEccccccccccHHHcccccccEEEccEccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccHHHHcccccEEEEcccccccccccHHHccccccEEEEcccccccccccHHHHHHHcccEEEcccccccccccHHHHHccccEEEEEcccccccccccccccccccHHHHHccccccccccccccccccccccccccHHEEEEHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHccccccHHHccccccccEEEEEEccccEEEEEEEcccccHHHcHHHHHHHHHHHHHHHHcccc
MVLPNLKISLVIFSLFFLIlfpvldfplivysdsTEEVHALLKWKTSlqnhdkgsllpswtlnnatkispcawfgihcnhvgrvnsinltnvglkgtlhdfsfssfphlayldlqvnqifgiippqignisklkyldlssnsfsgtippqignlSMLKFLYLSAnqfsgrippqighLSYIEALHLFKnqlsgpiphevgglsslnelaltsnflkgsippslgnltNLAILYLHnnslsgsipseignlkslsslalgnnklcgsiplflgnltnldtlylrnnsfsssipseignlkslSILElgenrlngsiplslgnltnldtLYLYTNSlsgsipseignlkslsgleladnelsssiphylgnlTNLAAFYLYKnslsgsipseignlkslsnldlsenklsgsiphslgnlTNLAILYLHSNTLLGSIPREIGNLKSLFElqlgdnklsnsishslgnltHMTLLALYDnalsgvipeeLGNLVKLTMLtlsdnqlqgsipnlrnlTNLIRLRLNRNhltcnisesfgihpkltfidlshnnfygqissdwgkcpnlgtfdvsvnniigslppeigdssqlhvIDLSanhiigkipseiGKLSSLIKLILRRNQLFGQLPSELGSLIQLEYLdlssnrlsnsiprsLGNLVKLHYLNLSTNQFIQEIPIKLEKLIHlseldlshnflgkeipsqICNMRSLEMLNLSHNNLSDFIPRCFEEMNGLLYIdisynelhgpipnstaFSDALMEALQgneglcgdikgfqsckaskshkpasrkIWVVIVFPLLGTVALLISLIALFFIFRRRKNALQtlqssprgtrgfLSVLTFEGKIVYEEIIRQRMVLMMSTALEKVDKEVYTKLIYLLEKSLQSRNFIRHSQVR
MVLPNLKISLVIFSLFFLILFPVLDFPLIVYSDSTEEVHALLKWKTSLQNHDKGSLLPSWTLNNATKISPCAWFGIHCNHVGRVNSINLTNVGLKGTLHDFSFSSFPHLAYLDLQVNQIFGIIPPQIGNISKLKYLDLSSNSFSGTIPPQIGNLSMLKFLYLSANQFSGRIPPQIGHLSYIEALHLFKNQLSGPIPHEVGGLSSLNELALTSNFLKGSIPPSLGNLTNLAILYLHNNSLSGSIPSEIGNLKSLSSLALGNNKLCGSIPLFLGNLTNLDTLYLRNNSFSSSIPSEIGNLKSLSILELGENRLNGSIPLSLGNLTNLDTLYLYTNSLSGSIPSEIGNLKSLSGLELADNELSSSIPHYLGNLTNLAAFYLYKNSLSGSIPSEIGNLKSLSNLDLSENKLSGSIPHSLGNLTNLAILYLHSNTLLGSIPREIGNLKSLFELQLGDNKLSNSISHSLGNLTHMTLLALYDNALSGVIPEELGNLVKLTMLTLSdnqlqgsipnlrNLTNLIRLRLNRNHLTCNISESFGIHPKLTFIDLSHNNFYGQISSDWGKCPNLGTFDVSVNNIIGSLPPEIGDSSQLHVIDLSANHIIGKIPSEIGKLSSLIKLILRRNQLFGQLPSELGSLIQLEYLDLSSNRLSNSIPRSLGNLVKLHYLNLSTNQFIQEIPIKLEKLIHLSELDLSHNFLGKEIPSQICNMRSLEMLNLSHNNLSDFIPRCFEEMNGLLYIDISYNELHGPIPNSTAFSDALMEALQGNEGLCGDIKGFQSCKAskshkpasrkIWVVIVFPLLGTVALLISLIALFFIFRRRKNALqtlqssprgtrgflsvltfeGKIVYEEIIRQRMVLMMSTALEKVDKEVYTKLIYLlekslqsrnfirhsqvr
MVLPNlkislvifslfflilfpvlDFPLIVYSDSTEEVHALLKWKTSLQNHDKGSLLPSWTLNNATKISPCAWFGIHCNHVGRVNSINLTNVGLKGTLHDFSFSSFPHLAYLDLQVNQIFGIIPPQIGNISKLKYLDLSSNSFSGTIPPQIGNLSMLKFLYLSANQFSGRIPPQIGHLSYIEALHLFKNQLSGPIPHEVGGLSSLNELALTSNFLKGSIPPSLGNLTNLAILYLHNNSLSGSIPSEIGNLKSLSSLALGNNKLCGSIPLFLGNLTNLDTLYLRNNSFSSSIPSEIGNLKSLSILELGENRLNGSIPLSlgnltnldtlylytnslsGSIPSEIGNLKSLSGLELADNELSSSIPHYLGNLTNLAAFYLYKNSLSGSIPSEIGNLKSLSNLDLSENKLSGSIPHSLGNLTNLAILYLHSNTLLGSIPREIGNLKSLFELQLGDNKLSNSISHSLGNLTHMTLLALYDNALSGVIPEELGNLVKLTMLTLSDNQLQGSIPnlrnltnlirlrlnrnHLTCNISESFGIHPKLTFIDLSHNNFYGQISSDWGKCPNLGTFDVSVNNIIGSLPPEIGDSSQLHVIDLSANHIIGKIPSEIGklssliklilrrNQLFGQLPSELGSLIQLEYLDLSSNRLSNSIPRSLGNLVKLHYLNLSTNQFIQEIPIKLEKLIHLSELDLSHNFLGKEIPSQICNMRSLEMLNLSHNNLSDFIPRCFEEMNGLLYIDISYNELHGPIPNSTAFSDALMEALQGNEGLCGDIKGFQSCKASKSHKPASRKIWVVIVFPLLGTVallislialffifrrrKNALQTLQSSPRGTRGFLSVLTFEGKIVYEEIIRQRMVLMMSTALEKVDKEVYTKLIYLLEKSLQSRNFIRHSQVR
****NLKISLVIFSLFFLILFPVLDFPLIVYSDSTEEVHALLKWKTSLQNHDKGSLLPSWTLNNATKISPCAWFGIHCNHVGRVNSINLTNVGLKGTLHDFSFSSFPHLAYLDLQVNQIFGIIPPQIGNISKLKYLDLSSNSFSGTIPPQIGNLSMLKFLYLSANQFSGRIPPQIGHLSYIEALHLFKNQLSGPIPHEVGGLSSLNELALTSNFLKGSIPPSLGNLTNLAILYLHNNSLSGSIPSEIGNLKSLSSLALGNNKLCGSIPLFLGNLTNLDTLYLRNNSFSSSIPSEIGNLKSLSILELGENRLNGSIPLSLGNLTNLDTLYLYTNSLSGSIPSEIGNLKSLSGLELADNELSSSIPHYLGNLTNLAAFYLYKNSLSGSI***********************IPHSLGNLTNLAILYLHSNTLLGSIPREIGNLKSLFELQLGDNKLSNSISHSLGNLTHMTLLALYDNALSGVIPEELGNLVKLTMLTLSDNQLQGSIPNLRNLTNLIRLRLNRNHLTCNISESFGIHPKLTFIDLSHNNFYGQISSDWGKCPNLGTFDVSVNNIIGSLPPEIGDSSQLHVIDLSANHIIGKIPSEIGKLSSLIKLILRRNQLFGQLPSELGSLIQLEYLDLSSNRLSNSIPRSLGNLVKLHYLNLSTNQFIQEIPIKLEKLIHLSELDLSHNFLGKEIPSQICNMRSLEMLNLSHNNLSDFIPRCFEEMNGLLYIDISYNELHGPIPNSTAFSDALMEALQGNEGLCGDIKGFQSC*********SRKIWVVIVFPLLGTVALLISLIALFFIFRRRKNALQTLQS*PRGTRGFLSVLTFEGKIVYEEIIRQRMVLMMSTALEKVDKEVYTKLIYLLEKSL************
*********LVIFSLFFLILFPVLDFPLIV**DSTEEVHALLKWKTSLQNHDKGSLLPSWTLNNATKISPCAWFGIHCNHVGRVNSINLTNVGLKGTLHDFSFSSFPHLAYLDLQVNQIFGIIPPQIGNISKLKYLDLSSNSFSGTIPPQIGNLSMLKFLYLSANQFSGRIPPQIGHLSYIEALHLFKNQLSGPIPHEVGGLSSLNELALTSNFLKGSIPPSLGNLTNLAILYLHNNSLSGSIPSEIGNLKSLSSLALGNNKLCGSIPLFLGNLTNLDTLYLRNNSFSSSIPSEIGNLKSLSILELGENRLNGSIPLSLGNLTNLDTLYLYTNSLSGSIPSEIGNLKSLSGLELADNELSSSIPHYLGNLTNLAAFYLYKNSLSGSIPSEIGNLKSLSNLDLSENKLSGSIPHSLGNLTNLAILYLHSNTLLGSIPREIGNLKSLFELQLGDNKLSNSISHSLGNLTHMTLLALYDNALSGVIPEELGNLVKLTMLTLSDNQLQGSIPNLRNLTNLIRLRLNRNHLTCNISESFGIHPKLTFIDLSHNNFYGQISSDWGKCPNLGTFDVSVNNIIGSLPPEIGDSSQLHVIDLSANHIIGKIPSEIGKLSSLIKLILRRNQLFGQLPSELGSLIQLEYLDLSSNRLSNSIPRSLGNLVKLHYLNLSTNQFIQEIPIKLEKLIHLSELDLSHNFLGKEIPSQICNMRSLEMLNLSHNNLSDFIPRCFEEMNGLLYIDISYNELHGPIPNSTAFSDALMEALQGNEGLCGDI*********************VIVFPLLGTVALLISLIALFFIF***********************LTFEGKIVYEEIIRQRMVLMMSTALEKVDKEVYTKLIYLLEKSLQSRNFIRHSQV*
MVLPNLKISLVIFSLFFLILFPVLDFPLIVYSDSTEEVHALLKWKTSLQNHDKGSLLPSWTLNNATKISPCAWFGIHCNHVGRVNSINLTNVGLKGTLHDFSFSSFPHLAYLDLQVNQIFGIIPPQIGNISKLKYLDLSSNSFSGTIPPQIGNLSMLKFLYLSANQFSGRIPPQIGHLSYIEALHLFKNQLSGPIPHEVGGLSSLNELALTSNFLKGSIPPSLGNLTNLAILYLHNNSLSGSIPSEIGNLKSLSSLALGNNKLCGSIPLFLGNLTNLDTLYLRNNSFSSSIPSEIGNLKSLSILELGENRLNGSIPLSLGNLTNLDTLYLYTNSLSGSIPSEIGNLKSLSGLELADNELSSSIPHYLGNLTNLAAFYLYKNSLSGSIPSEIGNLKSLSNLDLSENKLSGSIPHSLGNLTNLAILYLHSNTLLGSIPREIGNLKSLFELQLGDNKLSNSISHSLGNLTHMTLLALYDNALSGVIPEELGNLVKLTMLTLSDNQLQGSIPNLRNLTNLIRLRLNRNHLTCNISESFGIHPKLTFIDLSHNNFYGQISSDWGKCPNLGTFDVSVNNIIGSLPPEIGDSSQLHVIDLSANHIIGKIPSEIGKLSSLIKLILRRNQLFGQLPSELGSLIQLEYLDLSSNRLSNSIPRSLGNLVKLHYLNLSTNQFIQEIPIKLEKLIHLSELDLSHNFLGKEIPSQICNMRSLEMLNLSHNNLSDFIPRCFEEMNGLLYIDISYNELHGPIPNSTAFSDALMEALQGNEGLCGDIKGFQS**********SRKIWVVIVFPLLGTVALLISLIALFFIFRRRKNALQTLQSSPRGTRGFLSVLTFEGKIVYEEIIRQRMVLMMSTALEKVDKEVYTKLIYLLEKSLQSRNFIRHSQVR
**LPNLKISLVIFSLFFLILFPVLDFPLIVYSDSTEEVHALLKWKTSLQNHDKGSLLPSWTLNNATKISPCAWFGIHCNHVGRVNSINLTNVGLKGTLHDFSFSSFPHLAYLDLQVNQIFGIIPPQIGNISKLKYLDLSSNSFSGTIPPQIGNLSMLKFLYLSANQFSGRIPPQIGHLSYIEALHLFKNQLSGPIPHEVGGLSSLNELALTSNFLKGSIPPSLGNLTNLAILYLHNNSLSGSIPSEIGNLKSLSSLALGNNKLCGSIPLFLGNLTNLDTLYLRNNSFSSSIPSEIGNLKSLSILELGENRLNGSIPLSLGNLTNLDTLYLYTNSLSGSIPSEIGNLKSLSGLELADNELSSSIPHYLGNLTNLAAFYLYKNSLSGSIPSEIGNLKSLSNLDLSENKLSGSIPHSLGNLTNLAILYLHSNTLLGSIPREIGNLKSLFELQLGDNKLSNSISHSLGNLTHMTLLALYDNALSGVIPEELGNLVKLTMLTLSDNQLQGSIPNLRNLTNLIRLRLNRNHLTCNISESFGIHPKLTFIDLSHNNFYGQISSDWGKCPNLGTFDVSVNNIIGSLPPEIGDSSQLHVIDLSANHIIGKIPSEIGKLSSLIKLILRRNQLFGQLPSELGSLIQLEYLDLSSNRLSNSIPRSLGNLVKLHYLNLSTNQFIQEIPIKLEKLIHLSELDLSHNFLGKEIPSQICNMRSLEMLNLSHNNLSDFIPRCFEEMNGLLYIDISYNELHGPIPNSTAFSDALMEALQGNEGLCGDIKGFQSCKASKS*KPASRKIWVVIVFPLLGTVALLISLIALFFIFRRRKNALQTLQSSPRGTRGFLSVLTFEGKIVYEEIIRQRMVLMMSTALEKVDKEVYTKLIYLLEKSLQSRNFIRHS***
iiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVLPNLKISLVIFSLFFLILFPVLDFPLIVYSDSTEEVHALLKWKTSLQNHDKGSLLPSWTLNNATKISPCAWFGIHCNHVGRVNSINLTNVGLKGTLHDFSFSSFPHLAYLDLQVNQIFGIIPPQIGNISKLKYLDLSSNSFSGTIPPQIGNLSMLKFLYLSANQFSGRIPPQIGHLSYIEALHLFKNQLSGPIPHEVGGLSSLNELALTSNFLKGSIPPSLGNLTNLAILYLHNNSLSGSIPSEIGNLKSLSSLALGNNKLCGSIPLFLGNLTNLDTLYLRNNSFSSSIPSEIGNLKSLSILELGENRLNGSIPLSLGNLTNLDTLYLYTNSLSGSIPSEIGNLKSLSGLELADNELSSSIPHYLGNLTNLAAFYLYKNSLSGSIPSEIGNLKSLSNLDLSENKLSGSIPHSLGNLTNLAILYLHSNTLLGSIPREIGNLKSLFELQLGDNKLSNSISHSLGNLTHMTLLALYDNALSGVIPEELGNLVKLTMLTLSDNQLQGSIPNLRNLTNLIRLRLNRNHLTCNISESFGIHPKLTFIDLSHNNFYGQISSDWGKCPNLGTFDVSVNNIIGSLPPEIGDSSQLHVIDLSANHIIGKIPSEIGKLSSLIKLILRRNQLFGQLPSELGSLIQLEYLDLSSNRLSNSIPRSLGNLVKLHYLNLSTNQFIQEIPIKLEKLIHLSELDLSHNFLGKEIPSQICNMRSLEMLNLSHNNLSDFIPRCFEEMNGLLYIDISYNELHGPIPNSTAFSDALMEALQGNEGLCGDIKGFQSCKASKSHKPASRKIWVVIVFPLLGTVALLISLIALFFIFRRRKNALQTLQSSPRGTRGFLSVLTFEGKIVYEEIIRQRMVLMMSTALEKVDKEVYTKLIYLLEKSLQSRNFIRHSQVR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query893 2.2.26 [Sep-21-2011]
Q9LP24 1120 Probable leucine-rich rep yes no 0.877 0.7 0.447 0.0
Q8VZG8 1045 Probable LRR receptor-lik no no 0.724 0.619 0.429 1e-140
C0LGQ5 1249 LRR receptor-like serine/ no no 0.876 0.626 0.355 1e-120
Q9FIZ3 1252 LRR receptor-like serine/ no no 0.885 0.631 0.351 1e-119
Q9LVP0 1102 Probable leucine-rich rep no no 0.808 0.655 0.386 1e-118
O49318 1124 Probable leucine-rich rep no no 0.759 0.603 0.369 1e-109
Q9SHI2 1101 Leucine-rich repeat recep no no 0.734 0.595 0.387 1e-109
Q9FL28 1173 LRR receptor-like serine/ no no 0.838 0.638 0.346 1e-106
Q9SSL9 1123 Leucine-rich repeat recep no no 0.817 0.650 0.356 1e-106
Q9LYN8 1192 Leucine-rich repeat recep no no 0.797 0.597 0.361 1e-105
>sp|Q9LP24|Y1571_ARATH Probable leucine-rich repeat receptor-like protein kinase At1g35710 OS=Arabidopsis thaliana GN=At1g35710 PE=2 SV=1 Back     alignment and function desciption
 Score =  637 bits (1642), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/845 (44%), Positives = 524/845 (62%), Gaps = 61/845 (7%)

Query: 37  EVHALLKWKTSLQNHDKGSLLPSWT--LNNATKISPCAWFGIHCNHVGRVNSINLTNVGL 94
           E +ALLKWK++  N  K   L SW    N  T  S  +W+G+ CN  G +  +NLTN G+
Sbjct: 33  EANALLKWKSTFTNSSK---LSSWVHDANTNTSFSCTSWYGVSCNSRGSIEELNLTNTGI 89

Query: 95  KGTLHDFSFSSFPHLAYLDLQVNQIFGIIPPQIGNISKLKYLDLSSNSFSGTIPPQIGNL 154
           +GT  DF F S  +LAY+DL                        S N  SGTIPPQ GNL
Sbjct: 90  EGTFQDFPFISLSNLAYVDL------------------------SMNLLSGTIPPQFGNL 125

Query: 155 SMLKFLYLSANQFSGRIPPQIGHLSYIEALHLFKNQLSGPIPHEVGGLSSLNELALTSNF 214
           S L +  LS N  +G I P +G+L  +  L+L +N L+  IP E+G + S+ +LAL+ N 
Sbjct: 126 SKLIYFDLSTNHLTGEISPSLGNLKNLTVLYLHQNYLTSVIPSELGNMESMTDLALSQNK 185

Query: 215 LKGSIPPSLGNLTNLAILYLHNNSLSGSIPSEIGNLKSLSSLALGNNKLCGSIPLFLGNL 274
           L GSIP SLGNL NL +LYL+ N L+G IP E+GN++S++ LAL  NKL GSIP  LGNL
Sbjct: 186 LTGSIPSSLGNLKNLMVLYLYENYLTGVIPPELGNMESMTDLALSQNKLTGSIPSTLGNL 245

Query: 275 TNLDTLYLRNNSFSSSIPSEIGNLKSLSILELGENRLNGSIPLSLGNLTNLDTLYLYTNS 334
            NL  LYL  N  +  IP EIGN++S++ L L +N+L GSIP SLGNL NL  L L+ N 
Sbjct: 246 KNLMVLYLYENYLTGVIPPEIGNMESMTNLALSQNKLTGSIPSSLGNLKNLTLLSLFQNY 305

Query: 335 LSGSIPSEIGNLKSLSGLELADNELSSSIPHYLGNLTNLAAFYLYKNSLSGSIPSEIGNL 394
           L+G IP ++GN++S+  LEL++N+L+ SIP  LGNL NL   YLY+N L+G IP E+GN+
Sbjct: 306 LTGGIPPKLGNIESMIDLELSNNKLTGSIPSSLGNLKNLTILYLYENYLTGVIPPELGNM 365

Query: 395 KSLSNLDLSENKLSGSIPHSLGNLTNLAILYLHSNTLLGSIPREIGNLKSLFELQLGDNK 454
           +S+ +L L+ NKL+GSIP S GNL NL  LYL+ N L G IP+E+GN++S+  L L  NK
Sbjct: 366 ESMIDLQLNNNKLTGSIPSSFGNLKNLTYLYLYLNYLTGVIPQELGNMESMINLDLSQNK 425

Query: 455 LSNSISHSLGNLT------------------------HMTLLALYDNALSGVIPEELGNL 490
           L+ S+  S GN T                        H+T L L  N  +G  PE +   
Sbjct: 426 LTGSVPDSFGNFTKLESLYLRVNHLSGAIPPGVANSSHLTTLILDTNNFTGFFPETVCKG 485

Query: 491 VKLTMLTLSDNQLQGSIP-NLRNLTNLIRLRLNRNHLTCNISESFGIHPKLTFIDLSHNN 549
            KL  ++L  N L+G IP +LR+  +LIR R   N  T +I E+FGI+P L FID SHN 
Sbjct: 486 RKLQNISLDYNHLEGPIPKSLRDCKSLIRARFLGNKFTGDIFEAFGIYPDLNFIDFSHNK 545

Query: 550 FYGQISSDWGKCPNLGTFDVSVNNIIGSLPPEIGDSSQLHVIDLSANHIIGKIPSEIGKL 609
           F+G+ISS+W K P LG   +S NNI G++P EI + +QL  +DLS N++ G++P  IG L
Sbjct: 546 FHGEISSNWEKSPKLGALIMSNNNITGAIPTEIWNMTQLVELDLSTNNLFGELPEAIGNL 605

Query: 610 SSLIKLILRRNQLFGQLPSELGSLIQLEYLDLSSNRLSNSIPRSLGNLVKLHYLNLSTNQ 669
           ++L +L L  NQL G++P+ L  L  LE LDLSSN  S+ IP++  + +KLH +NLS N+
Sbjct: 606 TNLSRLRLNGNQLSGRVPAGLSFLTNLESLDLSSNNFSSEIPQTFDSFLKLHDMNLSRNK 665

Query: 670 FIQEIPIKLEKLIHLSELDLSHNFLGKEIPSQICNMRSLEMLNLSHNNLSDFIPRCFEEM 729
           F   IP +L KL  L++LDLSHN L  EIPSQ+ +++SL+ L+LSHNNLS  IP  FE M
Sbjct: 666 FDGSIP-RLSKLTQLTQLDLSHNQLDGEIPSQLSSLQSLDKLDLSHNNLSGLIPTTFEGM 724

Query: 730 NGLLYIDISYNELHGPIPNSTAFSDALMEALQGNEGLCGDI--KGFQSCKA-SKSHKPAS 786
             L  +DIS N+L GP+P++  F  A  +AL+ N GLC +I  +  + C+   K  K  +
Sbjct: 725 IALTNVDISNNKLEGPLPDTPTFRKATADALEENIGLCSNIPKQRLKPCRELKKPKKNGN 784

Query: 787 RKIWVVIVFPLLGTVALLISLIALFFIFRRRKNALQTLQSSPRGTRGFLSVLTFEGKIVY 846
             +W+++  P+LG V +++S+ A  F +  RK  LQ  +++   T   +S+ + +GK  Y
Sbjct: 785 LVVWILV--PILG-VLVILSICANTFTYCIRKRKLQNGRNTDPETGENMSIFSVDGKFKY 841

Query: 847 EEIIR 851
           ++II 
Sbjct: 842 QDIIE 846





Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|Q8VZG8|Y4885_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g08850 OS=Arabidopsis thaliana GN=At4g08850 PE=1 SV=3 Back     alignment and function description
>sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 Back     alignment and function description
>sp|Q9FIZ3|GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2 Back     alignment and function description
>sp|Q9LVP0|Y5639_ARATH Probable leucine-rich repeat receptor-like protein kinase At5g63930 OS=Arabidopsis thaliana GN=At5g63930 PE=1 SV=1 Back     alignment and function description
>sp|O49318|Y2317_ARATH Probable leucine-rich repeat receptor-like protein kinase At2g33170 OS=Arabidopsis thaliana GN=At2g33170 PE=2 SV=1 Back     alignment and function description
>sp|Q9SHI2|Y1723_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230 OS=Arabidopsis thaliana GN=At1g17230 PE=2 SV=2 Back     alignment and function description
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function description
>sp|Q9SSL9|PEPR1_ARATH Leucine-rich repeat receptor-like protein kinase PEPR1 OS=Arabidopsis thaliana GN=PEPR1 PE=1 SV=1 Back     alignment and function description
>sp|Q9LYN8|EXS_ARATH Leucine-rich repeat receptor protein kinase EXS OS=Arabidopsis thaliana GN=EXS PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query893
297846638 1123 hypothetical protein ARALYDRAFT_473694 [ 0.881 0.700 0.459 0.0
15219699 1120 putative leucine-rich repeat receptor-li 0.877 0.7 0.447 1e-179
357439013 1131 Receptor protein kinase-like protein [Me 0.900 0.710 0.424 1e-175
356577797 1204 PREDICTED: probable LRR receptor-like se 0.908 0.673 0.427 1e-175
224589418845 leucine-rich repeat receptor-like protei 0.845 0.893 0.453 1e-174
224145445 1163 predicted protein [Populus trichocarpa] 0.885 0.680 0.465 1e-172
357439001 1150 Receptor protein kinase-like protein [Me 0.930 0.722 0.426 1e-167
357439011 1191 Receptor protein kinase-like protein [Me 0.930 0.697 0.426 1e-167
224146638 1188 predicted protein [Populus trichocarpa] 0.891 0.670 0.431 1e-165
357439017 1157 Receptor-like protein kinase [Medicago t 0.916 0.707 0.414 1e-163
>gi|297846638|ref|XP_002891200.1| hypothetical protein ARALYDRAFT_473694 [Arabidopsis lyrata subsp. lyrata] gi|297337042|gb|EFH67459.1| hypothetical protein ARALYDRAFT_473694 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
 Score =  678 bits (1749), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/845 (45%), Positives = 528/845 (62%), Gaps = 58/845 (6%)

Query: 37  EVHALLKWKTSLQNHDKGSLLPSWT--LNNATKISPCAWFGIHCNHVGRVNSINLTNVGL 94
           E +ALLKWK++  N    S L SW    N     S  +W+G+ CN  G +  +NLT+  +
Sbjct: 33  EANALLKWKSTFTNQSHSSKLSSWVNDANTNPSFSCTSWYGVFCNSRGSIEKLNLTDNAI 92

Query: 95  KGTLHDFSFSSFPHLAYLDLQVNQIFGIIPPQIGNISKLKYLDLSSNSFSGTIPPQIGNL 154
           +GT  DF FSS P+LA +DL +N+                        FSGTIPPQ GNL
Sbjct: 93  EGTFQDFPFSSLPNLASIDLSMNR------------------------FSGTIPPQFGNL 128

Query: 155 SMLKFLYLSANQFSGRIPPQIGHLSYIEALHLFKNQLSGPIPHEVGGLSSLNELALTSNF 214
           S L +  LS N  +  IPP +G+L  +  L L  N L+G IP ++G + S+  L L+ N 
Sbjct: 129 SKLIYFDLSTNHLTREIPPSLGNLKNLTVLDLHHNYLTGVIPPDLGNMESMTYLELSHNK 188

Query: 215 LKGSIPPSLGNLTNLAILYLHNNSLSGSIPSEIGNLKSLSSLALGNNKLCGSIPLFLGNL 274
           L GSIP SLGNL NL +LYL+ N L+G IP E+GN++S+  L L  NKL GSIP  LGNL
Sbjct: 189 LTGSIPSSLGNLKNLTVLYLYQNYLTGVIPPELGNMESMIDLELSTNKLTGSIPSSLGNL 248

Query: 275 TNLDTLYLRNNSFSSSIPSEIGNLKSLSILELGENRLNGSIPLSLGNLTNLDTLYLYTNS 334
            NL  LYL +N  +  IP E+GN++S+  LEL +N+L GSIP SLGNL NL  LYLY N 
Sbjct: 249 KNLTVLYLHHNYLTGVIPPELGNMESMIDLELSDNKLTGSIPSSLGNLKNLTVLYLYKNY 308

Query: 335 LSGSIPSEIGNLKSLSGLELADNELSSSIPHYLGNLTNLAAFYLYKNSLSGSIPSEIGNL 394
           L+G IP E+GN++S++ L+L++N+L+ SIP  LGNL NL   YL+ N L+G IP E+GNL
Sbjct: 309 LTGVIPPELGNMESMTYLDLSENKLTGSIPSSLGNLKNLTVLYLHHNYLTGVIPPELGNL 368

Query: 395 KSLSNLDLSENKLSGSIPHSLGNLTNLAILYLHSNTLLGSIPREIGNLKSLFELQLGDNK 454
           +S+ +L+LS+NKL+GSIP SLGNL NL +LYLH N L G IP E+GN++S+ +L L  N 
Sbjct: 369 ESMIDLELSDNKLTGSIPSSLGNLKNLTVLYLHHNYLTGVIPPELGNMESMIDLALSQNN 428

Query: 455 LSNSISHSLGNLTHMTLLALYDNALSGVIPEELGNLVKLTML------------------ 496
           L+ SI  S GN T +  L L DN LSG IP  + N  +LT L                  
Sbjct: 429 LTGSIPSSFGNFTKLESLYLRDNHLSGTIPRGVANSSELTELLLDINNFTGFLPENICKG 488

Query: 497 ------TLSDNQLQGSIP-NLRNLTNLIRLRLNRNHLTCNISESFGIHPKLTFIDLSHNN 549
                 +L  N L+G IP +LR+  +LIR +   N    NISE+FG++P L FIDLSHN 
Sbjct: 489 GKLQNFSLDYNHLEGHIPKSLRDCKSLIRAKFVGNKFIGNISEAFGVYPDLDFIDLSHNK 548

Query: 550 FYGQISSDWGKCPNLGTFDVSVNNIIGSLPPEIGDSSQLHVIDLSANHIIGKIPSEIGKL 609
           F G+ISS+W K P LG   +S NNI G++PPEI +  QL  +DLS N++ G++P  IG L
Sbjct: 549 FNGEISSNWQKSPKLGALIMSNNNITGAIPPEIWNMKQLGELDLSTNNLTGELPEAIGNL 608

Query: 610 SSLIKLILRRNQLFGQLPSELGSLIQLEYLDLSSNRLSNSIPRSLGNLVKLHYLNLSTNQ 669
           + L KL+L  N+L G++P+ L  L  LE LDLSSNR S+ IP++  + +KLH +NLS N 
Sbjct: 609 TGLSKLLLNGNKLSGRVPTGLSFLTNLESLDLSSNRFSSQIPQTFDSFLKLHEMNLSKNN 668

Query: 670 FIQEIPIKLEKLIHLSELDLSHNFLGKEIPSQICNMRSLEMLNLSHNNLSDFIPRCFEEM 729
           F   IP  L KL  L+ LDLSHN L  EIPSQ+ +++SL+ LNLSHNNLS FIP  FE M
Sbjct: 669 FDGRIP-GLTKLTQLTHLDLSHNQLDGEIPSQLSSLQSLDKLNLSHNNLSGFIPTTFESM 727

Query: 730 NGLLYIDISYNELHGPIPNSTAFSDALMEALQGNEGLCGDI--KGFQSCKA-SKSHKPAS 786
             L +IDIS N+L GP+P++ AF +A  +AL+GN GLC +I  +  +SC+   K  K  +
Sbjct: 728 KALTFIDISNNKLEGPLPDNPAFQNATSDALEGNRGLCSNIPKQRLKSCRGFQKPKKNGN 787

Query: 787 RKIWVVIVFPLLGTVALLISLIALFFIFRRRKNALQTLQSSPRGTRGFLSVLTFEGKIVY 846
             +W+++  P+LG + +L S+ A  F +  RK      +++   T   +S+ + +GK  Y
Sbjct: 788 LLVWILV--PILGALVIL-SICAGAFTYYIRKRKPHNGRNTDSETGENMSIFSVDGKFKY 844

Query: 847 EEIIR 851
           ++II 
Sbjct: 845 QDIIE 849




Source: Arabidopsis lyrata subsp. lyrata

Species: Arabidopsis lyrata

Genus: Arabidopsis

Family: Brassicaceae

Order: Brassicales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|15219699|ref|NP_174809.1| putative leucine-rich repeat receptor-like protein [Arabidopsis thaliana] gi|75175345|sp|Q9LP24.1|Y1571_ARATH RecName: Full=Probable leucine-rich repeat receptor-like protein kinase At1g35710; Flags: Precursor gi|8778966|gb|AAF79881.1|AC021198_1 Contains similarity to receptor protein kinase-like protein from Arabidopsis thaliana gb|AL161513. It contains a eukaryotic protein kinase domain PF|00069. EST gb|AI997574 comes from this gene [Arabidopsis thaliana] gi|332193703|gb|AEE31824.1| putative leucine-rich repeat receptor-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|357439013|ref|XP_003589783.1| Receptor protein kinase-like protein [Medicago truncatula] gi|355478831|gb|AES60034.1| Receptor protein kinase-like protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|356577797|ref|XP_003557009.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g08850-like [Glycine max] Back     alignment and taxonomy information
>gi|224589418|gb|ACN59243.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|224145445|ref|XP_002325645.1| predicted protein [Populus trichocarpa] gi|222862520|gb|EEF00027.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357439001|ref|XP_003589777.1| Receptor protein kinase-like protein [Medicago truncatula] gi|355478825|gb|AES60028.1| Receptor protein kinase-like protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|357439011|ref|XP_003589782.1| Receptor protein kinase-like protein [Medicago truncatula] gi|355478830|gb|AES60033.1| Receptor protein kinase-like protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|224146638|ref|XP_002326079.1| predicted protein [Populus trichocarpa] gi|222862954|gb|EEF00461.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357439017|ref|XP_003589785.1| Receptor-like protein kinase [Medicago truncatula] gi|355478833|gb|AES60036.1| Receptor-like protein kinase [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query893
TAIR|locus:2011339 1120 AT1G35710 [Arabidopsis thalian 0.909 0.725 0.414 7.7e-158
TAIR|locus:2138268 1045 AT4G08850 [Arabidopsis thalian 0.751 0.642 0.381 5.2e-113
TAIR|locus:2160791 1102 AT5G63930 [Arabidopsis thalian 0.705 0.571 0.401 8.6e-104
TAIR|locus:2120362 1249 GSO1 "GASSHO1" [Arabidopsis th 0.778 0.556 0.362 3.6e-103
TAIR|locus:2156349 1252 GSO2 "GASSHO 2" [Arabidopsis t 0.760 0.542 0.370 4.9e-101
TAIR|locus:2182870 1192 EMS1 "EXCESS MICROSPOROCYTES1" 0.784 0.588 0.36 6.2e-101
TAIR|locus:2046525 1124 AT2G33170 [Arabidopsis thalian 0.724 0.575 0.370 1.7e-98
TAIR|locus:2131518 1091 AT4G26540 [Arabidopsis thalian 0.706 0.578 0.373 1.1e-96
UNIPROTKB|P93194 1109 INRPK1 "Receptor-like protein 0.732 0.589 0.356 4.7e-96
TAIR|locus:2032697 1123 PEPR1 "PEP1 receptor 1" [Arabi 0.771 0.613 0.341 4.7e-96
TAIR|locus:2011339 AT1G35710 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1538 (546.5 bits), Expect = 7.7e-158, P = 7.7e-158
 Identities = 342/825 (41%), Positives = 476/825 (57%)

Query:    32 SDSTEEVHALLKWKTSLQNHDKGSLLPSWT--LNNATKISPCAWFGIHCNHVGRVNSINL 89
             S +  E +ALLKWK++  N  K   L SW    N  T  S  +W+G+ CN  G +  +NL
Sbjct:    28 SATIAEANALLKWKSTFTNSSK---LSSWVHDANTNTSFSCTSWYGVSCNSRGSIEELNL 84

Query:    90 TNVGLKGTLHDFSFSSFPHLAYLDLQVNQIFGIIPPQIGNISKLKYLDLSSNSFSGTIPP 149
             TN G++GT  DF F S  +LAY+DL +N + G IPPQ GN+SKL Y DLS+N  +G I P
Sbjct:    85 TNTGIEGTFQDFPFISLSNLAYVDLSMNLLSGTIPPQFGNLSKLIYFDLSTNHLTGEISP 144

Query:   150 QIGNLSMLKFLYLSANQFSGRIPPQIGHLSYIEALHLFKNQLSGPIPHEVGGLSSLNELA 209
              +GNL  L  LYL  N  +  IP ++G++  +  L L +N+L+G IP  +G L +L  L 
Sbjct:   145 SLGNLKNLTVLYLHQNYLTSVIPSELGNMESMTDLALSQNKLTGSIPSSLGNLKNLMVLY 204

Query:   210 LTSNFLKGSIPPSLGNLTNLAILYLHNNSLSGSIPSEIGNLKSLSSLALGNNKLCGSIPL 269
             L  N+L G IPP LGN+ ++  L L  N L+GSIPS +GNLK+L  L L  N L G IP 
Sbjct:   205 LYENYLTGVIPPELGNMESMTDLALSQNKLTGSIPSTLGNLKNLMVLYLYENYLTGVIPP 264

Query:   270 FLGNLTNLDTLYLRNNSFSSSIPSEIGNLKSLSILELGENRLNGSIPLSXXXXXXXXXXX 329
              +GN+ ++  L L  N  + SIPS +GNLK+L++L L +N L G IP             
Sbjct:   265 EIGNMESMTNLALSQNKLTGSIPSSLGNLKNLTLLSLFQNYLTGGIPPKLGNIESMIDLE 324

Query:   330 XXXXXXXGSIPSEIGNLKSLSGLELADNELSSSIPHYLGNLTNLAAFYLYKNSLSGSIPS 389
                    GSIPS +GNLK+L+ L L +N L+  IP  LGN+ ++    L  N L+GSIPS
Sbjct:   325 LSNNKLTGSIPSSLGNLKNLTILYLYENYLTGVIPPELGNMESMIDLQLNNNKLTGSIPS 384

Query:   390 EIGNLKSLSNLDLSENKLSGSIPHSLGNLTNLAILYLHSNTLLGSIPREIGNLKSLFELQ 449
               GNLK+L+ L L  N L+G IP  LGN+ ++  L L  N L GS+P   GN   L  L 
Sbjct:   385 SFGNLKNLTYLYLYLNYLTGVIPQELGNMESMINLDLSQNKLTGSVPDSFGNFTKLESLY 444

Query:   450 LGDNKLSNSISHSLGNLTHMTLLALYDNALSGVIPEELGNLVKLTMLTLSDNQLQGSIPX 509
             L  N LS +I   + N +H+T L L  N  +G  PE +    KL  ++L  N L+G IP 
Sbjct:   445 LRVNHLSGAIPPGVANSSHLTTLILDTNNFTGFFPETVCKGRKLQNISLDYNHLEGPIPK 504

Query:   510 XXXXXXXXXXXXXXXH-LTCNISESFGIHPKLTFIDLSHNNFYGQISSDWGKCPNLGTFD 568
                            +  T +I E+FGI+P L FID SHN F+G+ISS+W K P LG   
Sbjct:   505 SLRDCKSLIRARFLGNKFTGDIFEAFGIYPDLNFIDFSHNKFHGEISSNWEKSPKLGALI 564

Query:   569 VSVNNIIGSLPPEIGDSSQLHVIDLSANHIIGKIPSEIGXXXXXXXXXXXXNQLFGQLPS 628
             +S NNI G++P EI + +QL  +DLS N++ G++P  IG            NQL G++P+
Sbjct:   565 MSNNNITGAIPTEIWNMTQLVELDLSTNNLFGELPEAIGNLTNLSRLRLNGNQLSGRVPA 624

Query:   629 ELGSLIQLEYLDLSSNRLSNSIPRSLGNLVKLHYLNLSTNQFIQEIPIKLEKLIHLSELD 688
              L  L  LE LDLSSN  S+ IP++  + +KLH +NLS N+F   IP +L KL  L++LD
Sbjct:   625 GLSFLTNLESLDLSSNNFSSEIPQTFDSFLKLHDMNLSRNKFDGSIP-RLSKLTQLTQLD 683

Query:   689 LSHNFLGKEIPSQICNMRSLEMLNLSHNNLSDFIPRCFEEMNGLLYIDISYNELHGPIPN 748
             LSHN L  EIPSQ+ +++SL+ L+LSHNNLS  IP  FE M  L  +DIS N+L GP+P+
Sbjct:   684 LSHNQLDGEIPSQLSSLQSLDKLDLSHNNLSGLIPTTFEGMIALTNVDISNNKLEGPLPD 743

Query:   749 STAFSDALMEALQGNEGLCGDI--KGFQSCKA-SKSHKPASRKIWVVIVFPLLGTVXXXX 805
             +  F  A  +AL+ N GLC +I  +  + C+   K  K  +  +W+++  P+LG V    
Sbjct:   744 TPTFRKATADALEENIGLCSNIPKQRLKPCRELKKPKKNGNLVVWILV--PILG-VLVIL 800

Query:   806 XXXXXXXXXXXXKNALQTLQSSPRGTRGFLSVLTFEGKIVYEEII 850
                         K  LQ  +++   T   +S+ + +GK  Y++II
Sbjct:   801 SICANTFTYCIRKRKLQNGRNTDPETGENMSIFSVDGKFKYQDII 845




GO:0004672 "protein kinase activity" evidence=IEA
GO:0004674 "protein serine/threonine kinase activity" evidence=ISS
GO:0004713 "protein tyrosine kinase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA;ISS
GO:0005886 "plasma membrane" evidence=ISM
GO:0006468 "protein phosphorylation" evidence=IEA;ISS
GO:0007169 "transmembrane receptor protein tyrosine kinase signaling pathway" evidence=ISS
GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA
GO:0000165 "MAPK cascade" evidence=RCA
GO:0009814 "defense response, incompatible interaction" evidence=RCA
TAIR|locus:2138268 AT4G08850 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2160791 AT5G63930 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2120362 GSO1 "GASSHO1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2156349 GSO2 "GASSHO 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2182870 EMS1 "EXCESS MICROSPOROCYTES1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046525 AT2G33170 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2131518 AT4G26540 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|P93194 INRPK1 "Receptor-like protein kinase" [Ipomoea nil (taxid:35883)] Back     alignment and assigned GO terms
TAIR|locus:2032697 PEPR1 "PEP1 receptor 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query893
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-115
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-23
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-19
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 8e-16
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 5e-15
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-15
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-14
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-14
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-14
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-14
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 7e-14
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-13
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-13
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 1e-13
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-12
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 3e-12
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 5e-12
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-11
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-10
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-09
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 2e-07
pfam0826342 pfam08263, LRRNT_2, Leucine rich repeat N-terminal 7e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 7e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 8e-05
PLN032101153 PLN03210, PLN03210, Resistant to P 2e-04
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 0.001
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.001
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.001
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 0.002
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.002
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.003
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score =  374 bits (963), Expect = e-115
 Identities = 258/674 (38%), Positives = 345/674 (51%), Gaps = 85/674 (12%)

Query: 153 NLSMLKFLYLSANQFSGRIPPQIGHLSYIEALHLFKNQLSGPIPHEVGGLS-SLNELALT 211
           N S +  + LS    SG+I   I  L YI+ ++L  NQLSGPIP ++   S SL  L L+
Sbjct: 67  NSSRVVSIDLSGKNISGKISSAIFRLPYIQTINLSNNQLSGPIPDDIFTTSSSLRYLNLS 126

Query: 212 SNFLKGSIPPSLGNLTNLAILYLHNNSLSGSIPSEIGNLKSLSSLALGNNKLCGSIPLFL 271
           +N   GSIP   G++ NL  L L NN LSG IP++IG+  SL  L LG N L G IP  L
Sbjct: 127 NNNFTGSIPR--GSIPNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSL 184

Query: 272 GNLTNLDTLYLRNNSFSSSIPSEIGNLKSLSILELGENRLNGSIPLSLGNLTNLDTLYLY 331
            NLT                        SL  L L  N+L G IP  LG + +L  +YL 
Sbjct: 185 TNLT------------------------SLEFLTLASNQLVGQIPRELGQMKSLKWIYLG 220

Query: 332 TNSLSGSIPSEIGNLKSLSGLELADNELSSSIPHYLGNLTNLAAFYLYKNSLSGSIPSEI 391
            N+LSG IP EIG L SL+ L+L  N L+  IP  LGNL NL   +LY+N LSG IP  I
Sbjct: 221 YNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIPPSI 280

Query: 392 GNLKSLSNLDLSENKLSGSIPHSLGNLTNLAILYLHSNTLLGSIPREIGNLKSLFELQLG 451
            +L+ L +LDLS+N LSG IP  +  L NL IL+L SN   G IP  + +L  L  LQL 
Sbjct: 281 FSLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFTGKIPVALTSLPRLQVLQLW 340

Query: 452 DNKLSNSISHSLGNLTHMTLLALYDNALSGVIPEELGNLVKLTMLTLSDNQLQGSIP-NL 510
            NK S  I  +LG   ++T+L L  N L+G IPE L +   L  L L  N L+G IP +L
Sbjct: 341 SNKFSGEIPKNLGKHNNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSL 400

Query: 511 RNLTNLIRLRLNRNHLTCNISESFGIHPKLTFIDLSHNNFYGQISSDWGKCPNLGTFDVS 570
               +L R+RL  N  +  +   F   P + F+D+S+NN  G+I+S     P+L    ++
Sbjct: 401 GACRSLRRVRLQDNSFSGELPSEFTKLPLVYFLDISNNNLQGRINSRKWDMPSLQMLSLA 460

Query: 571 VNNIIGSLPPEIGDSSQLHVIDLSANHIIGKIPSEIGKLSSLIKLILRRNQLFGQLPSEL 630
            N   G LP   G S +L  +DLS N   G +P ++G LS L++L L  N+L G++P EL
Sbjct: 461 RNKFFGGLPDSFG-SKRLENLDLSRNQFSGAVPRKLGSLSELMQLKLSENKLSGEIPDEL 519

Query: 631 GSLIQLEYLDLSSNRLSNSIPRSLGNLVKLHYLNLSTNQFIQEIPIKLEKLIHLSELDLS 690
            S  +L  LDLS N+LS  IP S                   E+P+       LS+LDLS
Sbjct: 520 SSCKKLVSLDLSHNQLSGQIPASFS-----------------EMPV-------LSQLDLS 555

Query: 691 HNFLGKEIPSQICNMRSLEMLNLSHNNLSDFIPRCFEEMNGLLYIDISYNELHGPIPNST 750
            N L  EIP  + N+ SL  +N+SHN+L                        HG +P++ 
Sbjct: 556 QNQLSGEIPKNLGNVESLVQVNISHNHL------------------------HGSLPSTG 591

Query: 751 AFSDALMEALQGNEGLCGDIK--GFQSCKASKSHKPASRKIWVVIVFPLLGTVALLISLI 808
           AF      A+ GN  LCG     G   CK     +      W   +   LG   L+++L+
Sbjct: 592 AFLAINASAVAGNIDLCGGDTTSGLPPCK-----RVRKTPSWWFYITCTLG-AFLVLALV 645

Query: 809 ALFFIFRRRKNALQ 822
           A  F+F R +N L+
Sbjct: 646 AFGFVFIRGRNNLE 659


Length = 968

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|219766 pfam08263, LRRNT_2, Leucine rich repeat N-terminal domain Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 893
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG4194873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 100.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.98
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.97
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.97
PLN032101153 Resistant to P. syringae 6; Provisional 99.92
PLN032101153 Resistant to P. syringae 6; Provisional 99.91
KOG4237498 consensus Extracellular matrix protein slit, conta 99.87
KOG4237498 consensus Extracellular matrix protein slit, conta 99.86
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.83
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.82
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.81
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.76
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.72
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.69
KOG0617264 consensus Ras suppressor protein (contains leucine 99.65
KOG0617264 consensus Ras suppressor protein (contains leucine 99.6
PLN03150623 hypothetical protein; Provisional 99.6
PLN03150623 hypothetical protein; Provisional 99.54
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.12
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.11
KOG0532722 consensus Leucine-rich repeat (LRR) protein, conta 99.11
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.07
KOG0532722 consensus Leucine-rich repeat (LRR) protein, conta 99.06
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.01
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.99
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.98
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.95
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.91
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.91
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.91
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.9
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.87
PF0826343 LRRNT_2: Leucine rich repeat N-terminal domain; In 98.85
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.75
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.74
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.73
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.71
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.51
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.35
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.21
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.07
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.05
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.01
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.97
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.92
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.88
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.78
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.69
PRK15386426 type III secretion protein GogB; Provisional 97.66
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.6
PRK15386426 type III secretion protein GogB; Provisional 97.57
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.33
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.26
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.25
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.17
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.11
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.11
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.91
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.79
KOG2123 388 consensus Uncharacterized conserved protein [Funct 96.65
KOG4341483 consensus F-box protein containing LRR [General fu 96.4
KOG4341483 consensus F-box protein containing LRR [General fu 96.19
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.0
KOG1947482 consensus Leucine rich repeat proteins, some prote 94.82
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.73
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.73
KOG1947482 consensus Leucine rich repeat proteins, some prote 94.55
KOG4308478 consensus LRR-containing protein [Function unknown 94.19
KOG4308478 consensus LRR-containing protein [Function unknown 93.4
KOG0473326 consensus Leucine-rich repeat protein [Function un 91.32
KOG0473326 consensus Leucine-rich repeat protein [Function un 90.28
KOG1187 361 consensus Serine/threonine protein kinase [Signal 89.51
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 88.53
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 88.19
smart0037026 LRR Leucine-rich repeats, outliers. 88.19
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 83.36
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 82.75
smart0037026 LRR Leucine-rich repeats, outliers. 81.98
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 81.98
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=100.00  E-value=2.5e-78  Score=751.91  Aligned_cols=591  Identities=40%  Similarity=0.639  Sum_probs=432.7

Q ss_pred             CHHHHHHHHHHHhhCCCCCCCCCCCCCCCCCCCCCCCCccCceeeCCCCCEEEEEcCCCCCccccCCccCCCCCCCCEEE
Q 002679           34 STEEVHALLKWKTSLQNHDKGSLLPSWTLNNATKISPCAWFGIHCNHVGRVNSINLTNVGLKGTLHDFSFSSFPHLAYLD  113 (893)
Q Consensus        34 ~~~~~~~ll~~k~~~~~~~~~~~l~~W~~~~~~~~~~c~w~gv~c~~~~~v~~l~l~~~~l~g~~~~~~~~~l~~L~~L~  113 (893)
                      .++|++||++||+++.+ + .+.+.+|+    ...+||.|.||+|+..++|+.|+|+++++.|.++ ..|..+++|++|+
T Consensus        27 ~~~~~~~l~~~~~~~~~-~-~~~~~~w~----~~~~~c~w~gv~c~~~~~v~~L~L~~~~i~~~~~-~~~~~l~~L~~L~   99 (968)
T PLN00113         27 HAEELELLLSFKSSIND-P-LKYLSNWN----SSADVCLWQGITCNNSSRVVSIDLSGKNISGKIS-SAIFRLPYIQTIN   99 (968)
T ss_pred             CHHHHHHHHHHHHhCCC-C-cccCCCCC----CCCCCCcCcceecCCCCcEEEEEecCCCccccCC-hHHhCCCCCCEEE
Confidence            46899999999999964 5 56789997    5678999999999988899999999999999887 7899999999999


Q ss_pred             CCCCCCCccCCcccc-CCCCCCEEeCCCCCCCCCCCccccCCCCCCeecCCCccCCCCCCCCCCCCCCCCEEeCCCccCC
Q 002679          114 LQVNQIFGIIPPQIG-NISKLKYLDLSSNSFSGTIPPQIGNLSMLKFLYLSANQFSGRIPPQIGHLSYIEALHLFKNQLS  192 (893)
Q Consensus       114 L~~n~l~~~~~~~~~-~l~~L~~L~Ls~n~~~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~  192 (893)
                      |++|.+.+.+|..+. .+++|++|+|++|.+++.+|.  +.+++|++|+|++|.+.+.+|..++++++|++|++++|.+.
T Consensus       100 Ls~n~~~~~ip~~~~~~l~~L~~L~Ls~n~l~~~~p~--~~l~~L~~L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~l~  177 (968)
T PLN00113        100 LSNNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPR--GSIPNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLV  177 (968)
T ss_pred             CCCCccCCcCChHHhccCCCCCEEECcCCccccccCc--cccCCCCEEECcCCcccccCChHHhcCCCCCEEECccCccc
Confidence            999999988887654 899999999999999988885  56888999999999988888888888888888888888888


Q ss_pred             CCCCcccCCCCCCCEEEccCCCCCCCCCCCCCCCCCCCEEEccCCcCCCCCCccccCCCCCCEEEccCCCCCCCCCCcCC
Q 002679          193 GPIPHEVGGLSSLNELALTSNFLKGSIPPSLGNLTNLAILYLHNNSLSGSIPSEIGNLKSLSSLALGNNKLCGSIPLFLG  272 (893)
Q Consensus       193 ~~~p~~~~~l~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~Ls~n~l~~~~p~~l~  272 (893)
                      +.+|..+.++++|++|++++|.+.+.+|..++++++|++|++++|.+++.+|..++++++|++|++++|.+.+.+|..++
T Consensus       178 ~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~  257 (968)
T PLN00113        178 GKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLG  257 (968)
T ss_pred             ccCChhhhhCcCCCeeeccCCCCcCcCChHHcCcCCccEEECcCCccCCcCChhHhcCCCCCEEECcCceeccccChhHh
Confidence            88888888888888888888888777777777777777777777777777777777777777777777777766666666


Q ss_pred             CCCCCCEEEeecCCCCCCCCccccCCCCCCeeecCCCcCCCCCCCCCCCCCCCCEEEccCCCCccccCCCCCCCCCCCeE
Q 002679          273 NLTNLDTLYLRNNSFSSSIPSEIGNLKSLSILELGENRLNGSIPLSLGNLTNLDTLYLYTNSLSGSIPSEIGNLKSLSGL  352 (893)
Q Consensus       273 ~l~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L  352 (893)
                      ++++|++|++++|.+.+.+|..+.++++|++|++++|.+.+.+|..+.++++|+.|++++|.+.+..|..+..+++|+.|
T Consensus       258 ~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L  337 (968)
T PLN00113        258 NLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFTGKIPVALTSLPRLQVL  337 (968)
T ss_pred             CCCCCCEEECcCCeeeccCchhHhhccCcCEEECcCCeeccCCChhHcCCCCCcEEECCCCccCCcCChhHhcCCCCCEE
Confidence            77777777777776666666666666666666666666666666655566666666666665555555555555555555


Q ss_pred             EccCCcCCCCcccccCCCcccceEecccccCCCCCCccccccccCceeccCCccccccCCccccCCCccceeeccccccc
Q 002679          353 ELADNELSSSIPHYLGNLTNLAAFYLYKNSLSGSIPSEIGNLKSLSNLDLSENKLSGSIPHSLGNLTNLAILYLHSNTLL  432 (893)
Q Consensus       353 ~ls~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~l~~l~~L~~L~L~~n~l~  432 (893)
                      ++++|.+++.                        +|..++.+++|+.|++++|++.+.+|..+..+++|+.|++++|.+.
T Consensus       338 ~L~~n~l~~~------------------------~p~~l~~~~~L~~L~Ls~n~l~~~~p~~~~~~~~L~~L~l~~n~l~  393 (968)
T PLN00113        338 QLWSNKFSGE------------------------IPKNLGKHNNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLE  393 (968)
T ss_pred             ECcCCCCcCc------------------------CChHHhCCCCCcEEECCCCeeEeeCChhHhCcCCCCEEECcCCEec
Confidence            5555555544                        4444455555555555555555555555555556666666666666


Q ss_pred             ccCChhhhcccccccccCCCCCcCCCccccCCCCCccceEEcccCcCcccCCccccCCCCCCEEecCCCcCcCCCCCcCC
Q 002679          433 GSIPREIGNLKSLFELQLGDNKLSNSISHSLGNLTHMTLLALYDNALSGVIPEELGNLVKLTMLTLSDNQLQGSIPNLRN  512 (893)
Q Consensus       433 ~~~~~~~~~~~~L~~L~Ls~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~l~~  512 (893)
                      +.+|..+..+++|+.|++++|++++..|..+..++.|+.+++++|.+++.++..+..++                     
T Consensus       394 ~~~p~~~~~~~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~~~~~~~l~---------------------  452 (968)
T PLN00113        394 GEIPKSLGACRSLRRVRLQDNSFSGELPSEFTKLPLVYFLDISNNNLQGRINSRKWDMP---------------------  452 (968)
T ss_pred             ccCCHHHhCCCCCCEEECcCCEeeeECChhHhcCCCCCEEECcCCcccCccChhhccCC---------------------
Confidence            66666666666666666666666666666666777777777777766654443222221                     


Q ss_pred             CCCCCEEEcCCCcCCCCCCccccCCCCCcEEeccCCcccccCCcCcCCCCCccEEEccCCccCCCCCCCcCCCCCccEEE
Q 002679          513 LTNLIRLRLNRNHLTCNISESFGIHPKLTFIDLSHNNFYGQISSDWGKCPNLGTFDVSVNNIIGSLPPEIGDSSQLHVID  592 (893)
Q Consensus       513 ~~~L~~L~l~~n~l~~~~~~~~~~~~~L~~L~ls~n~l~~~~~~~~~~~~~L~~L~ls~n~l~~~~p~~l~~l~~L~~L~  592 (893)
                                                +|+.|++++|++.                                         
T Consensus       453 --------------------------~L~~L~L~~n~~~-----------------------------------------  465 (968)
T PLN00113        453 --------------------------SLQMLSLARNKFF-----------------------------------------  465 (968)
T ss_pred             --------------------------CCcEEECcCceee-----------------------------------------
Confidence                                      2222222222221                                         


Q ss_pred             ccCCcccccCCccccCcccceeEEeccccccCCCcccccCCcccceecCCCCcccccccccccCCCCCCeeecccCcCCc
Q 002679          593 LSANHIIGKIPSEIGKLSSLIKLILRRNQLFGQLPSELGSLIQLEYLDLSSNRLSNSIPRSLGNLVKLHYLNLSTNQFIQ  672 (893)
Q Consensus       593 Ls~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~L~~L~Ls~N~l~~  672 (893)
                             +.+|..+                         ..++|+.|++++|++++.+|..+.++++|+.|+|++|++.+
T Consensus       466 -------~~~p~~~-------------------------~~~~L~~L~ls~n~l~~~~~~~~~~l~~L~~L~Ls~N~l~~  513 (968)
T PLN00113        466 -------GGLPDSF-------------------------GSKRLENLDLSRNQFSGAVPRKLGSLSELMQLKLSENKLSG  513 (968)
T ss_pred             -------eecCccc-------------------------ccccceEEECcCCccCCccChhhhhhhccCEEECcCCccee
Confidence                   1111111                         11234444555555555555566666677777777777777


Q ss_pred             ccchhhhhccCccccccccccCCCcccccccCCcccceeeCCCCcCCCCCchhhhcCCCCCEEEccCCcccccCCCCccc
Q 002679          673 EIPIKLEKLIHLSELDLSHNFLGKEIPSQICNMRSLEMLNLSHNNLSDFIPRCFEEMNGLLYIDISYNELHGPIPNSTAF  752 (893)
Q Consensus       673 ~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~l~ls~N~l~g~ip~~~~~  752 (893)
                      .+|..++.+++|++|+|++|.+++.+|..|..+++|++|||++|++++.+|..+..+++|+.+++++|+++|.+|..++|
T Consensus       514 ~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~l~ls~N~l~~~~p~~~~~  593 (968)
T PLN00113        514 EIPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHLHGSLPSTGAF  593 (968)
T ss_pred             eCChHHcCccCCCEEECCCCcccccCChhHhCcccCCEEECCCCcccccCChhHhcCcccCEEeccCCcceeeCCCcchh
Confidence            77878888888888888888888888888888999999999999999999999999999999999999999999999999


Q ss_pred             ccchhhhhcCCCCCCCCCC--CCCCCC
Q 002679          753 SDALMEALQGNEGLCGDIK--GFQSCK  777 (893)
Q Consensus       753 ~~~~~~~~~gn~~lc~~~~--~~~~C~  777 (893)
                      .++...++.||+.+||..+  ...+|.
T Consensus       594 ~~~~~~~~~~n~~lc~~~~~~~~~~c~  620 (968)
T PLN00113        594 LAINASAVAGNIDLCGGDTTSGLPPCK  620 (968)
T ss_pred             cccChhhhcCCccccCCccccCCCCCc
Confidence            9999999999999998632  234564



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG1187 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query893
3rgx_A768 Structural Insight Into Brassinosteroid Perception 2e-54
3rgx_A768 Structural Insight Into Brassinosteroid Perception 6e-32
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 3e-54
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 8e-32
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 1e-23
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 6e-18
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 2e-15
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 1e-13
2omu_A462 Crystal Structure Of Inla G194s+s Y369s/hec1 Comple 3e-12
2omu_A462 Crystal Structure Of Inla G194s+s Y369s/hec1 Comple 5e-07
2omt_A462 Crystal Structure Of Inla G194s+sHEC1 COMPLEX Lengt 4e-12
2omt_A462 Crystal Structure Of Inla G194s+sHEC1 COMPLEX Lengt 4e-07
2omz_A466 Crystal Structure Of Inla Y369a/hec1 Complex Length 7e-12
2omz_A466 Crystal Structure Of Inla Y369a/hec1 Complex Length 6e-06
2omx_A462 Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX 8e-12
2omx_A462 Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX 6e-07
2omv_A461 Crystal Structure Of Inla S192n Y369s/hec1 Complex 9e-12
2omv_A461 Crystal Structure Of Inla S192n Y369s/hec1 Complex 9e-06
2omy_A461 Crystal Structure Of Inla S192n/hec1 Complex Length 2e-11
2omy_A461 Crystal Structure Of Inla S192n/hec1 Complex Length 9e-06
1o6s_A466 Internalin (Listeria Monocytogenes) E-Cadherin (Hum 2e-11
1o6s_A466 Internalin (Listeria Monocytogenes) E-Cadherin (Hum 6e-06
2o6q_A270 Structural Diversity Of The Hagfish Variable Lympho 2e-08
2o6q_A270 Structural Diversity Of The Hagfish Variable Lympho 4e-04
1p8t_A285 Crystal Structure Of Nogo-66 Receptor Length = 285 2e-08
4fho_A231 Crystal Structure Of An Internalin C2 (Inlc2) From 2e-08
1ozn_A285 1.5a Crystal Structure Of The Nogo Receptor Ligand 3e-08
4fmz_A347 Crystal Structure Of An Internalin (Inlf) From List 6e-08
4fmz_A347 Crystal Structure Of An Internalin (Inlf) From List 2e-04
3kj4_A286 Structure Of Rat Nogo Receptor Bound To 1d9 Antagon 8e-08
3kj4_A286 Structure Of Rat Nogo Receptor Bound To 1d9 Antagon 9e-06
3kj4_A286 Structure Of Rat Nogo Receptor Bound To 1d9 Antagon 1e-05
1h6u_A308 Internalin H: Crystal Structure Of Fused N-Terminal 2e-07
3j0a_A 844 Homology Model Of Human Toll-Like Receptor 5 Fitted 6e-07
2z7x_B520 Crystal Structure Of The Tlr1-Tlr2 Heterodimer Indu 2e-06
1xku_A330 Crystal Structure Of The Dimeric Protein Core Of De 2e-05
1xku_A330 Crystal Structure Of The Dimeric Protein Core Of De 2e-05
1xcd_A329 Dimeric Bovine Tissue-Extracted Decorin, Crystal Fo 2e-05
1xcd_A329 Dimeric Bovine Tissue-Extracted Decorin, Crystal Fo 2e-05
3e6j_A229 Crystal Structure Of Variable Lymphocyte Receptor ( 5e-05
3e6j_A229 Crystal Structure Of Variable Lymphocyte Receptor ( 2e-04
3rfs_A272 Design Of A Binding Scaffold Based On Variable Lymp 1e-04
2id5_A477 Crystal Structure Of The Lingo-1 Ectodomain Length 1e-04
2wfh_A193 The Human Slit 2 Dimerization Domain D4 Length = 19 2e-04
2o6r_A177 Structural Diversity Of The Hagfish Variable Lympho 2e-04
4b8c_D727 Nuclease Module Of The Yeast Ccr4-Not Complex Lengt 2e-04
1w8a_A192 Third Lrr Domain Of Drosophila Slit Length = 192 2e-04
3rfj_A279 Design Of A Binding Scaffold Based On Variable Lymp 2e-04
3m19_A251 Crystal Structure Of Variable Lymphocyte Receptor V 3e-04
3m18_A251 Crystal Structure Of Variable Lymphocyte Receptor V 3e-04
3m18_A251 Crystal Structure Of Variable Lymphocyte Receptor V 4e-04
3a79_B562 Crystal Structure Of Tlr2-Tlr6-Pam2csk4 Complex Len 4e-04
3a79_B562 Crystal Structure Of Tlr2-Tlr6-Pam2csk4 Complex Len 7e-04
3v47_A455 Crystal Structure Of The N-Tetminal Fragment Of Zeb 5e-04
3b2d_A603 Crystal Structure Of Human Rp105MD-1 Complex Length 6e-04
3fxi_A605 Crystal Structure Of The Human Tlr4-Human Md-2-E.Co 7e-04
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure

Iteration: 1

Score = 211 bits (536), Expect = 2e-54, Method: Compositional matrix adjust. Identities = 233/775 (30%), Positives = 346/775 (44%), Gaps = 86/775 (11%) Query: 36 EEVHALLKWKTSLQNHDKGSLLPSWTLNNATKISPCAWFGIHCNHVGRVNSINLT----N 91 E+H L+ +K L + + LLP W+ N +PC + G+ C +V SI+L+ N Sbjct: 12 REIHQLISFKDVLPDKN---LLPDWSSNK----NPCTFDGVTCRD-DKVTSIDLSSKPLN 63 Query: 92 VGLKGTLHDFSFSSFPHLAYLDLQVNQIFGIIPPQIGNISKLKYLDLSSNSFSG--TIPP 149 VG + +L + I G + + L LDLS NS SG T Sbjct: 64 VGFSAVSSSLLSLTGLESLFL--SNSHINGSVS-GFKCSASLTSLDLSRNSLSGPVTTLT 120 Query: 150 QIGNLSMLKFLYLSAN--QFSGRIPPQIGHLSYIEALHLFKNQLSGPIPHEVG-----GL 202 +G+ S LKFL +S+N F G++ + L+ +E L L N +SG + VG G Sbjct: 121 SLGSCSGLKFLNVSSNTLDFPGKVSGGL-KLNSLEVLDLSANSISGA--NVVGWVLSDGC 177 Query: 203 SSLNELALTSNFLKGSIPPSLGNLTNLAILYLHNNSLSGSIPSEIGNLKSLSSLALGNNK 262 L LA++ N + G + + NL L + +N+ S IP +G+ +L L + NK Sbjct: 178 GELKHLAISGNKISGDV--DVSRCVNLEFLDVSSNNFSTGIPF-LGDCSALQHLDISGNK 234 Query: 263 LCGSIPLFLGNLTNLDTLYLRNNSFSSSIPSEIGNLKSLSILELGENRLNGSIP--LSXX 320 L G + T L L + +N F IP LKSL L L EN+ G IP LS Sbjct: 235 LSGDFSRAISTCTELKLLNISSNQFVGPIPPLP--LKSLQYLSLAENKFTGEIPDFLS-- 290 Query: 321 XXXXXXXXXXXXXXXXGSIPSEIGNLKSLSGLELADNELSSSIPHYLGNLTNLAAFYLYK 380 G +L+GL+L+ N ++P + G+ + L + L Sbjct: 291 -----------------------GACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSS 327 Query: 381 NSLSGSIPSE-IGNLKSLSNLDLSENKLSGSIPHSLGNLT-NLAILYLHSNTLLGSI-PR 437 N+ SG +P + + ++ L LDLS N+ SG +P SL NL+ +L L L SN G I P Sbjct: 328 NNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPN 387 Query: 438 EIGNLK-SLFELQLGDNKLSNSISHSLGNLTHMTLLALYDNALSGVIPEELGNLVKLTML 496 N K +L EL L +N + I +L N + + L L N LSG IP LG+L KL L Sbjct: 388 LCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDL 447 Query: 497 TLSDNQLQGSIPXXXXXXXXXXXXXXXXH-LTCNISESFGIHPKLTFIDLSHNNFYGQIS 555 L N L+G IP + LT I L +I LS+N G+I Sbjct: 448 KLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIP 507 Query: 556 SDWGKCPNLGTFDVSVNNIIGSLPPEIGDSSQLHVIDLSANHIIGKIPSEIGXXXXXXXX 615 G+ NL +S N+ G++P E+GD L +DL+ N G IP+ + Sbjct: 508 KWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAA 567 Query: 616 XXXXNQLF------GQLPSELGSLIQLEYLDLSS---NRLSNSIPRSLGNLV-------- 658 + + G G+ LE+ + S NRLS P ++ + V Sbjct: 568 NFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPT 627 Query: 659 -----KLHYLNLSTNQFIQEIPIKLEKLIHLSELDLSHNFLGKEIPSQICNMRSLEMLNL 713 + +L++S N IP ++ + +L L+L HN + IP ++ ++R L +L+L Sbjct: 628 FDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDL 687 Query: 714 SHNNLSDFIPRCFEEMNGLLYIDISYNELHGPIPNSTAFSDALMEALQGNEGLCG 768 S N L IP+ + L ID+S N L GPIP F N GLCG Sbjct: 688 SSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEMGQFETFPPAKFLNNPGLCG 742
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|2OMU|A Chain A, Crystal Structure Of Inla G194s+s Y369s/hec1 Complex Length = 462 Back     alignment and structure
>pdb|2OMU|A Chain A, Crystal Structure Of Inla G194s+s Y369s/hec1 Complex Length = 462 Back     alignment and structure
>pdb|2OMT|A Chain A, Crystal Structure Of Inla G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMT|A Chain A, Crystal Structure Of Inla G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMZ|A Chain A, Crystal Structure Of Inla Y369a/hec1 Complex Length = 466 Back     alignment and structure
>pdb|2OMZ|A Chain A, Crystal Structure Of Inla Y369a/hec1 Complex Length = 466 Back     alignment and structure
>pdb|2OMX|A Chain A, Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMX|A Chain A, Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMV|A Chain A, Crystal Structure Of Inla S192n Y369s/hec1 Complex Length = 461 Back     alignment and structure
>pdb|2OMV|A Chain A, Crystal Structure Of Inla S192n Y369s/hec1 Complex Length = 461 Back     alignment and structure
>pdb|2OMY|A Chain A, Crystal Structure Of Inla S192n/hec1 Complex Length = 461 Back     alignment and structure
>pdb|2OMY|A Chain A, Crystal Structure Of Inla S192n/hec1 Complex Length = 461 Back     alignment and structure
>pdb|1O6S|A Chain A, Internalin (Listeria Monocytogenes) E-Cadherin (Human) Recognition Complex Length = 466 Back     alignment and structure
>pdb|1O6S|A Chain A, Internalin (Listeria Monocytogenes) E-Cadherin (Human) Recognition Complex Length = 466 Back     alignment and structure
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure
>pdb|1P8T|A Chain A, Crystal Structure Of Nogo-66 Receptor Length = 285 Back     alignment and structure
>pdb|4FHO|A Chain A, Crystal Structure Of An Internalin C2 (Inlc2) From Listeria Monocytogenes Str. 4b F2365 At 1.90 A Resolution Length = 231 Back     alignment and structure
>pdb|1OZN|A Chain A, 1.5a Crystal Structure Of The Nogo Receptor Ligand Binding Domain Reveals A Convergent Recognition Scaffold Mediating Inhibition Of Myelination Length = 285 Back     alignment and structure
>pdb|4FMZ|A Chain A, Crystal Structure Of An Internalin (Inlf) From Listeria Monocytogenes Str. 4b F2365 At 1.91 A Resolution Length = 347 Back     alignment and structure
>pdb|4FMZ|A Chain A, Crystal Structure Of An Internalin (Inlf) From Listeria Monocytogenes Str. 4b F2365 At 1.91 A Resolution Length = 347 Back     alignment and structure
>pdb|3KJ4|A Chain A, Structure Of Rat Nogo Receptor Bound To 1d9 Antagonist Antibody Length = 286 Back     alignment and structure
>pdb|3KJ4|A Chain A, Structure Of Rat Nogo Receptor Bound To 1d9 Antagonist Antibody Length = 286 Back     alignment and structure
>pdb|3KJ4|A Chain A, Structure Of Rat Nogo Receptor Bound To 1d9 Antagonist Antibody Length = 286 Back     alignment and structure
>pdb|1H6U|A Chain A, Internalin H: Crystal Structure Of Fused N-Terminal Domains Length = 308 Back     alignment and structure
>pdb|3J0A|A Chain A, Homology Model Of Human Toll-Like Receptor 5 Fitted Into An Electron Microscopy Single Particle Reconstruction Length = 844 Back     alignment and structure
>pdb|2Z7X|B Chain B, Crystal Structure Of The Tlr1-Tlr2 Heterodimer Induced By Binding Of A Tri-Acylated Lipopeptide Length = 520 Back     alignment and structure
>pdb|1XKU|A Chain A, Crystal Structure Of The Dimeric Protein Core Of Decorin, The Archetypal Small Leucine-Rich Repeat Proteoglycan Length = 330 Back     alignment and structure
>pdb|1XKU|A Chain A, Crystal Structure Of The Dimeric Protein Core Of Decorin, The Archetypal Small Leucine-Rich Repeat Proteoglycan Length = 330 Back     alignment and structure
>pdb|1XCD|A Chain A, Dimeric Bovine Tissue-Extracted Decorin, Crystal Form 1 Length = 329 Back     alignment and structure
>pdb|1XCD|A Chain A, Dimeric Bovine Tissue-Extracted Decorin, Crystal Form 1 Length = 329 Back     alignment and structure
>pdb|3E6J|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor (Vlr) Rbc36 In Complex With H-Trisaccharide Length = 229 Back     alignment and structure
>pdb|3E6J|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor (Vlr) Rbc36 In Complex With H-Trisaccharide Length = 229 Back     alignment and structure
>pdb|3RFS|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 272 Back     alignment and structure
>pdb|2ID5|A Chain A, Crystal Structure Of The Lingo-1 Ectodomain Length = 477 Back     alignment and structure
>pdb|2WFH|A Chain A, The Human Slit 2 Dimerization Domain D4 Length = 193 Back     alignment and structure
>pdb|2O6R|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors B61 Length = 177 Back     alignment and structure
>pdb|4B8C|D Chain D, Nuclease Module Of The Yeast Ccr4-Not Complex Length = 727 Back     alignment and structure
>pdb|1W8A|A Chain A, Third Lrr Domain Of Drosophila Slit Length = 192 Back     alignment and structure
>pdb|3RFJ|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 279 Back     alignment and structure
>pdb|3M19|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R5.1 Length = 251 Back     alignment and structure
>pdb|3M18|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R2.1 In Complex With Hen Egg Lysozyme Length = 251 Back     alignment and structure
>pdb|3M18|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R2.1 In Complex With Hen Egg Lysozyme Length = 251 Back     alignment and structure
>pdb|3A79|B Chain B, Crystal Structure Of Tlr2-Tlr6-Pam2csk4 Complex Length = 562 Back     alignment and structure
>pdb|3A79|B Chain B, Crystal Structure Of Tlr2-Tlr6-Pam2csk4 Complex Length = 562 Back     alignment and structure
>pdb|3V47|A Chain A, Crystal Structure Of The N-Tetminal Fragment Of Zebrafish Tlr5 In Complex With Salmonella Flagellin Length = 455 Back     alignment and structure
>pdb|3B2D|A Chain A, Crystal Structure Of Human Rp105MD-1 Complex Length = 603 Back     alignment and structure
>pdb|3FXI|A Chain A, Crystal Structure Of The Human Tlr4-Human Md-2-E.Coli Lps Ra Complex Length = 605 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query893
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 0.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-120
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-99
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-33
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 8e-15
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 6e-11
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-111
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-102
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-75
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 9e-91
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-89
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-67
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-90
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-90
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-89
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-86
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-66
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-50
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-45
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-86
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-85
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-84
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 8e-78
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-85
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-84
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-76
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-53
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-77
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-75
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-64
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-52
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-46
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-22
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-63
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-60
1o6v_A466 Internalin A; bacterial infection, extracellular r 9e-56
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-61
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-57
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-54
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-45
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-38
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-22
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-18
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-06
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-57
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-55
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-51
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-47
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 9e-42
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-37
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-56
4fmz_A347 Internalin; leucine rich repeat, structural genomi 9e-56
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-54
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-52
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-46
4fmz_A347 Internalin; leucine rich repeat, structural genomi 9e-15
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-55
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-54
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-54
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-52
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 6e-48
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 8e-54
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 8e-54
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-50
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-37
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-32
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-15
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-53
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-52
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-43
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-41
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-11
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-47
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-46
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-44
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-40
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-37
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-35
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-16
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-46
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-46
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-45
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-45
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-43
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-40
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-39
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-43
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-40
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-39
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-36
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 2e-06
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-43
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-42
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-41
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-40
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-39
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-37
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-34
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-30
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-27
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-22
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-42
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-40
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-40
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-39
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-38
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-38
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-36
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-30
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-16
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-06
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-41
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-40
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-38
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-36
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 8e-40
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-38
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-38
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-38
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-37
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-37
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 7e-27
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-19
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-11
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 5e-39
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-37
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-37
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-35
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 1e-12
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 2e-10
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 3e-05
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 9e-37
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-33
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-32
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-32
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 7e-32
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-28
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 3e-36
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 6e-36
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 8e-06
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 4e-36
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-30
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 5e-30
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 4e-28
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 9e-27
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 5e-07
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-34
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 8e-33
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 9e-33
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-30
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 7e-22
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-20
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-33
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-32
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 9e-31
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-30
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-29
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-28
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-28
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-22
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-20
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-14
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-31
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-27
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-27
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-27
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-25
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-25
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-30
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-29
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-27
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-27
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-25
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 9e-23
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-15
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-13
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-30
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-29
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 9e-28
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 6e-27
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 6e-26
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-25
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-21
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-18
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-12
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-28
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-27
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-27
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-25
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-24
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 6e-24
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-23
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 9e-20
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-16
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-16
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-28
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-27
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-26
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 7e-26
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-25
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-25
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-13
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 7e-28
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-27
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-27
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-26
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 6e-26
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-25
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-20
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 9e-28
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 6e-26
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 8e-25
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-24
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-22
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-22
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-20
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 6e-14
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-12
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-27
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-24
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-21
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-20
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-18
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-16
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-15
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-11
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 3e-25
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 4e-25
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-22
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 7e-22
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-23
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-22
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-22
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-21
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-21
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-19
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-18
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-17
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-17
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-13
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-12
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 5e-23
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 6e-23
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 7e-23
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-21
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-21
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 5e-20
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-19
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 6e-18
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-11
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 5e-22
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-21
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-17
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-14
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-14
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-13
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-11
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 6e-22
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 6e-21
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 6e-21
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-20
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-18
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 5e-18
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-17
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 5e-17
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-16
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-21
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-21
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 7e-21
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 8e-21
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 4e-19
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-18
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 9e-18
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-14
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-14
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-13
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-12
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-10
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-20
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-17
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 8e-17
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-15
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-15
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-14
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-13
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-10
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-07
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-20
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 8e-16
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-15
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 5e-15
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-11
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 9e-10
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-19
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-18
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 8e-16
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-15
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-15
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 6e-15
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 6e-14
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-13
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 9e-13
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 5e-12
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-19
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-17
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 5e-16
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 5e-16
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 8e-15
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-09
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-18
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-17
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-17
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-15
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-15
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-13
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 6e-09
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 7e-17
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-16
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-16
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 4e-16
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 4e-13
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 9e-13
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 1e-08
3m19_A251 Variable lymphocyte receptor A diversity region; a 8e-17
3m19_A251 Variable lymphocyte receptor A diversity region; a 3e-16
3m19_A251 Variable lymphocyte receptor A diversity region; a 4e-16
3m19_A251 Variable lymphocyte receptor A diversity region; a 3e-15
3m19_A251 Variable lymphocyte receptor A diversity region; a 3e-15
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-14
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-14
3m19_A251 Variable lymphocyte receptor A diversity region; a 5e-14
3m19_A251 Variable lymphocyte receptor A diversity region; a 4e-11
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-10
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-08
3m19_A251 Variable lymphocyte receptor A diversity region; a 3e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-15
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-14
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-14
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 7e-14
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-13
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-13
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 7e-12
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 9e-11
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-10
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-09
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-09
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-08
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-15
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-14
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 8e-14
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-13
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 5e-13
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-12
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-12
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-09
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-09
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-09
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 8e-09
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-06
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-15
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-15
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-13
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-13
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 8e-13
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-14
3e6j_A229 Variable lymphocyte receptor diversity region; var 9e-14
3e6j_A229 Variable lymphocyte receptor diversity region; var 6e-12
3e6j_A229 Variable lymphocyte receptor diversity region; var 8e-12
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-11
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-08
3e6j_A229 Variable lymphocyte receptor diversity region; var 6e-07
3e6j_A229 Variable lymphocyte receptor diversity region; var 3e-06
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-05
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-14
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 6e-13
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-12
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-08
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 6e-07
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 6e-04
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 1e-12
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 2e-11
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 2e-11
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 6e-11
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 1e-10
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 2e-07
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 2e-06
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 2e-05
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 1e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 3e-12
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 3e-12
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-11
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-09
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-09
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 3e-09
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 4e-08
1w8a_A192 SLIT protein; signaling protein, secreted protein, 6e-11
1w8a_A192 SLIT protein; signaling protein, secreted protein, 9e-10
1w8a_A192 SLIT protein; signaling protein, secreted protein, 9e-10
1w8a_A192 SLIT protein; signaling protein, secreted protein, 1e-09
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-09
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-09
1w8a_A192 SLIT protein; signaling protein, secreted protein, 3e-09
1w8a_A192 SLIT protein; signaling protein, secreted protein, 9e-09
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-08
1w8a_A192 SLIT protein; signaling protein, secreted protein, 8e-07
1w8a_A192 SLIT protein; signaling protein, secreted protein, 7e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 8e-11
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 4e-10
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 8e-10
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 9e-10
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 4e-09
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-08
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-08
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-08
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-08
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 2e-07
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-07
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 8e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 5e-04
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 1e-10
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-10
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 7e-10
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 9e-10
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-09
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-08
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 7e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 4e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-04
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 5e-10
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 7e-09
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 8e-09
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 1e-08
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 3e-08
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 1e-07
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 2e-07
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 4e-07
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 4e-07
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 9e-05
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 1e-04
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 1e-08
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 7e-08
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 9e-08
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 3e-07
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-06
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 3e-06
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-05
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 3e-05
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 1e-08
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 8e-08
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 2e-04
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 4e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-08
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 9e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 9e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-08
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 4e-07
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 5e-07
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 8e-07
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 4e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-08
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-04
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 1e-07
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 5e-07
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 5e-07
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 5e-06
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 7e-06
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 3e-05
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 3e-05
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 1e-04
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 2e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 2e-07
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 1e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 1e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 1e-04
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 8e-07
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 2e-06
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 1e-04
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 2e-06
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 3e-06
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 4e-06
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 6e-06
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 5e-05
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 7e-05
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 2e-04
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 2e-04
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 6e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 8e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  637 bits (1646), Expect = 0.0
 Identities = 235/753 (31%), Positives = 336/753 (44%), Gaps = 34/753 (4%)

Query: 32  SDSTEEVHALLKWKTSLQNHDKGSLLPSWTLNNATKISPCAWFGIHCNHVGRVNSINLTN 91
                E+H L+ +K  L +    +LLP W+ N     +PC + G+ C    +V SI+L++
Sbjct: 8   QSLYREIHQLISFKDVLPDK---NLLPDWSSNK----NPCTFDGVTCRD-DKVTSIDLSS 59

Query: 92  VGLKGTLHDF--SFSSFPHLAYLDLQVNQIFGIIPPQIGNISKLKYLDLSSNSFSGTIPP 149
             L         S  S   L  L L  + I G +       + L  LDLS NS SG +  
Sbjct: 60  KPLNVGFSAVSSSLLSLTGLESLFLSNSHINGSVSG-FKCSASLTSLDLSRNSLSGPVTT 118

Query: 150 --QIGNLSMLKFLYLSANQFSGRIP-PQIGHLSYIEALHLFKNQLSGPIPHEV---GGLS 203
              +G+ S LKFL +S+N             L+ +E L L  N +SG          G  
Sbjct: 119 LTSLGSCSGLKFLNVSSNTLDFPGKVSGGLKLNSLEVLDLSANSISGANVVGWVLSDGCG 178

Query: 204 SLNELALTSNFLKGSIPPSLGNLTNLAILYLHNNSLSGSIPSEIGNLKSLSSLALGNNKL 263
            L  LA++ N + G +   +    NL  L + +N+ S  IP  +G+  +L  L +  NKL
Sbjct: 179 ELKHLAISGNKISGDVD--VSRCVNLEFLDVSSNNFSTGIPF-LGDCSALQHLDISGNKL 235

Query: 264 CGSIPLFLGNLTNLDTLYLRNNSFSSSIPSEIGNLKSLSILELGENRLNGSIPLSL-GNL 322
            G     +   T L  L + +N F   IP     LKSL  L L EN+  G IP  L G  
Sbjct: 236 SGDFSRAISTCTELKLLNISSNQFVGPIPPL--PLKSLQYLSLAENKFTGEIPDFLSGAC 293

Query: 323 TNLDTLYLYTNSLSGSIPSEIGNLKSLSGLELADNELSSSIP-HYLGNLTNLAAFYLYKN 381
             L  L L  N   G++P   G+   L  L L+ N  S  +P   L  +  L    L  N
Sbjct: 294 DTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFN 353

Query: 382 SLSGSIPSEIGNLK-SLSNLDLSENKLSGSIPHSLGN--LTNLAILYLHSNTLLGSIPRE 438
             SG +P  + NL  SL  LDLS N  SG I  +L       L  LYL +N   G IP  
Sbjct: 354 EFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPT 413

Query: 439 IGNLKSLFELQLGDNKLSNSISHSLGNLTHMTLLALYDNALSGVIPEELGNLVKLTMLTL 498
           + N   L  L L  N LS +I  SLG+L+ +  L L+ N L G IP+EL  +  L  L L
Sbjct: 414 LSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLIL 473

Query: 499 SDNQLQGSIPN-LRNLTNLIRLRLNRNHLTCNISESFGIHPKLTFIDLSHNNFYGQISSD 557
             N L G IP+ L N TNL  + L+ N LT  I +  G    L  + LS+N+F G I ++
Sbjct: 474 DFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAE 533

Query: 558 WGKCPNLGTFDVSVNNIIGSLPPEIGDSSQLHVIDLSANHIIGKIPSEIGKLSSLIKLIL 617
            G C +L   D++ N   G++P  +   S      ++AN I GK    I       +   
Sbjct: 534 LGDCRSLIWLDLNTNLFNGTIPAAMFKQSG----KIAANFIAGKRYVYIKNDGMKKECHG 589

Query: 618 RRN--QLFGQLPSELGSLIQLEYLDLSSNRLSNSIPRSLGNLVKLHYLNLSTNQFIQEIP 675
             N  +  G    +L  L      +++S         +  N   + +L++S N     IP
Sbjct: 590 AGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIP 649

Query: 676 IKLEKLIHLSELDLSHNFLGKEIPSQICNMRSLEMLNLSHNNLSDFIPRCFEEMNGLLYI 735
            ++  + +L  L+L HN +   IP ++ ++R L +L+LS N L   IP+    +  L  I
Sbjct: 650 KEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEI 709

Query: 736 DISYNELHGPIPNSTAFSDALMEALQGNEGLCG 768
           D+S N L GPIP    F          N GLCG
Sbjct: 710 DLSNNNLSGPIPEMGQFETFPPAKFLNNPGLCG 742


>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure

Structure Templates Detected by HHsearch ?

No hit with probability above 80.00


Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 893
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 8e-26
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-19
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-18
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 4e-18
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 9e-18
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-15
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-13
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-22
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-22
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-20
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-20
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-20
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-18
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-18
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-18
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-16
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-10
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-22
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 5e-22
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-20
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-15
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-13
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-09
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 9e-07
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-04
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 4e-21
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 8e-20
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-17
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 7e-17
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-13
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-11
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-08
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-08
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 6e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 1e-11
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 4e-07
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 5e-07
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 3e-06
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 1e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 2e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 5e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 7e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 2e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 7e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.002
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-11
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 3e-11
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 9e-11
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-10
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-09
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 3e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 4e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.002
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 6e-09
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-06
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 7e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 8e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 6e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 6e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.001
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.001
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.002
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.002
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.004
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 6e-09
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 3e-07
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 1e-06
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 6e-06
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 4e-05
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 4e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 7e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.002
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.003
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.004
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-08
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-07
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 8e-07
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-06
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-06
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-05
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 2e-08
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 2e-07
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 2e-05
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 3e-05
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 1e-04
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 8e-04
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 0.003
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 9e-07
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 4e-05
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 4e-04
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 0.002
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 0.003
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 9e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 3e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 3e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 4e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 6e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 3e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 3e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 6e-04
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 1e-06
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 4e-05
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 0.003
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 1e-06
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 3e-06
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 1e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 3e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 8e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 9e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.001
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.001
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.002
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 3e-06
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 0.001
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 0.004
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 7e-06
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 6e-05
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 8e-05
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 2e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 7e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 8e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 9e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.003
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 2e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 2e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 3e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 6e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 7e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.003
d1m9la_198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 7e-04
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
 Score =  106 bits (265), Expect = 8e-26
 Identities = 85/311 (27%), Positives = 130/311 (41%), Gaps = 14/311 (4%)

Query: 36  EEVHALLKWKTSLQNHDKGSLLPSWTLNNATKISPCAWFGIHCN---HVGRVNSINLTNV 92
           ++  ALL+ K  L N    + L SW     T      W G+ C+      RVN+++L+ +
Sbjct: 6   QDKQALLQIKKDLGNP---TTLSSW--LPTTDCCNRTWLGVLCDTDTQTYRVNNLDLSGL 60

Query: 93  GLKGTLH-DFSFSSFPHLAYLDLQVN-QIFGIIPPQIGNISKLKYLDLSSNSFSGTIPPQ 150
            L        S ++ P+L +L +     + G IPP I  +++L YL ++  + SG IP  
Sbjct: 61  NLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDF 120

Query: 151 IGNLSMLKFLYLSANQFSGRIPPQIGHLSYIEALHLFKNQLSGPIPHEVGGLSSLNE-LA 209
           +  +  L  L  S N  SG +PP I  L  +  +    N++SG IP   G  S L   + 
Sbjct: 121 LSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMT 180

Query: 210 LTSNFLKGSIPPSLGNLTNLAILYLHNNSLSGSIPSEIGNLKSLSSLALGNNKLCGSIPL 269
           ++ N L G IPP+  NL         + ++     S +      +               
Sbjct: 181 ISRNRLTGKIPPTFANLNL--AFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFDLG 238

Query: 270 FLGNLTNLDTLYLRNNSFSSSIPSEIGNLKSLSILELGENRLNGSIPLSLGNLTNLDTLY 329
            +G   NL+ L LRNN    ++P  +  LK L  L +  N L G IP   GNL   D   
Sbjct: 239 KVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIP-QGGNLQRFDVSA 297

Query: 330 LYTNSLSGSIP 340
              N      P
Sbjct: 298 YANNKCLCGSP 308


>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query893
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 100.0
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 100.0
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 100.0
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 100.0
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 100.0
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 100.0
d1p9ag_266 von Willebrand factor binding domain of glycoprote 100.0
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.98
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.95
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.95
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.95
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.95
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.92
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.92
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.92
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.92
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.91
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.91
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.88
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.88
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.86
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.85
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.83
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.8
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.74
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.71
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.7
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.7
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.64
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.61
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 99.2
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 99.12
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.86
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 98.43
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 98.24
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=100.00  E-value=0  Score=290.33  Aligned_cols=291  Identities=32%  Similarity=0.563  Sum_probs=166.3

Q ss_pred             CCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCC--CCCCEEECCC---CCEEEEECCCCCCCCC--CCCCCCC
Q ss_conf             6988889999999860799999999999988999999998--4471452899---9899998699998443--4876578
Q 002679           32 SDSTEEVHALLKWKTSLQNHDKGSLLPSWTLNNATKISPC--AWFGIHCNHV---GRVNSINLTNVGLKGT--LHDFSFS  104 (893)
Q Consensus        32 ~~~~~~~~~l~~~~~~~~~~~~~~~~~~W~~~~~~~~~~c--~w~gv~c~~~---~~v~~l~l~~~~~~~~--~~~~~~~  104 (893)
                      .|.++|++||++||+++.+ |  ..+++|.    .++|||  .|.||+|+..   +||+.|+++++++.|.  +| ..+.
T Consensus         2 ~c~~~e~~aLl~~k~~~~~-~--~~l~sW~----~~~d~C~~~w~gv~C~~~~~~~~v~~L~L~~~~l~g~~~lp-~~l~   73 (313)
T d1ogqa_           2 LCNPQDKQALLQIKKDLGN-P--TTLSSWL----PTTDCCNRTWLGVLCDTDTQTYRVNNLDLSGLNLPKPYPIP-SSLA   73 (313)
T ss_dssp             CSCHHHHHHHHHHHHHTTC-C--GGGTTCC----TTSCTTTTCSTTEEECCSSSCCCEEEEEEECCCCSSCEECC-GGGG
T ss_pred             CCCHHHHHHHHHHHHHCCC-C--CCCCCCC----CCCCCCCCCCCCEEEECCCCCEEEEEEECCCCCCCCCCCCC-HHHH
T ss_conf             9898999999999997799-9--8677889----99999889488969748999479889989899888888798-4784


Q ss_pred             CCCCCCEEECCC-CCCCCCCCCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCEECCCCCCCCCCCCCCCCCCCCCCE
Q ss_conf             999997998789-9777569724459999989858898799889822459999991017885579999787898999879
Q 002679          105 SFPHLAYLDLQV-NQIFGIIPPQIGNISKLKYLDLSSNSFSGTIPPQIGNLSMLKFLYLSANQFSGRIPPQIGHLSYIEA  183 (893)
Q Consensus       105 ~l~~L~~L~L~~-n~~~~~~~~~~~~l~~L~~L~Ls~n~~~~~~p~~l~~l~~L~~L~L~~n~~~~~~p~~l~~l~~L~~  183 (893)
                      ++++|++|+|++ |.+.+.+|..|+++++|++|++++|.+.+..+..+..+.+|++++++.|.+.+.+|..+++++.++.
T Consensus        74 ~L~~L~~L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l~l~~N~~~~~~p~~l~~l~~L~~  153 (313)
T d1ogqa_          74 NLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVG  153 (313)
T ss_dssp             GCTTCSEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCE
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHCCCCCCCCCCCCCCCHHHHCCCCCCCCCCCCCCCHHHCCCCCCCE
T ss_conf             67533520202654333002431145420011020356434433222220111001111224555568512206740000


Q ss_pred             EECCCCCCCCCCCCCCCCCCCC-CEEECCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCEEECCCCC
Q ss_conf             9698865789898445799999-899845887999899898899998889910786888899244699999799845887
Q 002679          184 LHLFKNQLSGPIPHEVGGLSSL-NELALTSNFLKGSIPPSLGNLTNLAILYLHNNSLSGSIPSEIGNLKSLSSLALGNNK  262 (893)
Q Consensus       184 L~l~~~~~~~~~~~~~~~l~~L-~~L~l~~n~~~~~~~~~l~~l~~L~~L~l~~n~l~~~~~~~l~~l~~L~~L~l~~n~  262 (893)
                      +++++|.+.+.+|..+..+..+ +.++++.|.+++..+..+..+..                         ..+++..+.
T Consensus       154 l~l~~n~l~~~ip~~~~~l~~l~~~l~~~~n~l~~~~~~~~~~l~~-------------------------~~l~l~~~~  208 (313)
T d1ogqa_         154 ITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLNL-------------------------AFVDLSRNM  208 (313)
T ss_dssp             EECCSSCCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGGCCC-------------------------SEEECCSSE
T ss_pred             EECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-------------------------CCCCCCCCC
T ss_conf             0023553356203121443112323102246435332433222222-------------------------233333343


Q ss_pred             CCCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCCCCCC
Q ss_conf             99989876789998879994267778878745558888875206987477877888888999987983378875666898
Q 002679          263 LCGSIPLFLGNLTNLDTLYLRNNSFSSSIPSEIGNLKSLSILELGENRLNGSIPLSLGNLTNLDTLYLYTNSLSGSIPSE  342 (893)
Q Consensus       263 ~~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~l~~n~~~~~~~~~  342 (893)
                      ..+.+|..+..++.++.++++++.+.+..+ .+..+++|+.|++++|++++.+|..++++++|++|++++|.++|.+|. 
T Consensus       209 ~~~~~~~~~~~~~~l~~l~~~~~~l~~~~~-~~~~~~~L~~L~Ls~N~l~g~iP~~l~~L~~L~~L~Ls~N~l~g~iP~-  286 (313)
T d1ogqa_         209 LEGDASVLFGSDKNTQKIHLAKNSLAFDLG-KVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQ-  286 (313)
T ss_dssp             EEECCGGGCCTTSCCSEEECCSSEECCBGG-GCCCCTTCCEEECCSSCCEECCCGGGGGCTTCCEEECCSSEEEEECCC-
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCEECCCCCHHHHCCCCCCEEECCCCCCCCCCCC-
T ss_conf             322222222222221112222222222222-222455444444765706660876884799999897958835166898-


Q ss_pred             CCCCCCCCEEECCCC
Q ss_conf             889999986974478
Q 002679          343 IGNLKSLSGLELADN  357 (893)
Q Consensus       343 l~~l~~L~~L~l~~n  357 (893)
                      +..+++|+.+++++|
T Consensus       287 ~~~L~~L~~l~l~~N  301 (313)
T d1ogqa_         287 GGNLQRFDVSAYANN  301 (313)
T ss_dssp             STTGGGSCGGGTCSS
T ss_pred             CCCCCCCCHHHHCCC
T ss_conf             666799897886889



>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure