Citrus Sinensis ID: 002744
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 885 | ||||||
| 255567695 | 874 | DNA repair helicase rad5,16, putative [R | 0.959 | 0.971 | 0.642 | 0.0 | |
| 297739163 | 964 | unnamed protein product [Vitis vinifera] | 0.813 | 0.746 | 0.734 | 0.0 | |
| 359485610 | 989 | PREDICTED: ATP-dependent helicase rhp16- | 0.815 | 0.730 | 0.714 | 0.0 | |
| 356542082 | 926 | PREDICTED: ATP-dependent helicase rhp16- | 0.988 | 0.944 | 0.625 | 0.0 | |
| 356547089 | 924 | PREDICTED: ATP-dependent helicase rhp16- | 0.989 | 0.948 | 0.628 | 0.0 | |
| 15220993 | 833 | Helicase protein with RING/U-box domain | 0.828 | 0.879 | 0.662 | 0.0 | |
| 297848774 | 843 | SNF2 domain-containing protein [Arabidop | 0.831 | 0.873 | 0.661 | 0.0 | |
| 357471341 | 935 | DNA repair protein RAD5 [Medicago trunca | 0.824 | 0.780 | 0.716 | 0.0 | |
| 449490335 | 875 | PREDICTED: LOW QUALITY PROTEIN: ATP-depe | 0.849 | 0.859 | 0.660 | 0.0 | |
| 449468370 | 867 | PREDICTED: LOW QUALITY PROTEIN: ATP-depe | 0.849 | 0.867 | 0.655 | 0.0 |
| >gi|255567695|ref|XP_002524826.1| DNA repair helicase rad5,16, putative [Ricinus communis] gi|223535886|gb|EEF37546.1| DNA repair helicase rad5,16, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 1157 bits (2992), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 585/910 (64%), Positives = 690/910 (75%), Gaps = 61/910 (6%)
Query: 1 MELRSRKTIGQSSGSGNGDAQGKQGNSGEGDSKGKGIIDLSDVSDDEIYVPSSDSDSFHS 60
MELRSRK + + GN + + GN E D+K + SDDE+Y+ SS+ +S
Sbjct: 1 MELRSRKKLPKPL-IGN-EREETDGNEVE-DNK---LYTNDGHSDDELYIVSSNDES--- 51
Query: 61 DDECKIYGDRHILKLGLSLETNNLTSS--SVTGEFSIDLNAEPAAEREEVGPSNLVYCRE 118
+E + S + +N SS GE D N +P + N+V
Sbjct: 52 -EEDSVLA---------STDADNAESSMKRSMGEAEPD-NGQPVVQLPNAPQINIV---- 96
Query: 119 QPAQAKGKKNESNKKKKTRGKKRQRTGSSLLWEIWEEEHERWIDMHEKDDVDLDQQNAFM 178
+KK+ KR+R LLW+IWEEE+ERWID H +DVD+D Q+ +
Sbjct: 97 -----------QERKKRRYSSKRKRNKVILLWKIWEEENERWIDDHLTEDVDIDHQHGIV 145
Query: 179 TETAEDPPDLITPLLRYQKEWLAWALKQEESAIRGGILADEMGMGKTIQAIALVLAKREI 238
TETAE P +LI PLLRYQKEWLAWALKQEES+ +GGILADEMGMGKTIQAIALVLAKREI
Sbjct: 146 TETAEPPAELIMPLLRYQKEWLAWALKQEESSTKGGILADEMGMGKTIQAIALVLAKREI 205
Query: 239 RGTIGELDASS---SSSTGLLGIKATLVICPVAAVTQWVSEINRFTSVGSTKVLIYHGSN 295
E + ++ SS GIK TLV+CPV AVTQWV EI+RFT+ GSTKVL+YHG+N
Sbjct: 206 LRQNRESNGATLLPGSSIDPSGIKPTLVVCPVVAVTQWVKEIDRFTTEGSTKVLVYHGAN 265
Query: 296 RERSAKQFSEFDFVITTYSIIEADYRKHVMPPKQKCQYCGKSFYQKKLVVHLKYFCGPSA 355
RE+S+K F FDFVITTYS +EA++RK++MPPK KC YCGKSFY+ KL HLKYFCGP A
Sbjct: 266 REKSSKHFLGFDFVITTYSTVEAEFRKYMMPPKDKCAYCGKSFYENKLATHLKYFCGPDA 325
Query: 356 VRTEKQSKQEKKKMKSS------------------VYEGYPGKKNGKKSSVGGVQKP-SG 396
RT KQSKQ++KK+K+S V G +K + V+
Sbjct: 326 FRTAKQSKQDRKKLKTSPTEKARSDESPKIQDDVDVISGRTYRKRHAAMEISEVELALRK 385
Query: 397 GKSPLHSLKWERIILDEAHFIKDRRSNTAKAVLALESSYKWALSGTPLQNRVGELYSLVR 456
KS LHS+KW+RIILDEAH++KD+R NTAKA+ ALESSYKWALSGTPLQNRVGELYSLVR
Sbjct: 386 EKSVLHSMKWDRIILDEAHYVKDKRCNTAKAIFALESSYKWALSGTPLQNRVGELYSLVR 445
Query: 457 FLQITPYSYYFCKDCDCKVLDY-SSAECPNCPHNSVRHFCWWNRYVATPIQTHGNSYGGR 515
FLQI PYS+Y CKDCDC++LDY S +C +CPH+SVRHFCWWN+YVA PIQ +G G+
Sbjct: 446 FLQIVPYSFYLCKDCDCRILDYRPSTQCSSCPHSSVRHFCWWNKYVAKPIQGYGTKDIGK 505
Query: 516 RAMILLKHKVLRSVILRRTKKGRAADLALPPRIVSLRRDSLDIREADYYESLYSESQAQF 575
RAM+LL HKVLR+++LRRTKKGRAADLALPPR+V LRRD+LD++E DYY+SLY+ESQAQF
Sbjct: 506 RAMLLLTHKVLRNIVLRRTKKGRAADLALPPRMVMLRRDTLDVKEEDYYQSLYNESQAQF 565
Query: 576 NTYVQAGTVMNNYAHIFDLLTRLRQAVDHPYLVVYSKTASLRGETEADAEHVQQVCGLCN 635
NTYVQAGT+MNNYAHIFDLLTRLRQAVDHPYLVVYSKT RG D ++ +QVC +C+
Sbjct: 566 NTYVQAGTLMNNYAHIFDLLTRLRQAVDHPYLVVYSKTPPQRGGNLFDTDN-EQVCDICH 624
Query: 636 DLADDPVVTNCGHAFCKACLFDSSASKFVAKCPTCSIPLTVDFTANEGAGNRTSKTTIKG 695
D A+DPVVT+C H FCKACL D SAS CPTC LTVD T AG++T+KTTI G
Sbjct: 625 DPAEDPVVTSCSHVFCKACLLDFSASLGRVSCPTCYSLLTVDLTTKTDAGDQTAKTTIMG 684
Query: 696 FKSSSILNRIQLDEFQSSTKIEALREEIRFMVERDGSAKGIVFSQFTSFLDLINYSLHKS 755
FKSSSILNRIQL++FQ+STKIEALREEIRFMVERDGSAKGIVFSQFTSFLDLI+YSLHKS
Sbjct: 685 FKSSSILNRIQLNDFQTSTKIEALREEIRFMVERDGSAKGIVFSQFTSFLDLISYSLHKS 744
Query: 756 GVNCVQLVGSMSIPARDAAINRFTEDPDCKIFLMSLKAGGVALNLTVASHVFLMDPWWNP 815
G+NCVQLVGSMS+PARD AI RF+EDP+CKIFLMSLKAGGVALNLTVASHVFLMDPWWNP
Sbjct: 745 GINCVQLVGSMSLPARDNAIKRFSEDPNCKIFLMSLKAGGVALNLTVASHVFLMDPWWNP 804
Query: 816 AVEQQAQDRIHRIGQYKPIRIVRFLIENTIEERILKLQEKKKLVFEGTVGGSADAFGKLT 875
AVE+QAQDRIHRIGQYKPIRIVRF+IENTIEERIL+LQEKK+LVFEGT+GGS++A GKLT
Sbjct: 805 AVERQAQDRIHRIGQYKPIRIVRFVIENTIEERILQLQEKKELVFEGTLGGSSEALGKLT 864
Query: 876 EADMRFLFVT 885
DM+FLF+T
Sbjct: 865 AEDMQFLFIT 874
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|297739163|emb|CBI28814.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359485610|ref|XP_002269303.2| PREDICTED: ATP-dependent helicase rhp16-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356542082|ref|XP_003539500.1| PREDICTED: ATP-dependent helicase rhp16-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356547089|ref|XP_003541950.1| PREDICTED: ATP-dependent helicase rhp16-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|15220993|ref|NP_172004.1| Helicase protein with RING/U-box domain [Arabidopsis thaliana] gi|332189671|gb|AEE27792.1| Helicase protein with RING/U-box domain [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297848774|ref|XP_002892268.1| SNF2 domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297338110|gb|EFH68527.1| SNF2 domain-containing protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|357471341|ref|XP_003605955.1| DNA repair protein RAD5 [Medicago truncatula] gi|355507010|gb|AES88152.1| DNA repair protein RAD5 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|449490335|ref|XP_004158575.1| PREDICTED: LOW QUALITY PROTEIN: ATP-dependent helicase rhp16-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449468370|ref|XP_004151894.1| PREDICTED: LOW QUALITY PROTEIN: ATP-dependent helicase rhp16-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 885 | ||||||
| TAIR|locus:2207175 | 833 | AT1G05120 [Arabidopsis thalian | 0.545 | 0.579 | 0.749 | 4.4e-268 | |
| TAIR|locus:2196115 | 678 | AT1G02670 [Arabidopsis thalian | 0.223 | 0.292 | 0.708 | 4.8e-161 | |
| GENEDB_PFALCIPARUM|PFL2440w | 1647 | PFL2440w "DNA repair protein r | 0.288 | 0.154 | 0.457 | 1.1e-149 | |
| UNIPROTKB|Q8I4S6 | 1647 | PFL2440w "DNA repair protein r | 0.288 | 0.154 | 0.457 | 1.1e-149 | |
| POMBASE|SPCC330.01c | 861 | rhp16 "Rad16 homolog Rhp16" [S | 0.533 | 0.548 | 0.474 | 3.9e-144 | |
| CGD|CAL0006085 | 852 | RAD16 [Candida albicans (taxid | 0.534 | 0.555 | 0.456 | 1.5e-138 | |
| SGD|S000000318 | 790 | RAD16 "Protein that binds dama | 0.529 | 0.593 | 0.455 | 5e-138 | |
| UNIPROTKB|G4MPA7 | 986 | MGG_07014 "DNA repair protein | 0.526 | 0.472 | 0.429 | 5.7e-123 | |
| TAIR|locus:2162504 | 1029 | RAD5 [Arabidopsis thaliana (ta | 0.488 | 0.419 | 0.343 | 2.4e-87 | |
| DICTYBASE|DDB_G0272082 | 1838 | DDB_G0272082 "CHR group protei | 0.196 | 0.094 | 0.463 | 2.7e-86 |
| TAIR|locus:2207175 AT1G05120 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1968 (697.8 bits), Expect = 4.4e-268, Sum P(2) = 4.4e-268
Identities = 365/487 (74%), Positives = 426/487 (87%)
Query: 401 LHSLKWERIILDEAHFIKDRRSNTAKAVLALESSYKWALSGTPLQNRVGELYSLVRFLQI 460
LHS+KW RIILDEAH+IK+RRSNTA+AV ALE++Y+WALSGTPLQNRVGELYSL+RFLQI
Sbjct: 349 LHSVKWNRIILDEAHYIKERRSNTARAVFALEATYRWALSGTPLQNRVGELYSLIRFLQI 408
Query: 461 TPYSYYFCKDCDCKVLDYSSAE-CPNCPHNSVRHFCWWNRYVATPIQTHGNSYG-GRRAM 518
PYSYYFCKDCDC++LDY + + CP+CPHN+VRHFCWWN+YVA PI +G S+G G+RAM
Sbjct: 409 RPYSYYFCKDCDCRILDYVAHQSCPHCPHNAVRHFCWWNKYVAKPITVYG-SFGLGKRAM 467
Query: 519 ILLKHKVLRSVILRRTKKGRAADLALPPRIVSLRRDSLDIREADYYESLYSESQAQFNTY 578
ILLKHKVL+ ++LRRTK GRAADLALPPRI++LRRD+LD++E DYYESLY SQA+FNTY
Sbjct: 468 ILLKHKVLKDILLRRTKLGRAADLALPPRIITLRRDTLDVKEFDYYESLYKNSQAEFNTY 527
Query: 579 VQAGTVMNNYAHIFDLLTRLRQAVDHPYLVVYSKTASLRGETEADAEHVQQVCGLCNDLA 638
++AGT+MNNYAHIFDLLTRLRQAVDHPYLVVYS ++ D +Q CGLC+D A
Sbjct: 528 IEAGTLMNNYAHIFDLLTRLRQAVDHPYLVVYSNSSGANANL-VDENKSEQECGLCHDPA 586
Query: 639 DDPVVTNCGHAFCKACLFDSSASKFVAKCPTCSIPLTVDFTANEGAGNRTSKTTIKGFKS 698
+D VVT+C H FCKACL SAS CPTCS LTVD+T ++ SKTT+KGF++
Sbjct: 587 EDYVVTSCAHVFCKACLIGFSASLGKVTCPTCSKLLTVDWTTKADTEHKASKTTLKGFRA 646
Query: 699 SSILNRIQLDEFQSSTKIEALREEIRFMVERDGSAKGIVFSQFTSFLDLINYSLHKSGVN 758
SSILNRI+LD+FQ+STKIEALREEIRFMVERDGSAK IVFSQFTSFLDLINY+L K GV+
Sbjct: 647 SSILNRIKLDDFQTSTKIEALREEIRFMVERDGSAKAIVFSQFTSFLDLINYTLGKCGVS 706
Query: 759 CVQLVGSMSIPARDAAINRFTEDPDCKIFLMSLKAGGVALNLTVASHVFLMDPWWNPAVE 818
CVQLVGSM++ ARD AIN+F EDPDC++FLMSLKAGGVALNLTVASHVF+MDPWWNPAVE
Sbjct: 707 CVQLVGSMTMAARDTAINKFKEDPDCRVFLMSLKAGGVALNLTVASHVFMMDPWWNPAVE 766
Query: 819 QQAQDRIHRIGQYKPIRIVRFLIENTIEERILKLQEKKKLVFEGTVGGSADAFGKLTEAD 878
+QAQDRIHRIGQYKPIR+VRF+IENT+EERIL+LQ+KK+LVFEGTVGGS +A GKLTE D
Sbjct: 767 RQAQDRIHRIGQYKPIRVVRFIIENTVEERILRLQKKKELVFEGTVGGSQEAIGKLTEED 826
Query: 879 MRFLFVT 885
MRFLF T
Sbjct: 827 MRFLFTT 833
|
|
| TAIR|locus:2196115 AT1G02670 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| GENEDB_PFALCIPARUM|PFL2440w PFL2440w "DNA repair protein rhp16, putative" [Plasmodium falciparum (taxid:5833)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8I4S6 PFL2440w "DNA repair protein rhp16, putative" [Plasmodium falciparum 3D7 (taxid:36329)] | Back alignment and assigned GO terms |
|---|
| POMBASE|SPCC330.01c rhp16 "Rad16 homolog Rhp16" [Schizosaccharomyces pombe (taxid:4896)] | Back alignment and assigned GO terms |
|---|
| CGD|CAL0006085 RAD16 [Candida albicans (taxid:5476)] | Back alignment and assigned GO terms |
|---|
| SGD|S000000318 RAD16 "Protein that binds damaged DNA during NER" [Saccharomyces cerevisiae (taxid:4932)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G4MPA7 MGG_07014 "DNA repair protein RAD16" [Magnaporthe oryzae 70-15 (taxid:242507)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2162504 RAD5 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0272082 DDB_G0272082 "CHR group protein" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 885 | |||
| COG0553 | 866 | COG0553, HepA, Superfamily II DNA/RNA helicases, S | 4e-60 | |
| pfam00176 | 301 | pfam00176, SNF2_N, SNF2 family N-terminal domain | 2e-34 | |
| pfam00176 | 301 | pfam00176, SNF2_N, SNF2 family N-terminal domain | 1e-22 | |
| PLN03142 | 1033 | PLN03142, PLN03142, Probable chromatin-remodeling | 9e-22 | |
| cd00079 | 131 | cd00079, HELICc, Helicase superfamily c-terminal d | 2e-19 | |
| COG0553 | 866 | COG0553, HepA, Superfamily II DNA/RNA helicases, S | 7e-17 | |
| pfam00271 | 78 | pfam00271, Helicase_C, Helicase conserved C-termin | 2e-15 | |
| PLN03142 | 1033 | PLN03142, PLN03142, Probable chromatin-remodeling | 1e-14 | |
| smart00490 | 82 | smart00490, HELICc, helicase superfamily c-termina | 1e-14 | |
| smart00487 | 201 | smart00487, DEXDc, DEAD-like helicases superfamily | 6e-13 | |
| PLN03142 | 1033 | PLN03142, PLN03142, Probable chromatin-remodeling | 2e-11 | |
| smart00184 | 40 | smart00184, RING, Ring finger | 8e-08 | |
| cd00162 | 45 | cd00162, RING, RING-finger (Really Interesting New | 1e-07 | |
| pfam13923 | 45 | pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI | 3e-07 | |
| cd00046 | 144 | cd00046, DEXDc, DEAD-like helicases superfamily | 3e-06 | |
| pfam13639 | 46 | pfam13639, zf-RING_2, Ring finger domain | 3e-06 | |
| pfam00097 | 40 | pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING | 9e-06 | |
| COG5574 | 271 | COG5574, PEX10, RING-finger-containing E3 ubiquiti | 1e-04 | |
| COG5152 | 259 | COG5152, COG5152, Uncharacterized conserved protei | 4e-04 | |
| TIGR00599 | 397 | TIGR00599, rad18, DNA repair protein rad18 | 5e-04 | |
| pfam13445 | 55 | pfam13445, zf-RING_LisH, RING-type zinc-finger, Li | 7e-04 | |
| smart00487 | 201 | smart00487, DEXDc, DEAD-like helicases superfamily | 0.003 | |
| pfam13920 | 49 | pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RI | 0.004 |
| >gnl|CDD|223627 COG0553, HepA, Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
Score = 219 bits (560), Expect = 4e-60
Identities = 142/497 (28%), Positives = 209/497 (42%), Gaps = 95/497 (19%)
Query: 391 VQKPSGGKSPLHSLKWERIILDEAHFIKDRRSNTAKAVLALESSYKWALSGTPLQNRVGE 450
+++ L ++W+R++LDEAH IK+ +S+ KA+ L++ + L+GTPL+NR+GE
Sbjct: 458 LRRFLVDHGGLKKIEWDRVVLDEAHRIKNDQSSEGKALQFLKALNRLDLTGTPLENRLGE 517
Query: 451 LYSLVRFLQITPYSYYFCKDCDCKVLDYSSAECPNCPHNSVRHFCWWNRYVATPIQTHGN 510
L+SL++ + P S F R PIQ +
Sbjct: 518 LWSLLQEF-LNPGLL----------------------GTSFAIF---TRLFEKPIQAEED 551
Query: 511 SYGG--RRAMILLKHKVLRSVILRRTKKGRAADLALPPRIVSLRRDSLDIREADYYESLY 568
R I L K+L ILRRTK+ LPP+I + L + + YE+L
Sbjct: 552 IGPLEARELGIELLRKLLSPFILRRTKEDVEVLKELPPKIEKVLECELSEEQRELYEALL 611
Query: 569 SESQAQFNTYVQAGTVMNNYAHIFDLLTRLRQAVDHPYLVVYSKTASLRGETEADAEHVQ 628
++ LL L +A + S+ L +
Sbjct: 612 EGAE-----------------KNQQLLEDLEKADSDENRIGDSELNILA--------LLT 646
Query: 629 QVCGLCNDLADDPVVTNCGHAFCKACLFDSSASKFVAKCPTCSIPLTVDFTANEGAGNRT 688
++ +CN A L D + T D ++
Sbjct: 647 RLRQICNHPA----------------LVDEG------------LEATFDRIVLLLREDKD 678
Query: 689 SKTTIKGFKSSSILNRIQLDEFQ-SSTKIEALREEIRFMVERDGSAKGIVFSQFTSFLDL 747
K S LDE E ++ ++FSQFT LDL
Sbjct: 679 FDYLKKPLIQLSKGKLQALDELLLDKLLEEGHYHKV------------LIFSQFTPVLDL 726
Query: 748 INYSLHKSGVNCVQLVGSMSIPARDAAINRFTEDPDCKIFLMSLKAGGVALNLTVASHVF 807
+ L G+ V+L GS R I+RF D + K+FL+SLKAGG+ LNLT A V
Sbjct: 727 LEDYLKALGIKYVRLDGSTPAKRRQELIDRFNADEEEKVFLLSLKAGGLGLNLTGADTVI 786
Query: 808 LMDPWWNPAVEQQAQDRIHRIGQYKPIRIVRFLIENTIEERILKLQEKKKLVFEGTVGGS 867
L DPWWNPAVE QA DR HRIGQ +P+++ R + TIEE+IL+LQEKK+ + + +
Sbjct: 787 LFDPWWNPAVELQAIDRAHRIGQKRPVKVYRLITRGTIEEKILELQEKKQELLDSLIDAE 846
Query: 868 A-DAFGKLTEADMRFLF 883
KL+ D+ LF
Sbjct: 847 GEKELSKLSIEDLLDLF 863
|
Length = 866 |
| >gnl|CDD|215770 pfam00176, SNF2_N, SNF2 family N-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|215770 pfam00176, SNF2_N, SNF2 family N-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|215601 PLN03142, PLN03142, Probable chromatin-remodeling complex ATPase chain; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238034 cd00079, HELICc, Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process | Back alignment and domain information |
|---|
| >gnl|CDD|223627 COG0553, HepA, Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|201125 pfam00271, Helicase_C, Helicase conserved C-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|215601 PLN03142, PLN03142, Probable chromatin-remodeling complex ATPase chain; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|197757 smart00490, HELICc, helicase superfamily c-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|214692 smart00487, DEXDc, DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|215601 PLN03142, PLN03142, Probable chromatin-remodeling complex ATPase chain; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|214546 smart00184, RING, Ring finger | Back alignment and domain information |
|---|
| >gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) | Back alignment and domain information |
|---|
| >gnl|CDD|238005 cd00046, DEXDc, DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain | Back alignment and domain information |
|---|
| >gnl|CDD|215715 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING finger) | Back alignment and domain information |
|---|
| >gnl|CDD|227861 COG5574, PEX10, RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|227481 COG5152, COG5152, Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|233043 TIGR00599, rad18, DNA repair protein rad18 | Back alignment and domain information |
|---|
| >gnl|CDD|222135 pfam13445, zf-RING_LisH, RING-type zinc-finger, LisH dimerisation motif | Back alignment and domain information |
|---|
| >gnl|CDD|214692 smart00487, DEXDc, DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|222454 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RING finger) | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 885 | |||
| KOG1002 | 791 | consensus Nucleotide excision repair protein RAD16 | 100.0 | |
| KOG0387 | 923 | consensus Transcription-coupled repair protein CSB | 100.0 | |
| KOG0385 | 971 | consensus Chromatin remodeling complex WSTF-ISWI, | 100.0 | |
| KOG0388 | 1185 | consensus SNF2 family DNA-dependent ATPase [Replic | 100.0 | |
| KOG0389 | 941 | consensus SNF2 family DNA-dependent ATPase [Chroma | 100.0 | |
| KOG0384 | 1373 | consensus Chromodomain-helicase DNA-binding protei | 100.0 | |
| KOG0392 | 1549 | consensus SNF2 family DNA-dependent ATPase domain- | 100.0 | |
| PLN03142 | 1033 | Probable chromatin-remodeling complex ATPase chain | 100.0 | |
| KOG4439 | 901 | consensus RNA polymerase II transcription terminat | 100.0 | |
| KOG0391 | 1958 | consensus SNF2 family DNA-dependent ATPase [Genera | 100.0 | |
| KOG0386 | 1157 | consensus Chromatin remodeling complex SWI/SNF, co | 100.0 | |
| KOG0390 | 776 | consensus DNA repair protein, SNF2 family [Replica | 100.0 | |
| KOG1015 | 1567 | consensus Transcription regulator XNP/ATRX, DEAD-b | 100.0 | |
| KOG1001 | 674 | consensus Helicase-like transcription factor HLTF/ | 100.0 | |
| COG0553 | 866 | HepA Superfamily II DNA/RNA helicases, SNF2 family | 100.0 | |
| KOG1000 | 689 | consensus Chromatin remodeling protein HARP/SMARCA | 100.0 | |
| PRK04914 | 956 | ATP-dependent helicase HepA; Validated | 100.0 | |
| KOG1016 | 1387 | consensus Predicted DNA helicase, DEAD-box superfa | 100.0 | |
| KOG0298 | 1394 | consensus DEAD box-containing helicase-like transc | 100.0 | |
| KOG0383 | 696 | consensus Predicted helicase [General function pre | 100.0 | |
| PF00176 | 299 | SNF2_N: SNF2 family N-terminal domain; InterPro: I | 100.0 | |
| TIGR00603 | 732 | rad25 DNA repair helicase rad25. All proteins in t | 100.0 | |
| PRK13766 | 773 | Hef nuclease; Provisional | 100.0 | |
| COG1111 | 542 | MPH1 ERCC4-like helicases [DNA replication, recomb | 100.0 | |
| COG1061 | 442 | SSL2 DNA or RNA helicases of superfamily II [Trans | 99.97 | |
| PHA02558 | 501 | uvsW UvsW helicase; Provisional | 99.97 | |
| KOG0354 | 746 | consensus DEAD-box like helicase [General function | 99.94 | |
| KOG1123 | 776 | consensus RNA polymerase II transcription initiati | 99.93 | |
| PTZ00110 | 545 | helicase; Provisional | 99.93 | |
| PRK10590 | 456 | ATP-dependent RNA helicase RhlE; Provisional | 99.92 | |
| PRK11192 | 434 | ATP-dependent RNA helicase SrmB; Provisional | 99.92 | |
| PRK11776 | 460 | ATP-dependent RNA helicase DbpA; Provisional | 99.92 | |
| PRK04837 | 423 | ATP-dependent RNA helicase RhlB; Provisional | 99.92 | |
| TIGR00614 | 470 | recQ_fam ATP-dependent DNA helicase, RecQ family. | 99.91 | |
| PRK01297 | 475 | ATP-dependent RNA helicase RhlB; Provisional | 99.91 | |
| PRK04537 | 572 | ATP-dependent RNA helicase RhlB; Provisional | 99.91 | |
| PLN00206 | 518 | DEAD-box ATP-dependent RNA helicase; Provisional | 99.91 | |
| PRK11634 | 629 | ATP-dependent RNA helicase DeaD; Provisional | 99.9 | |
| PRK11448 | 1123 | hsdR type I restriction enzyme EcoKI subunit R; Pr | 99.9 | |
| PTZ00424 | 401 | helicase 45; Provisional | 99.89 | |
| PRK11057 | 607 | ATP-dependent DNA helicase RecQ; Provisional | 99.89 | |
| KOG0331 | 519 | consensus ATP-dependent RNA helicase [RNA processi | 99.89 | |
| TIGR01389 | 591 | recQ ATP-dependent DNA helicase RecQ. The ATP-depe | 99.89 | |
| TIGR00643 | 630 | recG ATP-dependent DNA helicase RecG. | 99.88 | |
| PLN03137 | 1195 | ATP-dependent DNA helicase; Q4-like; Provisional | 99.87 | |
| PRK10917 | 681 | ATP-dependent DNA helicase RecG; Provisional | 99.87 | |
| TIGR00580 | 926 | mfd transcription-repair coupling factor (mfd). Al | 99.86 | |
| KOG0330 | 476 | consensus ATP-dependent RNA helicase [RNA processi | 99.86 | |
| TIGR03817 | 742 | DECH_helic helicase/secretion neighborhood putativ | 99.85 | |
| PRK10689 | 1147 | transcription-repair coupling factor; Provisional | 99.84 | |
| COG0513 | 513 | SrmB Superfamily II DNA and RNA helicases [DNA rep | 99.82 | |
| PRK02362 | 737 | ski2-like helicase; Provisional | 99.81 | |
| PRK13767 | 876 | ATP-dependent helicase; Provisional | 99.81 | |
| PRK01172 | 674 | ski2-like helicase; Provisional | 99.78 | |
| TIGR03714 | 762 | secA2 accessory Sec system translocase SecA2. Memb | 99.78 | |
| KOG0333 | 673 | consensus U5 snRNP-like RNA helicase subunit [RNA | 99.77 | |
| TIGR00348 | 667 | hsdR type I site-specific deoxyribonuclease, HsdR | 99.77 | |
| KOG0328 | 400 | consensus Predicted ATP-dependent RNA helicase FAL | 99.77 | |
| TIGR01587 | 358 | cas3_core CRISPR-associated helicase Cas3. This mo | 99.76 | |
| COG1200 | 677 | RecG RecG-like helicase [DNA replication, recombin | 99.76 | |
| PRK00254 | 720 | ski2-like helicase; Provisional | 99.75 | |
| TIGR02621 | 844 | cas3_GSU0051 CRISPR-associated helicase Cas3, Anae | 99.74 | |
| COG4096 | 875 | HsdR Type I site-specific restriction-modification | 99.74 | |
| PRK09200 | 790 | preprotein translocase subunit SecA; Reviewed | 99.73 | |
| TIGR00963 | 745 | secA preprotein translocase, SecA subunit. The pro | 99.71 | |
| KOG0335 | 482 | consensus ATP-dependent RNA helicase [RNA processi | 99.71 | |
| KOG0350 | 620 | consensus DEAD-box ATP-dependent RNA helicase [RNA | 99.71 | |
| PRK09401 | 1176 | reverse gyrase; Reviewed | 99.69 | |
| PRK12898 | 656 | secA preprotein translocase subunit SecA; Reviewed | 99.69 | |
| KOG0348 | 708 | consensus ATP-dependent RNA helicase [RNA processi | 99.68 | |
| COG0514 | 590 | RecQ Superfamily II DNA helicase [DNA replication, | 99.68 | |
| TIGR03158 | 357 | cas3_cyano CRISPR-associated helicase, Cyano-type. | 99.66 | |
| KOG0336 | 629 | consensus ATP-dependent RNA helicase [RNA processi | 99.66 | |
| PHA02653 | 675 | RNA helicase NPH-II; Provisional | 99.66 | |
| PRK05580 | 679 | primosome assembly protein PriA; Validated | 99.66 | |
| cd00079 | 131 | HELICc Helicase superfamily c-terminal domain; ass | 99.65 | |
| KOG0343 | 758 | consensus RNA Helicase [RNA processing and modific | 99.65 | |
| KOG4284 | 980 | consensus DEAD box protein [Transcription] | 99.64 | |
| COG1201 | 814 | Lhr Lhr-like helicases [General function predictio | 99.63 | |
| PRK09751 | 1490 | putative ATP-dependent helicase Lhr; Provisional | 99.63 | |
| KOG0340 | 442 | consensus ATP-dependent RNA helicase [RNA processi | 99.63 | |
| KOG0342 | 543 | consensus ATP-dependent RNA helicase pitchoune [RN | 99.62 | |
| PF04851 | 184 | ResIII: Type III restriction enzyme, res subunit; | 99.61 | |
| TIGR01054 | 1171 | rgy reverse gyrase. Generally, these gyrases are e | 99.61 | |
| COG1204 | 766 | Superfamily II helicase [General function predicti | 99.6 | |
| KOG0345 | 567 | consensus ATP-dependent RNA helicase [RNA processi | 99.6 | |
| KOG0338 | 691 | consensus ATP-dependent RNA helicase [RNA processi | 99.59 | |
| KOG0339 | 731 | consensus ATP-dependent RNA helicase [RNA processi | 99.59 | |
| TIGR00595 | 505 | priA primosomal protein N'. All proteins in this f | 99.59 | |
| COG4889 | 1518 | Predicted helicase [General function prediction on | 99.59 | |
| COG1205 | 851 | Distinct helicase family with a unique C-terminal | 99.57 | |
| TIGR01970 | 819 | DEAH_box_HrpB ATP-dependent helicase HrpB. This mo | 99.55 | |
| KOG0347 | 731 | consensus RNA helicase [RNA processing and modific | 99.54 | |
| KOG0341 | 610 | consensus DEAD-box protein abstrakt [RNA processin | 99.54 | |
| PF00271 | 78 | Helicase_C: Helicase conserved C-terminal domain; | 99.54 | |
| KOG0326 | 459 | consensus ATP-dependent RNA helicase [RNA processi | 99.53 | |
| PRK14701 | 1638 | reverse gyrase; Provisional | 99.53 | |
| PRK13104 | 896 | secA preprotein translocase subunit SecA; Reviewed | 99.52 | |
| KOG0332 | 477 | consensus ATP-dependent RNA helicase [RNA processi | 99.51 | |
| PRK12906 | 796 | secA preprotein translocase subunit SecA; Reviewed | 99.51 | |
| PRK11664 | 812 | ATP-dependent RNA helicase HrpB; Provisional | 99.5 | |
| smart00487 | 201 | DEXDc DEAD-like helicases superfamily. | 99.47 | |
| PRK12904 | 830 | preprotein translocase subunit SecA; Reviewed | 99.47 | |
| COG1197 | 1139 | Mfd Transcription-repair coupling factor (superfam | 99.47 | |
| COG1202 | 830 | Superfamily II helicase, archaea-specific [General | 99.47 | |
| cd00046 | 144 | DEXDc DEAD-like helicases superfamily. A diverse f | 99.46 | |
| PRK09694 | 878 | helicase Cas3; Provisional | 99.45 | |
| KOG0344 | 593 | consensus ATP-dependent RNA helicase [RNA processi | 99.45 | |
| smart00490 | 82 | HELICc helicase superfamily c-terminal domain. | 99.41 | |
| PRK13107 | 908 | preprotein translocase subunit SecA; Reviewed | 99.4 | |
| KOG0334 | 997 | consensus RNA helicase [RNA processing and modific | 99.36 | |
| TIGR00631 | 655 | uvrb excinuclease ABC, B subunit. This family is b | 99.35 | |
| COG4098 | 441 | comFA Superfamily II DNA/RNA helicase required for | 99.32 | |
| PRK12900 | 1025 | secA preprotein translocase subunit SecA; Reviewed | 99.31 | |
| KOG0346 | 569 | consensus RNA helicase [RNA processing and modific | 99.3 | |
| TIGR01967 | 1283 | DEAH_box_HrpA ATP-dependent helicase HrpA. This mo | 99.28 | |
| cd00268 | 203 | DEADc DEAD-box helicases. A diverse family of prot | 99.27 | |
| PRK05298 | 652 | excinuclease ABC subunit B; Provisional | 99.26 | |
| COG0556 | 663 | UvrB Helicase subunit of the DNA excision repair c | 99.25 | |
| KOG0327 | 397 | consensus Translation initiation factor 4F, helica | 99.24 | |
| PRK11131 | 1294 | ATP-dependent RNA helicase HrpA; Provisional | 99.23 | |
| PRK12326 | 764 | preprotein translocase subunit SecA; Reviewed | 99.22 | |
| KOG0351 | 941 | consensus ATP-dependent DNA helicase [Replication, | 99.22 | |
| PF00270 | 169 | DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 | 99.22 | |
| KOG0952 | 1230 | consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup | 99.19 | |
| KOG0337 | 529 | consensus ATP-dependent RNA helicase [RNA processi | 99.16 | |
| PRK12899 | 970 | secA preprotein translocase subunit SecA; Reviewed | 99.13 | |
| COG1203 | 733 | CRISPR-associated helicase Cas3 [Defense mechanism | 99.08 | |
| KOG0352 | 641 | consensus ATP-dependent DNA helicase [Replication, | 99.03 | |
| COG1198 | 730 | PriA Primosomal protein N' (replication factor Y) | 98.97 | |
| PRK13103 | 913 | secA preprotein translocase subunit SecA; Reviewed | 98.97 | |
| PRK12903 | 925 | secA preprotein translocase subunit SecA; Reviewed | 98.95 | |
| KOG0353 | 695 | consensus ATP-dependent DNA helicase [General func | 98.95 | |
| COG1110 | 1187 | Reverse gyrase [DNA replication, recombination, an | 98.91 | |
| KOG0951 | 1674 | consensus RNA helicase BRR2, DEAD-box superfamily | 98.85 | |
| PF11496 | 297 | HDA2-3: Class II histone deacetylase complex subun | 98.84 | |
| KOG0947 | 1248 | consensus Cytoplasmic exosomal RNA helicase SKI2, | 98.8 | |
| TIGR00596 | 814 | rad1 DNA repair protein (rad1). This family is bas | 98.78 | |
| PF13872 | 303 | AAA_34: P-loop containing NTP hydrolase pore-1 | 98.73 | |
| COG0610 | 962 | Type I site-specific restriction-modification syst | 98.66 | |
| KOG1513 | 1300 | consensus Nuclear helicase MOP-3/SNO (DEAD-box sup | 98.65 | |
| COG4581 | 1041 | Superfamily II RNA helicase [DNA replication, reco | 98.58 | |
| PRK12901 | 1112 | secA preprotein translocase subunit SecA; Reviewed | 98.53 | |
| CHL00122 | 870 | secA preprotein translocase subunit SecA; Validate | 98.51 | |
| PRK12902 | 939 | secA preprotein translocase subunit SecA; Reviewed | 98.42 | |
| KOG0949 | 1330 | consensus Predicted helicase, DEAD-box superfamily | 98.33 | |
| KOG0329 | 387 | consensus ATP-dependent RNA helicase [RNA processi | 98.33 | |
| PF13871 | 278 | Helicase_C_4: Helicase_C-like | 98.33 | |
| KOG0950 | 1008 | consensus DNA polymerase theta/eta, DEAD-box super | 98.31 | |
| PF07652 | 148 | Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR | 98.2 | |
| KOG0349 | 725 | consensus Putative DEAD-box RNA helicase DDX1 [RNA | 98.14 | |
| KOG0948 | 1041 | consensus Nuclear exosomal RNA helicase MTR4, DEAD | 98.02 | |
| PRK15483 | 986 | type III restriction-modification system StyLTI en | 98.02 | |
| COG0653 | 822 | SecA Preprotein translocase subunit SecA (ATPase, | 97.92 | |
| KOG0920 | 924 | consensus ATP-dependent RNA helicase A [RNA proces | 97.79 | |
| KOG0922 | 674 | consensus DEAH-box RNA helicase [RNA processing an | 97.78 | |
| KOG0953 | 700 | consensus Mitochondrial RNA helicase SUV3, DEAD-bo | 97.65 | |
| PF02399 | 824 | Herpes_ori_bp: Origin of replication binding prote | 97.63 | |
| smart00488 | 289 | DEXDc2 DEAD-like helicases superfamily. | 97.61 | |
| smart00489 | 289 | DEXDc3 DEAD-like helicases superfamily. | 97.61 | |
| COG1643 | 845 | HrpA HrpA-like helicases [DNA replication, recombi | 97.58 | |
| KOG0924 | 1042 | consensus mRNA splicing factor ATP-dependent RNA h | 97.5 | |
| TIGR01407 | 850 | dinG_rel DnaQ family exonuclease/DinG family helic | 97.42 | |
| TIGR03117 | 636 | cas_csf4 CRISPR-associated DEAD/DEAH-box helicase | 97.25 | |
| PF13086 | 236 | AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV | 97.25 | |
| KOG1802 | 935 | consensus RNA helicase nonsense mRNA reducing fact | 97.2 | |
| PF07517 | 266 | SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011 | 97.11 | |
| PF15227 | 42 | zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: | 96.94 | |
| TIGR02562 | 1110 | cas3_yersinia CRISPR-associated helicase Cas3. The | 96.88 | |
| PLN03208 | 193 | E3 ubiquitin-protein ligase RMA2; Provisional | 96.82 | |
| TIGR00604 | 705 | rad3 DNA repair helicase (rad3). All proteins in t | 96.77 | |
| KOG0823 | 230 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.75 | |
| PF02562 | 205 | PhoH: PhoH-like protein; InterPro: IPR003714 PhoH | 96.61 | |
| PRK10536 | 262 | hypothetical protein; Provisional | 96.6 | |
| COG3587 | 985 | Restriction endonuclease [Defense mechanisms] | 96.54 | |
| KOG0925 | 699 | consensus mRNA splicing factor ATP-dependent RNA h | 96.42 | |
| KOG0923 | 902 | consensus mRNA splicing factor ATP-dependent RNA h | 96.42 | |
| TIGR01407 | 850 | dinG_rel DnaQ family exonuclease/DinG family helic | 96.41 | |
| PRK07246 | 820 | bifunctional ATP-dependent DNA helicase/DNA polyme | 96.31 | |
| PF13923 | 39 | zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); | 96.26 | |
| COG1199 | 654 | DinG Rad3-related DNA helicases [Transcription / D | 96.22 | |
| PF13307 | 167 | Helicase_C_2: Helicase C-terminal domain; PDB: 4A1 | 96.16 | |
| PF00097 | 41 | zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I | 96.11 | |
| KOG0317 | 293 | consensus Predicted E3 ubiquitin ligase, integral | 96.09 | |
| KOG1132 | 945 | consensus Helicase of the DEAD superfamily [Replic | 96.07 | |
| PRK08074 | 928 | bifunctional ATP-dependent DNA helicase/DNA polyme | 96.05 | |
| PRK14873 | 665 | primosome assembly protein PriA; Provisional | 96.05 | |
| smart00504 | 63 | Ubox Modified RING finger domain. Modified RING fi | 95.92 | |
| PRK08074 | 928 | bifunctional ATP-dependent DNA helicase/DNA polyme | 95.8 | |
| KOG1803 | 649 | consensus DNA helicase [Replication, recombination | 95.79 | |
| KOG4150 | 1034 | consensus Predicted ATP-dependent RNA helicase [RN | 95.71 | |
| TIGR00599 | 397 | rad18 DNA repair protein rad18. This family is bas | 95.68 | |
| KOG0978 | 698 | consensus E3 ubiquitin ligase involved in syntaxin | 95.64 | |
| KOG2164 | 513 | consensus Predicted E3 ubiquitin ligase [Posttrans | 95.6 | |
| PF13920 | 50 | zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); | 95.6 | |
| TIGR00376 | 637 | DNA helicase, putative. The gene product may repre | 95.53 | |
| KOG0320 | 187 | consensus Predicted E3 ubiquitin ligase [Posttrans | 95.46 | |
| PF13401 | 131 | AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S | 95.35 | |
| PF09848 | 352 | DUF2075: Uncharacterized conserved protein (DUF207 | 95.33 | |
| PHA02929 | 238 | N1R/p28-like protein; Provisional | 95.21 | |
| PF14835 | 65 | zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM | 94.89 | |
| PF14634 | 44 | zf-RING_5: zinc-RING finger domain | 94.88 | |
| TIGR00604 | 705 | rad3 DNA repair helicase (rad3). All proteins in t | 94.84 | |
| smart00492 | 141 | HELICc3 helicase superfamily c-terminal domain. | 94.72 | |
| PRK11747 | 697 | dinG ATP-dependent DNA helicase DinG; Provisional | 94.69 | |
| COG5432 | 391 | RAD18 RING-finger-containing E3 ubiquitin ligase [ | 94.6 | |
| COG5574 | 271 | PEX10 RING-finger-containing E3 ubiquitin ligase [ | 94.56 | |
| PHA02926 | 242 | zinc finger-like protein; Provisional | 94.53 | |
| PF13445 | 43 | zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. | 94.34 | |
| TIGR01447 | 586 | recD exodeoxyribonuclease V, alpha subunit. This f | 93.89 | |
| PRK07246 | 820 | bifunctional ATP-dependent DNA helicase/DNA polyme | 93.86 | |
| PRK10875 | 615 | recD exonuclease V subunit alpha; Provisional | 93.8 | |
| PF06862 | 442 | DUF1253: Protein of unknown function (DUF1253); In | 93.74 | |
| smart00184 | 39 | RING Ring finger. E3 ubiquitin-protein ligase acti | 93.61 | |
| TIGR01448 | 720 | recD_rel helicase, putative, RecD/TraA family. Thi | 93.59 | |
| KOG0287 | 442 | consensus Postreplication repair protein RAD18 [Re | 93.59 | |
| PF13604 | 196 | AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL | 93.44 | |
| KOG0926 | 1172 | consensus DEAH-box RNA helicase [RNA processing an | 93.43 | |
| PRK11747 | 697 | dinG ATP-dependent DNA helicase DinG; Provisional | 93.34 | |
| KOG1805 | 1100 | consensus DNA replication helicase [Replication, r | 93.31 | |
| KOG1785 | 563 | consensus Tyrosine kinase negative regulator CBL [ | 93.3 | |
| cd00162 | 45 | RING RING-finger (Really Interesting New Gene) dom | 93.23 | |
| PF05876 | 557 | Terminase_GpA: Phage terminase large subunit (GpA) | 93.15 | |
| smart00491 | 142 | HELICc2 helicase superfamily c-terminal domain. | 92.94 | |
| PF04564 | 73 | U-box: U-box domain; InterPro: IPR003613 Quality c | 92.79 | |
| TIGR00570 | 309 | cdk7 CDK-activating kinase assembly factor MAT1. A | 92.56 | |
| PF13639 | 44 | zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C | 92.35 | |
| TIGR03117 | 636 | cas_csf4 CRISPR-associated DEAD/DEAH-box helicase | 91.95 | |
| TIGR02881 | 261 | spore_V_K stage V sporulation protein K. Members o | 91.37 | |
| KOG2879 | 298 | consensus Predicted E3 ubiquitin ligase [Posttrans | 91.28 | |
| PHA02533 | 534 | 17 large terminase protein; Provisional | 90.79 | |
| PF12340 | 229 | DUF3638: Protein of unknown function (DUF3638); In | 89.39 | |
| TIGR03420 | 226 | DnaA_homol_Hda DnaA regulatory inactivator Hda. Me | 89.04 | |
| KOG2660 | 331 | consensus Locus-specific chromosome binding protei | 88.88 | |
| COG1875 | 436 | NYN ribonuclease and ATPase of PhoH family domains | 88.78 | |
| PRK06526 | 254 | transposase; Provisional | 88.49 | |
| COG3421 | 812 | Uncharacterized protein conserved in bacteria [Fun | 87.86 | |
| KOG0824 | 324 | consensus Predicted E3 ubiquitin ligase [Posttrans | 87.74 | |
| TIGR02880 | 284 | cbbX_cfxQ probable Rubsico expression protein CbbX | 87.69 | |
| KOG2177 | 386 | consensus Predicted E3 ubiquitin ligase [Posttrans | 87.66 | |
| cd00009 | 151 | AAA The AAA+ (ATPases Associated with a wide varie | 87.45 | |
| PF06733 | 174 | DEAD_2: DEAD_2; InterPro: IPR010614 This represent | 86.34 | |
| PRK08084 | 235 | DNA replication initiation factor; Provisional | 85.95 | |
| KOG4172 | 62 | consensus Predicted E3 ubiquitin ligase [Posttrans | 85.77 | |
| PLN03025 | 319 | replication factor C subunit; Provisional | 85.67 | |
| CHL00181 | 287 | cbbX CbbX; Provisional | 85.21 | |
| KOG0951 | 1674 | consensus RNA helicase BRR2, DEAD-box superfamily | 85.07 | |
| KOG4265 | 349 | consensus Predicted E3 ubiquitin ligase [Posttrans | 84.68 | |
| PRK12723 | 388 | flagellar biosynthesis regulator FlhF; Provisional | 84.59 | |
| PF14447 | 55 | Prok-RING_4: Prokaryotic RING finger family 4 | 84.33 | |
| PRK08116 | 268 | hypothetical protein; Validated | 84.21 | |
| COG5152 | 259 | Uncharacterized conserved protein, contains RING a | 83.71 | |
| PRK07003 | 830 | DNA polymerase III subunits gamma and tau; Validat | 83.36 | |
| smart00382 | 148 | AAA ATPases associated with a variety of cellular | 83.06 | |
| TIGR03015 | 269 | pepcterm_ATPase putative secretion ATPase, PEP-CTE | 82.46 | |
| PF13245 | 76 | AAA_19: Part of AAA domain | 82.24 | |
| KOG0952 | 1230 | consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup | 80.62 | |
| PRK14087 | 450 | dnaA chromosomal replication initiation protein; P | 80.54 | |
| KOG0311 | 381 | consensus Predicted E3 ubiquitin ligase [Posttrans | 80.03 |
| >KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.7e-117 Score=921.44 Aligned_cols=623 Identities=57% Similarity=0.955 Sum_probs=574.8
Q ss_pred CcccccccccCCCCCCcccccccHHHHHHHHHHHHHhhhccCCCceeeCCCCCChHHHHHHHHHcccccccccCCCCCCC
Q 002744 170 DLDQQNAFMTETAEDPPDLITPLLRYQKEWLAWALKQEESAIRGGILADEMGMGKTIQAIALVLAKREIRGTIGELDASS 249 (885)
Q Consensus 170 ~~~~~~~~~~~~~~~p~~~~~~L~~yQ~~~v~~l~~~~~~~~~ggILADemGlGKTi~aiali~~~~~~~~~~~~~~~~~ 249 (885)
+++.+++.....+++|.++..+|.|||++++.|+..++.+.+.|||||||||+|||||+|++++...
T Consensus 163 dlde~~p~i~e~aeqP~dlii~LL~fQkE~l~Wl~~QE~Ss~~GGiLADEMGMGKTIQtIaLllae~------------- 229 (791)
T KOG1002|consen 163 DLDEANPVIAERAEQPDDLIIPLLPFQKEGLAWLTSQEESSVAGGILADEMGMGKTIQTIALLLAEV------------- 229 (791)
T ss_pred hhhhcCchhhhcccCcccceecchhhhHHHHHHHHHhhhhhhccceehhhhccchHHHHHHHHHhcc-------------
Confidence 5677888888899999999999999999999999999999999999999999999999999998732
Q ss_pred CCCCCCCCCCcEEEEechhhHHHHHHHHHHhcCCCCceEEEEeCCCcccchhhhcCCCEEEecchhhHHhhhhccCCCcc
Q 002744 250 SSSTGLLGIKATLVICPVAAVTQWVSEINRFTSVGSTKVLIYHGSNRERSAKQFSEFDFVITTYSIIEADYRKHVMPPKQ 329 (885)
Q Consensus 250 ~~~~~~~~~~~~LIV~P~sll~qW~~Ei~k~~~~~~~~v~v~~g~~~~~~~~~l~~~dvvItty~~l~~~~~~~~~~~~~ 329 (885)
...|+|||||...+.||.+||.+++. +.+++++|||.++....+.+..||||+|||..+.+.|++.-..
T Consensus 230 -------~ra~tLVvaP~VAlmQW~nEI~~~T~-gslkv~~YhG~~R~~nikel~~YDvVLTty~vvEs~yRk~~~G--- 298 (791)
T KOG1002|consen 230 -------DRAPTLVVAPTVALMQWKNEIERHTS-GSLKVYIYHGAKRDKNIKELMNYDVVLTTYAVVESVYRKQDYG--- 298 (791)
T ss_pred -------ccCCeeEEccHHHHHHHHHHHHHhcc-CceEEEEEecccccCCHHHhhcCcEEEEecHHHHHHHHhcccc---
Confidence 23689999999999999999999997 7999999999999999999999999999999999988652100
Q ss_pred cccccCcccchhhhhhhhhhccCCcchhhhhhhHHHHhhhccccccCCCCCCCCCCCCCCCCCCCCCCCCCCccceecEE
Q 002744 330 KCQYCGKSFYQKKLVVHLKYFCGPSAVRTEKQSKQEKKKMKSSVYEGYPGKKNGKKSSVGGVQKPSGGKSPLHSLKWERI 409 (885)
Q Consensus 330 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~k~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~w~~v 409 (885)
..+. -......+.|++++|.+|
T Consensus 299 -------------------------------------------------frrK---------ngv~ke~SlLHsi~~~Ri 320 (791)
T KOG1002|consen 299 -------------------------------------------------FRRK---------NGVDKEKSLLHSIKFYRI 320 (791)
T ss_pred -------------------------------------------------cccc---------CCcccccchhhhceeeee
Confidence 0000 013345688999999999
Q ss_pred EEecccccCCCCcHHHHHHHhcccccEEEEeCcCCCCchhhHHHHHHHhccCCCCccccccccccccccC---CCCCCCC
Q 002744 410 ILDEAHFIKDRRSNTAKAVLALESSYKWALSGTPLQNRVGELYSLVRFLQITPYSYYFCKDCDCKVLDYS---SAECPNC 486 (885)
Q Consensus 410 IlDEaH~ikn~~s~~~~~~~~l~~~~r~lLTGTPi~N~l~eL~~ll~fL~~~~~~~~~~~~~~~~~~~~~---~~~~~~~ 486 (885)
|+||||.||+..|++++++..|.+.+||+|||||+||+..|||+|++||++.||++|+|..|++..+++. ...|+.|
T Consensus 321 IlDEAH~IK~R~snTArAV~~L~tt~rw~LSGTPLQNrigElySLiRFL~i~Pfsyyfc~~cdc~~~~~~ftdr~~c~~c 400 (791)
T KOG1002|consen 321 ILDEAHNIKDRQSNTARAVFALETTYRWCLSGTPLQNRIGELYSLIRFLNINPFSYYFCTKCDCASLDWKFTDRMHCDHC 400 (791)
T ss_pred ehhhhcccccccccHHHHHHhhHhhhhhhccCCcchhhHHHHHHHHHHHccCcchhhhhhhccccccceeecccccCCcc
Confidence 9999999999999999999999999999999999999999999999999999999999999999998865 5789999
Q ss_pred CCCCcchhhhhhhhhcccccccCCCchhhHHHHHHHHHHhhHhhhhhccCCcccccCCCCeEEEEeecCCCHHHHHHHHH
Q 002744 487 PHNSVRHFCWWNRYVATPIQTHGNSYGGRRAMILLKHKVLRSVILRRTKKGRAADLALPPRIVSLRRDSLDIREADYYES 566 (885)
Q Consensus 487 ~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~l~~ll~~~~lRr~k~dv~~~l~lP~~~~~~~~~~ls~~q~~~y~~ 566 (885)
.++...|+.+|+..+..||+..+....|..+.. ..+.++..+|+||+|-..+.++.|||+++.+.+..|+.++.++|+.
T Consensus 401 ~h~~m~h~~~~n~~mlk~IqkfG~eGpGk~af~-~~h~llk~ImlrrTkl~RAdDLgLPPRiv~vRrD~fn~eE~D~YeS 479 (791)
T KOG1002|consen 401 SHNIMQHTCFFNHFMLKPIQKFGVEGPGKEAFN-NIHTLLKNIMLRRTKLERADDLGLPPRIVTVRRDFFNEEEKDLYES 479 (791)
T ss_pred cchhhhhhhhhcccccccchhhcccCchHHHHH-HHHHHHHHHHHHHhhcccccccCCCccceeeehhhhhhHHHHHHHH
Confidence 999999999999999999999999888887776 4589999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHHHHHHhccccccchhHHHHHHHHHHHhhcCccceeecccccccCCChhhhhhhhhhhccccCcCCCCccccC
Q 002744 567 LYSESQAQFNTYVQAGTVMNNYAHIFDLLTRLRQAVDHPYLVVYSKTASLRGETEADAEHVQQVCGLCNDLADDPVVTNC 646 (885)
Q Consensus 567 l~~~~~~~~~~~~~~~~~~~~~~~~l~~l~~lr~~~~~p~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~c 646 (885)
++......++.|...+.++++|+++|.++.++||+++||+|+.++....+. +......+|.+|.+++++++.+.|
T Consensus 480 LY~dSkrkfntyieeGvvlNNYAnIF~LitRmRQ~aDHP~LVl~S~~~n~~-----~enk~~~~C~lc~d~aed~i~s~C 554 (791)
T KOG1002|consen 480 LYKDSKRKFNTYIEEGVVLNNYANIFTLITRMRQAADHPDLVLYSANANLP-----DENKGEVECGLCHDPAEDYIESSC 554 (791)
T ss_pred HHHhhHHhhhhHHhhhhhhhhHHHHHHHHHHHHHhccCcceeeehhhcCCC-----ccccCceeecccCChhhhhHhhhh
Confidence 999999999999999999999999999999999999999999877444332 334456789999999999999999
Q ss_pred Cchhhhhhhhhccccc---cCCCCCCCCCCccccccccCCCCCCCccccccCCCcchhhhhhcccccCcchHHHHHHHHH
Q 002744 647 GHAFCKACLFDSSASK---FVAKCPTCSIPLTVDFTANEGAGNRTSKTTIKGFKSSSILNRIQLDEFQSSTKIEALREEI 723 (885)
Q Consensus 647 ~~~~c~~c~~~~~~~~---~~~~cp~c~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~S~Kl~~L~~lL 723 (885)
.|.||.-|+.++.... ....||.|.+++.+|... ...++...++|..+++++++.+++|.+|+|+++|++.|
T Consensus 555 hH~FCrlCi~eyv~~f~~~~nvtCP~C~i~LsiDlse-----~alek~~l~~Fk~sSIlnRinm~~~qsSTKIEAL~EEl 629 (791)
T KOG1002|consen 555 HHKFCRLCIKEYVESFMENNNVTCPVCHIGLSIDLSE-----PALEKTDLKGFKASSILNRINMDDWQSSTKIEALVEEL 629 (791)
T ss_pred hHHHHHHHHHHHHHhhhcccCCCCccccccccccccc-----hhhhhcchhhhhhHHHhhhcchhhhcchhHHHHHHHHH
Confidence 9999999998876533 348999999999988543 33456778999999999999999999999999999999
Q ss_pred HHHHhcCCCccEEEEccChhHHHHHHHHHHhCCCcEEEEecCCCHHHHHHHHHhhccCCCceEEEEecCCCccccccccc
Q 002744 724 RFMVERDGSAKGIVFSQFTSFLDLINYSLHKSGVNCVQLVGSMSIPARDAAINRFTEDPDCKIFLMSLKAGGVALNLTVA 803 (885)
Q Consensus 724 ~~~~~~~~~~KvIIFsq~~~~l~~L~~~L~~~gi~~~~i~G~~~~~~R~~~i~~F~~~~~~~VlL~St~agg~GlNL~~A 803 (885)
..+.+++..-|.||||||+.|+|+|...|.+.|+.++.+.|+|++..|.+.|+.|.++++++|||+|++|||+.|||+.|
T Consensus 630 ~~l~~rd~t~KsIVFSQFTSmLDLi~~rL~kaGfscVkL~GsMs~~ardatik~F~nd~~c~vfLvSLkAGGVALNLteA 709 (791)
T KOG1002|consen 630 YFLRERDRTAKSIVFSQFTSMLDLIEWRLGKAGFSCVKLVGSMSPAARDATIKYFKNDIDCRVFLVSLKAGGVALNLTEA 709 (791)
T ss_pred HHHHHcccchhhhhHHHHHHHHHHHHHHhhccCceEEEeccCCChHHHHHHHHHhccCCCeEEEEEEeccCceEeeechh
Confidence 99999998999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred CEEEEeCCCCCcchHHHHhhhhhhcCCcccEEEEEEEeCCCHHHHHHHHHHHHHHHHhhhcCCCcccccCCCHHHHHhhh
Q 002744 804 SHVFLMDPWWNPAVEQQAQDRIHRIGQYKPIRIVRFLIENTIEERILKLQEKKKLVFEGTVGGSADAFGKLTEADMRFLF 883 (885)
Q Consensus 804 ~~VI~~D~~wnp~~~~QaigR~~RiGQ~k~V~VyrLv~~~TiEe~i~~~~~~K~~~~~~~~~~~~~~~~~~~~~~~~~lf 883 (885)
++|++|||||||+++.||.+|+|||||.+||.|.||++++|||++|+++|++|..+|++++|+++..+++++++||++||
T Consensus 710 SqVFmmDPWWNpaVe~Qa~DRiHRIGQ~rPvkvvrf~iEnsiE~kIieLQeKKa~mihaTi~qde~Ai~kLt~eDmqfLF 789 (791)
T KOG1002|consen 710 SQVFMMDPWWNPAVEWQAQDRIHRIGQYRPVKVVRFCIENSIEEKIIELQEKKANMIHATIGQDEEAISKLTEEDMQFLF 789 (791)
T ss_pred ceeEeecccccHHHHhhhhhhHHhhcCccceeEEEeehhccHHHHHHHHHHHHhhhhhhhcCCcHHHHHhcCHHHHHHHh
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred cC
Q 002744 884 VT 885 (885)
Q Consensus 884 ~~ 885 (885)
.+
T Consensus 790 ~n 791 (791)
T KOG1002|consen 790 NN 791 (791)
T ss_pred cC
Confidence 75
|
|
| >KOG0387 consensus Transcription-coupled repair protein CSB/RAD26 (contains SNF2 family DNA-dependent ATPase domain) [Transcription; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0385 consensus Chromatin remodeling complex WSTF-ISWI, small subunit [Transcription] | Back alignment and domain information |
|---|
| >KOG0388 consensus SNF2 family DNA-dependent ATPase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0389 consensus SNF2 family DNA-dependent ATPase [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG0384 consensus Chromodomain-helicase DNA-binding protein [Transcription] | Back alignment and domain information |
|---|
| >KOG0392 consensus SNF2 family DNA-dependent ATPase domain-containing protein [Transcription] | Back alignment and domain information |
|---|
| >PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional | Back alignment and domain information |
|---|
| >KOG4439 consensus RNA polymerase II transcription termination factor TTF2/lodestar, DEAD-box superfamily [Transcription; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0391 consensus SNF2 family DNA-dependent ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0386 consensus Chromatin remodeling complex SWI/SNF, component SWI2 and related ATPases (DNA/RNA helicase superfamily) [Chromatin structure and dynamics; Transcription] | Back alignment and domain information |
|---|
| >KOG0390 consensus DNA repair protein, SNF2 family [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG1015 consensus Transcription regulator XNP/ATRX, DEAD-box superfamily [Transcription] | Back alignment and domain information |
|---|
| >KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG1000 consensus Chromatin remodeling protein HARP/SMARCAL1, DEAD-box superfamily [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PRK04914 ATP-dependent helicase HepA; Validated | Back alignment and domain information |
|---|
| >KOG1016 consensus Predicted DNA helicase, DEAD-box superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0383 consensus Predicted helicase [General function prediction only] | Back alignment and domain information |
|---|
| >PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e | Back alignment and domain information |
|---|
| >TIGR00603 rad25 DNA repair helicase rad25 | Back alignment and domain information |
|---|
| >PRK13766 Hef nuclease; Provisional | Back alignment and domain information |
|---|
| >COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PHA02558 uvsW UvsW helicase; Provisional | Back alignment and domain information |
|---|
| >KOG0354 consensus DEAD-box like helicase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1123 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, 3'-5' helicase subunit SSL2 [Transcription; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PTZ00110 helicase; Provisional | Back alignment and domain information |
|---|
| >PRK10590 ATP-dependent RNA helicase RhlE; Provisional | Back alignment and domain information |
|---|
| >PRK11192 ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >PRK11776 ATP-dependent RNA helicase DbpA; Provisional | Back alignment and domain information |
|---|
| >PRK04837 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family | Back alignment and domain information |
|---|
| >PRK01297 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >PRK04537 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK11634 ATP-dependent RNA helicase DeaD; Provisional | Back alignment and domain information |
|---|
| >PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional | Back alignment and domain information |
|---|
| >PTZ00424 helicase 45; Provisional | Back alignment and domain information |
|---|
| >PRK11057 ATP-dependent DNA helicase RecQ; Provisional | Back alignment and domain information |
|---|
| >KOG0331 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR01389 recQ ATP-dependent DNA helicase RecQ | Back alignment and domain information |
|---|
| >TIGR00643 recG ATP-dependent DNA helicase RecG | Back alignment and domain information |
|---|
| >PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional | Back alignment and domain information |
|---|
| >PRK10917 ATP-dependent DNA helicase RecG; Provisional | Back alignment and domain information |
|---|
| >TIGR00580 mfd transcription-repair coupling factor (mfd) | Back alignment and domain information |
|---|
| >KOG0330 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase | Back alignment and domain information |
|---|
| >PRK10689 transcription-repair coupling factor; Provisional | Back alignment and domain information |
|---|
| >COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK02362 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >PRK13767 ATP-dependent helicase; Provisional | Back alignment and domain information |
|---|
| >PRK01172 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >TIGR03714 secA2 accessory Sec system translocase SecA2 | Back alignment and domain information |
|---|
| >KOG0333 consensus U5 snRNP-like RNA helicase subunit [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family | Back alignment and domain information |
|---|
| >KOG0328 consensus Predicted ATP-dependent RNA helicase FAL1, involved in rRNA maturation, DEAD-box superfamily [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR01587 cas3_core CRISPR-associated helicase Cas3 | Back alignment and domain information |
|---|
| >COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] | Back alignment and domain information |
|---|
| >PRK00254 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype | Back alignment and domain information |
|---|
| >COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK09200 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >TIGR00963 secA preprotein translocase, SecA subunit | Back alignment and domain information |
|---|
| >KOG0335 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0350 consensus DEAD-box ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK09401 reverse gyrase; Reviewed | Back alignment and domain information |
|---|
| >PRK12898 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >KOG0348 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type | Back alignment and domain information |
|---|
| >KOG0336 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PHA02653 RNA helicase NPH-II; Provisional | Back alignment and domain information |
|---|
| >PRK05580 primosome assembly protein PriA; Validated | Back alignment and domain information |
|---|
| >cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process | Back alignment and domain information |
|---|
| >KOG0343 consensus RNA Helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG4284 consensus DEAD box protein [Transcription] | Back alignment and domain information |
|---|
| >COG1201 Lhr Lhr-like helicases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK09751 putative ATP-dependent helicase Lhr; Provisional | Back alignment and domain information |
|---|
| >KOG0340 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0342 consensus ATP-dependent RNA helicase pitchoune [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 | Back alignment and domain information |
|---|
| >TIGR01054 rgy reverse gyrase | Back alignment and domain information |
|---|
| >COG1204 Superfamily II helicase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0345 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0338 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0339 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR00595 priA primosomal protein N' | Back alignment and domain information |
|---|
| >COG4889 Predicted helicase [General function prediction only] | Back alignment and domain information |
|---|
| >COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB | Back alignment and domain information |
|---|
| >KOG0347 consensus RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0341 consensus DEAD-box protein abstrakt [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins | Back alignment and domain information |
|---|
| >KOG0326 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK14701 reverse gyrase; Provisional | Back alignment and domain information |
|---|
| >PRK13104 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >KOG0332 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK12906 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PRK11664 ATP-dependent RNA helicase HrpB; Provisional | Back alignment and domain information |
|---|
| >smart00487 DEXDc DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >PRK12904 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] | Back alignment and domain information |
|---|
| >COG1202 Superfamily II helicase, archaea-specific [General function prediction only] | Back alignment and domain information |
|---|
| >cd00046 DEXDc DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >PRK09694 helicase Cas3; Provisional | Back alignment and domain information |
|---|
| >KOG0344 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >smart00490 HELICc helicase superfamily c-terminal domain | Back alignment and domain information |
|---|
| >PRK13107 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >KOG0334 consensus RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR00631 uvrb excinuclease ABC, B subunit | Back alignment and domain information |
|---|
| >COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK12900 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >KOG0346 consensus RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA | Back alignment and domain information |
|---|
| >cd00268 DEADc DEAD-box helicases | Back alignment and domain information |
|---|
| >PRK05298 excinuclease ABC subunit B; Provisional | Back alignment and domain information |
|---|
| >COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0327 consensus Translation initiation factor 4F, helicase subunit (eIF-4A) and related helicases [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK11131 ATP-dependent RNA helicase HrpA; Provisional | Back alignment and domain information |
|---|
| >PRK12326 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >KOG0351 consensus ATP-dependent DNA helicase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases | Back alignment and domain information |
|---|
| >KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0337 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK12899 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG0352 consensus ATP-dependent DNA helicase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK13103 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PRK12903 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >KOG0353 consensus ATP-dependent DNA helicase [General function prediction only] | Back alignment and domain information |
|---|
| >COG1110 Reverse gyrase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF11496 HDA2-3: Class II histone deacetylase complex subunits 2 and 3; InterPro: IPR021006 This entry contains the class II histone deacetylase complex subunits HDA2 and HDA3 is found in fungi | Back alignment and domain information |
|---|
| >KOG0947 consensus Cytoplasmic exosomal RNA helicase SKI2, DEAD-box superfamily [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR00596 rad1 DNA repair protein (rad1) | Back alignment and domain information |
|---|
| >PF13872 AAA_34: P-loop containing NTP hydrolase pore-1 | Back alignment and domain information |
|---|
| >COG0610 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG1513 consensus Nuclear helicase MOP-3/SNO (DEAD-box superfamily) [Transcription; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK12901 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >CHL00122 secA preprotein translocase subunit SecA; Validated | Back alignment and domain information |
|---|
| >PRK12902 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >KOG0949 consensus Predicted helicase, DEAD-box superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0329 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF13871 Helicase_C_4: Helicase_C-like | Back alignment and domain information |
|---|
| >KOG0950 consensus DNA polymerase theta/eta, DEAD-box superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain | Back alignment and domain information |
|---|
| >KOG0349 consensus Putative DEAD-box RNA helicase DDX1 [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0948 consensus Nuclear exosomal RNA helicase MTR4, DEAD-box superfamily [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK15483 type III restriction-modification system StyLTI enzyme res; Provisional | Back alignment and domain information |
|---|
| >COG0653 SecA Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >KOG0920 consensus ATP-dependent RNA helicase A [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0922 consensus DEAH-box RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0953 consensus Mitochondrial RNA helicase SUV3, DEAD-box superfamily [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein | Back alignment and domain information |
|---|
| >smart00488 DEXDc2 DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >smart00489 DEXDc3 DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0924 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative | Back alignment and domain information |
|---|
| >TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 | Back alignment and domain information |
|---|
| >PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A | Back alignment and domain information |
|---|
| >KOG1802 consensus RNA helicase nonsense mRNA reducing factor (pNORF1) [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF07517 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011115 SecA protein binds to the plasma membrane where it interacts with proOmpA to support translocation of proOmpA through the membrane | Back alignment and domain information |
|---|
| >PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A | Back alignment and domain information |
|---|
| >TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3 | Back alignment and domain information |
|---|
| >PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional | Back alignment and domain information |
|---|
| >TIGR00604 rad3 DNA repair helicase (rad3) | Back alignment and domain information |
|---|
| >KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] | Back alignment and domain information |
|---|
| >PRK10536 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG3587 Restriction endonuclease [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG0925 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0923 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative | Back alignment and domain information |
|---|
| >PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated | Back alignment and domain information |
|---|
| >PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A | Back alignment and domain information |
|---|
| >COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF13307 Helicase_C_2: Helicase C-terminal domain; PDB: 4A15_A 2VSF_A 3CRV_A 3CRW_1 2VL7_A | Back alignment and domain information |
|---|
| >PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1132 consensus Helicase of the DEAD superfamily [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated | Back alignment and domain information |
|---|
| >PRK14873 primosome assembly protein PriA; Provisional | Back alignment and domain information |
|---|
| >smart00504 Ubox Modified RING finger domain | Back alignment and domain information |
|---|
| >PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated | Back alignment and domain information |
|---|
| >KOG1803 consensus DNA helicase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG4150 consensus Predicted ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR00599 rad18 DNA repair protein rad18 | Back alignment and domain information |
|---|
| >KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A | Back alignment and domain information |
|---|
| >TIGR00376 DNA helicase, putative | Back alignment and domain information |
|---|
| >KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B | Back alignment and domain information |
|---|
| >PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function | Back alignment and domain information |
|---|
| >PHA02929 N1R/p28-like protein; Provisional | Back alignment and domain information |
|---|
| >PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B | Back alignment and domain information |
|---|
| >PF14634 zf-RING_5: zinc-RING finger domain | Back alignment and domain information |
|---|
| >TIGR00604 rad3 DNA repair helicase (rad3) | Back alignment and domain information |
|---|
| >smart00492 HELICc3 helicase superfamily c-terminal domain | Back alignment and domain information |
|---|
| >PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional | Back alignment and domain information |
|---|
| >COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PHA02926 zinc finger-like protein; Provisional | Back alignment and domain information |
|---|
| >PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A | Back alignment and domain information |
|---|
| >TIGR01447 recD exodeoxyribonuclease V, alpha subunit | Back alignment and domain information |
|---|
| >PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated | Back alignment and domain information |
|---|
| >PRK10875 recD exonuclease V subunit alpha; Provisional | Back alignment and domain information |
|---|
| >PF06862 DUF1253: Protein of unknown function (DUF1253); InterPro: IPR010678 This family is defined by a C-terminal region of approximately 500 residues, Digestive organ expansion factor (DEF) is thought to Regulate the p53 pathway to control the expansion growth of digestive organs and is required for the expansion growth of intestine, liver and exocrine pancreas, but not endocrine pancreas [, ] | Back alignment and domain information |
|---|
| >smart00184 RING Ring finger | Back alignment and domain information |
|---|
| >TIGR01448 recD_rel helicase, putative, RecD/TraA family | Back alignment and domain information |
|---|
| >KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A | Back alignment and domain information |
|---|
| >KOG0926 consensus DEAH-box RNA helicase [RNA processing and modification; Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional | Back alignment and domain information |
|---|
| >KOG1805 consensus DNA replication helicase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] | Back alignment and domain information |
|---|
| >cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >PF05876 Terminase_GpA: Phage terminase large subunit (GpA); InterPro: IPR008866 This entry is represented by Bacteriophage lambda, GpA | Back alignment and domain information |
|---|
| >smart00491 HELICc2 helicase superfamily c-terminal domain | Back alignment and domain information |
|---|
| >PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis | Back alignment and domain information |
|---|
| >TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 | Back alignment and domain information |
|---|
| >PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A | Back alignment and domain information |
|---|
| >TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 | Back alignment and domain information |
|---|
| >TIGR02881 spore_V_K stage V sporulation protein K | Back alignment and domain information |
|---|
| >KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PHA02533 17 large terminase protein; Provisional | Back alignment and domain information |
|---|
| >PF12340 DUF3638: Protein of unknown function (DUF3638); InterPro: IPR022099 This domain family is found in eukaryotes, and is approximately 230 amino acids in length | Back alignment and domain information |
|---|
| >TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda | Back alignment and domain information |
|---|
| >KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] | Back alignment and domain information |
|---|
| >COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only] | Back alignment and domain information |
|---|
| >PRK06526 transposase; Provisional | Back alignment and domain information |
|---|
| >COG3421 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX | Back alignment and domain information |
|---|
| >KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >PF06733 DEAD_2: DEAD_2; InterPro: IPR010614 This represents a conserved region within a number of RAD3-like DNA-binding helicases that are seemingly ubiquitous - members include proteins of eukaryotic, bacterial and archaeal origin | Back alignment and domain information |
|---|
| >PRK08084 DNA replication initiation factor; Provisional | Back alignment and domain information |
|---|
| >KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PLN03025 replication factor C subunit; Provisional | Back alignment and domain information |
|---|
| >CHL00181 cbbX CbbX; Provisional | Back alignment and domain information |
|---|
| >KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK12723 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PF14447 Prok-RING_4: Prokaryotic RING finger family 4 | Back alignment and domain information |
|---|
| >PRK08116 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] | Back alignment and domain information |
|---|
| >PRK07003 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >smart00382 AAA ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >PF13245 AAA_19: Part of AAA domain | Back alignment and domain information |
|---|
| >KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK14087 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 885 | ||||
| 3mwy_W | 800 | Crystal Structure Of The Chromodomain-atpase Portio | 5e-27 | ||
| 1z6a_A | 500 | Sulfolobus Solfataricus Swi2SNF2 ATPASE CORE DOMAIN | 1e-19 | ||
| 1z5z_A | 271 | Sulfolobus Solfataricus Swi2SNF2 ATPASE C-Terminal | 1e-19 | ||
| 1z63_A | 500 | Sulfolobus Solfataricus Swi2SNF2 ATPASE CORE IN COM | 1e-19 | ||
| 1z3i_X | 644 | Structure Of The Swi2SNF2 CHROMATIN REMODELING DOMA | 3e-18 |
| >pdb|3MWY|W Chain W, Crystal Structure Of The Chromodomain-atpase Portion Of The Yeast Chd1 Chromatin Remodeler Length = 800 | Back alignment and structure |
|
| >pdb|1Z6A|A Chain A, Sulfolobus Solfataricus Swi2SNF2 ATPASE CORE DOMAIN Length = 500 | Back alignment and structure |
| >pdb|1Z5Z|A Chain A, Sulfolobus Solfataricus Swi2SNF2 ATPASE C-Terminal Domain Length = 271 | Back alignment and structure |
| >pdb|1Z63|A Chain A, Sulfolobus Solfataricus Swi2SNF2 ATPASE CORE IN COMPLEX With Dsdna Length = 500 | Back alignment and structure |
| >pdb|1Z3I|X Chain X, Structure Of The Swi2SNF2 CHROMATIN REMODELING DOMAIN OF EUKARYOTIC Rad54 Length = 644 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 885 | |||
| 1z5z_A | 271 | Helicase of the SNF2/RAD54 family; hydrolase, reco | 1e-64 | |
| 1z5z_A | 271 | Helicase of the SNF2/RAD54 family; hydrolase, reco | 2e-08 | |
| 1z63_A | 500 | Helicase of the SNF2/RAD54 hamily; protein-DNA com | 8e-63 | |
| 1z63_A | 500 | Helicase of the SNF2/RAD54 hamily; protein-DNA com | 6e-29 | |
| 1z63_A | 500 | Helicase of the SNF2/RAD54 hamily; protein-DNA com | 1e-24 | |
| 1z3i_X | 644 | Similar to RAD54-like; recombination ATPase helica | 6e-37 | |
| 1z3i_X | 644 | Similar to RAD54-like; recombination ATPase helica | 2e-17 | |
| 1z3i_X | 644 | Similar to RAD54-like; recombination ATPase helica | 8e-15 | |
| 3dmq_A | 968 | RNA polymerase-associated protein RAPA; SWF2/SNF2, | 2e-34 | |
| 3dmq_A | 968 | RNA polymerase-associated protein RAPA; SWF2/SNF2, | 2e-16 | |
| 3dmq_A | 968 | RNA polymerase-associated protein RAPA; SWF2/SNF2, | 5e-08 | |
| 3mwy_W | 800 | Chromo domain-containing protein 1; SWI2/SNF2 ATPa | 2e-29 | |
| 3mwy_W | 800 | Chromo domain-containing protein 1; SWI2/SNF2 ATPa | 1e-17 | |
| 3mwy_W | 800 | Chromo domain-containing protein 1; SWI2/SNF2 ATPa | 7e-13 | |
| 3hgt_A | 328 | HDA1 complex subunit 3; RECA-like domain, SWI2/SNF | 2e-20 | |
| 1wp9_A | 494 | ATP-dependent RNA helicase, putative; ATPase, DNA | 6e-13 | |
| 1wp9_A | 494 | ATP-dependent RNA helicase, putative; ATPase, DNA | 6e-11 | |
| 2csy_A | 81 | Zinc finger protein 183-like 1; ring finger protei | 4e-11 | |
| 2d8t_A | 71 | Dactylidin, ring finger protein 146; RNF146, ring | 5e-11 | |
| 2ecy_A | 66 | TNF receptor-associated factor 3; metal binding pr | 6e-11 | |
| 1bor_A | 56 | Transcription factor PML; proto-oncogene, nuclear | 9e-10 | |
| 3hct_A | 118 | TNF receptor-associated factor 6; cross-brace, bet | 1e-09 | |
| 2yur_A | 74 | Retinoblastoma-binding protein 6; P53-associated c | 1e-09 | |
| 2djb_A | 72 | Polycomb group ring finger protein 6; PCGF6, ring | 2e-09 | |
| 3ztg_A | 92 | E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR | 2e-09 | |
| 1z6u_A | 150 | NP95-like ring finger protein isoform B; structura | 4e-09 | |
| 4epo_C | 149 | E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 | 4e-09 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 4e-09 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-06 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-06 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 5e-05 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 6e-04 | |
| 3fl2_A | 124 | E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA | 5e-09 | |
| 2ecj_A | 58 | Tripartite motif-containing protein 39; TRIM39, ri | 9e-09 | |
| 3l11_A | 115 | E3 ubiquitin-protein ligase RNF168; E3 ligase, rin | 1e-08 | |
| 3lrq_A | 100 | E3 ubiquitin-protein ligase TRIM37; structural gen | 1e-08 | |
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 1e-08 | |
| 2ysj_A | 63 | Tripartite motif-containing protein 31; ring-type | 1e-08 | |
| 1jm7_B | 117 | BARD1, BRCA1-associated ring domain protein 1; rin | 2e-08 | |
| 1jm7_A | 112 | BRCA1, breast cancer type 1 susceptibility protein | 2e-08 | |
| 2y43_A | 99 | E3 ubiquitin-protein ligase RAD18; DNA repair, met | 2e-08 | |
| 2ckl_A | 108 | Polycomb group ring finger protein 4; BMI1, RING1B | 2e-08 | |
| 3knv_A | 141 | TNF receptor-associated factor 2; cross-brace, alt | 3e-08 | |
| 2ysl_A | 73 | Tripartite motif-containing protein 31; ring-type | 4e-08 | |
| 2ecw_A | 85 | Tripartite motif-containing protein 30; metal bind | 5e-08 | |
| 1rmd_A | 116 | RAG1; V(D)J recombination, antibody, MAD, ring fin | 5e-08 | |
| 2y1n_A | 389 | E3 ubiquitin-protein ligase; ligase-transferase co | 8e-08 | |
| 4a2q_A | 797 | RIG-I, retinoic acid inducible protein I; hydrolas | 1e-07 | |
| 2ecv_A | 85 | Tripartite motif-containing protein 5; metal bindi | 2e-07 | |
| 4a2w_A | 936 | RIG-I, retinoic acid inducible protein I; hydrolas | 2e-07 | |
| 2egp_A | 79 | Tripartite motif-containing protein 34; ZF-C3HC4 d | 3e-07 | |
| 3ng2_A | 71 | RNF4, snurf, ring finger protein 4; ring domain, E | 3e-07 | |
| 2xeu_A | 64 | Ring finger protein 4; transcription, zinc-finger, | 4e-07 | |
| 2ckl_B | 165 | Ubiquitin ligase protein RING2; BMI1, RING1B, poly | 6e-07 | |
| 1chc_A | 68 | Equine herpes virus-1 ring domain; viral protein; | 4e-06 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 7e-06 | |
| 2ea6_A | 69 | Ring finger protein 4; RNF4, RES4-26, ring domain, | 7e-06 | |
| 2ct2_A | 88 | Tripartite motif protein 32; zinc-finger protein H | 1e-05 | |
| 2fz4_A | 237 | DNA repair protein RAD25; RECA-like domain, DNA da | 2e-05 | |
| 2cs3_A | 93 | Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, s | 3e-05 | |
| 2fwr_A | 472 | DNA repair protein RAD25; DNA unwinding, XPB, DNA | 3e-05 | |
| 2ct0_A | 74 | Non-SMC element 1 homolog; ring domain, structural | 5e-04 | |
| 1wim_A | 94 | KIAA0161 protein; ring finger domain, UBCM4-intera | 5e-04 |
| >1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 Length = 271 | Back alignment and structure |
|---|
Score = 217 bits (555), Expect = 1e-64
Identities = 53/174 (30%), Positives = 89/174 (51%), Gaps = 3/174 (1%)
Query: 711 QSSTKIEALREEIRFMVERDGSAKGIVFSQFTSFLDLINYSLHK-SGVNCVQLVGSMSIP 769
+ S K+ E I ++ +F+QF +I + K L G +S
Sbjct: 93 RRSGKMIRTMEIIEEALDEGDKI--AIFTQFVDMGKIIRNIIEKELNTEVPFLYGELSKK 150
Query: 770 ARDAAINRFTEDPDCKIFLMSLKAGGVALNLTVASHVFLMDPWWNPAVEQQAQDRIHRIG 829
RD I++F +P K ++S+KAGG +NLT A+ V D WWNPAVE QA DR++RIG
Sbjct: 151 ERDDIISKFQNNPSVKFIVLSVKAGGFGINLTSANRVIHFDRWWNPAVEDQATDRVYRIG 210
Query: 830 QYKPIRIVRFLIENTIEERILKLQEKKKLVFEGTVGGSADAFGKLTEADMRFLF 883
Q + + + + + T+EE+I +L K+ +F+ + +L+ ++R +
Sbjct: 211 QTRNVIVHKLISVGTLEEKIDQLLAFKRSLFKDIISSGDSWITELSTEELRKVI 264
|
| >1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 Length = 271 | Back alignment and structure |
|---|
| >1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Length = 500 | Back alignment and structure |
|---|
| >1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Length = 500 | Back alignment and structure |
|---|
| >1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Length = 500 | Back alignment and structure |
|---|
| >1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Length = 644 | Back alignment and structure |
|---|
| >1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Length = 644 | Back alignment and structure |
|---|
| >1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Length = 644 | Back alignment and structure |
|---|
| >3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Length = 968 | Back alignment and structure |
|---|
| >3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Length = 968 | Back alignment and structure |
|---|
| >3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Length = 968 | Back alignment and structure |
|---|
| >3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Length = 800 | Back alignment and structure |
|---|
| >3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Length = 800 | Back alignment and structure |
|---|
| >3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Length = 800 | Back alignment and structure |
|---|
| >3hgt_A HDA1 complex subunit 3; RECA-like domain, SWI2/SNF2 helical domain, chromatin regulator, coiled coil, nucleus, repressor, transcription; 2.20A {Saccharomyces cerevisiae} PDB: 3hgq_A Length = 328 | Back alignment and structure |
|---|
| >1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Length = 494 | Back alignment and structure |
|---|
| >1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Length = 494 | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 56 | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118 | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Length = 92 | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150 | Back alignment and structure |
|---|
| >4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 58 | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115 | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Length = 170 | Back alignment and structure |
|---|
| >2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 63 | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 117 | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 112 | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Length = 141 | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Length = 85 | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Length = 116 | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 | Back alignment and structure |
|---|
| >4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Length = 797 | Back alignment and structure |
|---|
| >2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 85 | Back alignment and structure |
|---|
| >4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Length = 936 | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 | Back alignment and structure |
|---|
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Length = 165 | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Length = 237 | Back alignment and structure |
|---|
| >2cs3_A Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.3 Length = 93 | Back alignment and structure |
|---|
| >2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Length = 472 | Back alignment and structure |
|---|
| >2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 94 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
No hit with probability above 80.00
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 885 | ||||
| d1z3ix1 | 346 | c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fi | 1e-26 | |
| d1z3ix1 | 346 | c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fi | 4e-04 | |
| d1z5za1 | 244 | c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 h | 1e-24 | |
| d1wp9a2 | 286 | c.37.1.19 (A:201-486) putative ATP-dependent RNA h | 5e-16 | |
| d1z3ix2 | 298 | c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fis | 3e-13 | |
| d1z3ix2 | 298 | c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fis | 0.001 | |
| d1z63a1 | 230 | c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 h | 5e-13 | |
| d1z63a1 | 230 | c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 h | 2e-10 | |
| d2fwra1 | 200 | c.37.1.19 (A:257-456) DNA repair protein RAD25 {Ar | 3e-10 | |
| d1bora_ | 56 | g.44.1.1 (A:) Acute promyelocytic leukaemia proto- | 1e-09 | |
| d1rmda2 | 86 | g.44.1.1 (A:1-86) V(D)J recombination activating p | 1e-09 | |
| d1fbva4 | 79 | g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta | 2e-08 | |
| d1jm7a_ | 103 | g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie | 2e-07 | |
| d1chca_ | 68 | g.44.1.1 (A:) Immediate early protein, IEEHV {Equi | 2e-06 | |
| d1t1ha_ | 78 | g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cre | 6e-05 | |
| d2fz4a1 | 206 | c.37.1.19 (A:24-229) DNA repair protein RAD25 {Arc | 1e-04 | |
| d2baya1 | 56 | g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 { | 5e-04 | |
| d1iyma_ | 55 | g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati | 0.001 | |
| d1g25a_ | 65 | g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi | 0.002 | |
| d1vyxa_ | 60 | g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal do | 0.003 |
| >d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Length = 346 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Tandem AAA-ATPase domain domain: Rad54-like, Rad54L species: Zebra fish (Danio rerio) [TaxId: 7955]
Score = 110 bits (274), Expect = 1e-26
Identities = 63/179 (35%), Positives = 87/179 (48%), Gaps = 2/179 (1%)
Query: 706 QLDEFQSSTKIEALREEIRFMVERDGSAKGIVFSQFTSFLDLINYSLHKSGVNCVQLVGS 765
+ E Q S K+ L + I M S K ++ S +T LDL V+L G+
Sbjct: 93 KAVEPQLSGKMLVL-DYILAMTRTTTSDKVVLVSNYTQTLDLFEKLCRNRRYLYVRLDGT 151
Query: 766 MSIPARDAAINRFTEDPDCKI-FLMSLKAGGVALNLTVASHVFLMDPWWNPAVEQQAQDR 824
MSI R + RF + F++S KAGG LNL A+ + + DP WNPA ++QA R
Sbjct: 152 MSIKKRAKIVERFNNPSSPEFIFMLSSKAGGCGLNLIGANRLVMFDPDWNPANDEQAMAR 211
Query: 825 IHRIGQYKPIRIVRFLIENTIEERILKLQEKKKLVFEGTVGGSADAFGKLTEADMRFLF 883
+ R GQ K I R L TIEE+IL+ Q KK + V D + ++R LF
Sbjct: 212 VWRDGQKKTCYIYRLLSTGTIEEKILQRQAHKKALSSCVVDEEQDVERHFSLGELRELF 270
|
| >d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Length = 346 | Back information, alignment and structure |
|---|
| >d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Length = 244 | Back information, alignment and structure |
|---|
| >d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 286 | Back information, alignment and structure |
|---|
| >d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Length = 298 | Back information, alignment and structure |
|---|
| >d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Length = 298 | Back information, alignment and structure |
|---|
| >d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Length = 230 | Back information, alignment and structure |
|---|
| >d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Length = 230 | Back information, alignment and structure |
|---|
| >d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 200 | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 | Back information, alignment and structure |
|---|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 | Back information, alignment and structure |
|---|
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 78 | Back information, alignment and structure |
|---|
| >d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 206 | Back information, alignment and structure |
|---|
| >d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56 | Back information, alignment and structure |
|---|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Length = 60 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 885 | |||
| d1z3ix1 | 346 | Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI | 100.0 | |
| d1z5za1 | 244 | Helicase of the SNF2/Rad54 hamily {Sulfolobus solf | 100.0 | |
| d1z3ix2 | 298 | Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI | 100.0 | |
| d1z63a1 | 230 | Helicase of the SNF2/Rad54 hamily {Sulfolobus solf | 100.0 | |
| d1wp9a2 | 286 | putative ATP-dependent RNA helicase PF2015 {Pyroco | 99.93 | |
| d2fwra1 | 200 | DNA repair protein RAD25 {Archaeoglobus fulgidus [ | 99.93 | |
| d1rifa_ | 282 | DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] | 99.91 | |
| d2fz4a1 | 206 | DNA repair protein RAD25 {Archaeoglobus fulgidus [ | 99.9 | |
| d1t5ia_ | 168 | Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo | 99.87 | |
| d1s2ma2 | 171 | Putative ATP-dependent RNA helicase DHH1 {Baker's | 99.86 | |
| d1wp9a1 | 200 | putative ATP-dependent RNA helicase PF2015 {Pyroco | 99.84 | |
| d1hv8a2 | 155 | Putative DEAD box RNA helicase {Archaeon Methanoco | 99.84 | |
| d1fuka_ | 162 | Initiation factor 4a {Baker's yeast (Saccharomyces | 99.82 | |
| d2j0sa2 | 168 | Probable ATP-dependent RNA helicase DDX48 {Human ( | 99.81 | |
| d2rb4a1 | 168 | ATP-dependent RNA helicase DDX25 {Human (Homo sapi | 99.79 | |
| d2bmfa2 | 305 | Dengue virus helicase {Dengue virus type 2 [TaxId: | 99.76 | |
| d1oywa3 | 200 | RecQ helicase domain {Escherichia coli [TaxId: 562 | 99.75 | |
| d1t5la2 | 181 | Nucleotide excision repair enzyme UvrB {Bacillus c | 99.7 | |
| d1c4oa2 | 174 | Nucleotide excision repair enzyme UvrB {Thermus th | 99.67 | |
| d2p6ra3 | 202 | Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 | 99.67 | |
| d1gkub1 | 237 | Helicase-like "domain" of reverse gyrase {Archaeon | 99.55 | |
| d1gm5a3 | 264 | RecG helicase domain {Thermotoga maritima [TaxId: | 99.51 | |
| d1a1va1 | 136 | HCV helicase domain {Human hepatitis C virus (HCV) | 99.47 | |
| d1oywa2 | 206 | RecQ helicase domain {Escherichia coli [TaxId: 562 | 99.42 | |
| d1yksa1 | 140 | YFV helicase domain {Yellow fever virus [TaxId: 11 | 99.4 | |
| d1hv8a1 | 208 | Putative DEAD box RNA helicase {Archaeon Methanoco | 99.39 | |
| d2eyqa3 | 233 | Transcription-repair coupling factor, TRCF {Escher | 99.37 | |
| d1gkub2 | 248 | Helicase-like "domain" of reverse gyrase {Archaeon | 99.36 | |
| d1jr6a_ | 138 | HCV helicase domain {Human hepatitis C virus (HCV) | 99.24 | |
| d2j0sa1 | 222 | Probable ATP-dependent RNA helicase DDX48 {Human ( | 99.19 | |
| d2g9na1 | 218 | Initiation factor 4a {Human (Homo sapiens) [TaxId: | 99.19 | |
| d1wrba1 | 238 | putative ATP-dependent RNA helicase VlgB {Flatworm | 99.19 | |
| d2p6ra4 | 201 | Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 | 99.16 | |
| d1a1va2 | 299 | HCV helicase domain {Human hepatitis C virus (HCV) | 99.16 | |
| d1t6na_ | 207 | Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo | 99.13 | |
| d1gm5a4 | 206 | RecG helicase domain {Thermotoga maritima [TaxId: | 99.1 | |
| d1veca_ | 206 | DEAD box RNA helicase rck/p54 {Human (Homo sapiens | 99.09 | |
| d1qdea_ | 212 | Initiation factor 4a {Baker's yeast (Saccharomyces | 99.07 | |
| d2eyqa5 | 211 | Transcription-repair coupling factor, TRCF {Escher | 98.98 | |
| d1s2ma1 | 206 | Putative ATP-dependent RNA helicase DHH1 {Baker's | 98.96 | |
| d1q0ua_ | 209 | Probable DEAD box RNA helicase YqfR {Bacillus stea | 98.89 | |
| d1yksa2 | 299 | YFV helicase domain {Yellow fever virus [TaxId: 11 | 98.46 | |
| d1tf5a4 | 175 | Translocation ATPase SecA, nucleotide-binding doma | 98.32 | |
| d1nkta4 | 219 | Translocation ATPase SecA, nucleotide-binding doma | 97.62 | |
| d1w36d1 | 359 | Exodeoxyribonuclease V alpha chain (RecD) {Escheri | 97.49 | |
| d1tf5a3 | 273 | Translocation ATPase SecA, nucleotide-binding doma | 97.44 | |
| d1nkta3 | 288 | Translocation ATPase SecA, nucleotide-binding doma | 97.31 | |
| d1jm7a_ | 103 | brca1 RING domain {Human (Homo sapiens) [TaxId: 96 | 97.22 | |
| d1rmda2 | 86 | V(D)J recombination activating protein 1 (RAG1), d | 96.9 | |
| d1t5la1 | 413 | Nucleotide excision repair enzyme UvrB {Bacillus c | 96.76 | |
| d1jm7b_ | 97 | bard1 RING domain {Human (Homo sapiens) [TaxId: 96 | 96.74 | |
| d1fbva4 | 79 | CBL {Human (Homo sapiens) [TaxId: 9606]} | 96.47 | |
| d2c2la2 | 80 | STIP1 homology and U box-containing protein 1, STU | 96.27 | |
| d1bora_ | 56 | Acute promyelocytic leukaemia proto-oncoprotein PM | 95.83 | |
| d1c4oa1 | 408 | Nucleotide excision repair enzyme UvrB {Thermus th | 95.52 | |
| d1chca_ | 68 | Immediate early protein, IEEHV {Equine herpesvirus | 95.35 | |
| d2baya1 | 56 | Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac | 95.31 | |
| d1t1ha_ | 78 | E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi | 95.29 | |
| d1v87a_ | 114 | Deltex protein 2 RING-H2 domain {Mouse (Mus muscul | 95.09 | |
| d1wgma_ | 98 | Ubiquitin conjugation factor E4A {Human (Homo sapi | 94.52 | |
| d1uaaa1 | 306 | DEXX box DNA helicase {Escherichia coli, RepD [Tax | 93.76 | |
| d1g25a_ | 65 | TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 | 93.37 | |
| d1iyma_ | 55 | EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 | 92.72 | |
| d1ur6b_ | 52 | Not-4 N-terminal RING finger domain {Human (Homo s | 92.32 | |
| d1a5ta2 | 207 | delta prime subunit of DNA polymerase III, N-domai | 91.4 | |
| d1njfa_ | 239 | delta prime subunit of DNA polymerase III, N-domai | 90.89 | |
| d1vyxa_ | 60 | IE1B protein (ORF K3), N-terminal domain {Kaposi's | 89.46 | |
| d3dplr1 | 88 | RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase | 88.87 | |
| d1pjra1 | 318 | DEXX box DNA helicase {Bacillus stearothermophilus | 88.08 | |
| d2gnoa2 | 198 | gamma subunit of DNA polymerase III, N-domain {The | 87.3 | |
| d1sxje2 | 252 | Replication factor C5 {Baker's yeast (Saccharomyce | 86.56 | |
| d1wima_ | 94 | UbcM4-interacting protein 4 (KIAA0161) {Human (Hom | 82.61 |
| >d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Tandem AAA-ATPase domain domain: Rad54-like, Rad54L species: Zebra fish (Danio rerio) [TaxId: 7955]
Probab=100.00 E-value=0 Score=348.13 Aligned_cols=262 Identities=29% Similarity=0.359 Sum_probs=211.3
Q ss_pred CCCEEEEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHCCCCCEEECCCCCCCCCCHHH
Q ss_conf 99707888606899899999999999999999999750655662457999999999750596530111121235877133
Q 002744 544 LPPRIVSLRRDSLDIREADYYESLYSESQAQFNTYVQAGTVMNNYAHIFDLLTRLRQAVDHPYLVVYSKTASLRGETEAD 623 (885)
Q Consensus 544 lp~~~~~~~~~~ls~~e~~~y~~l~~~~~~~~~~~~~~~~~~~~~~~~l~~l~~Lrq~~~hp~l~~~~~~~~~~~~~~~~ 623 (885)
||++++.++.|+|++.|+++|+.+....... ..........+++..+++|||+|+||+|+.............
T Consensus 9 LP~K~e~vv~v~LS~~Q~~lY~~~l~~~~~~-----~~~~~~~~~~~~L~~l~~LRkiCnHP~L~~~~~~~~~~~~~~-- 81 (346)
T d1z3ix1 9 LPVKIEQVVCCNLTPLQKELYKLFLKQAKPV-----ESLQTGKISVSSLSSITSLKKLCNHPALIYEKCLTGEEGFDG-- 81 (346)
T ss_dssp SCCEEEEEEEECCCHHHHHHHHHHHHHHCGG-----GSSCTTCCCHHHHHHHHHHHHHHHCTHHHHHHHHHTCTTCTT--
T ss_pred CCCCEEEEEEECCCHHHHHHHHHHHHHHHHH-----HHHHCCCCHHHHHHHHHHHHHHHCCHHHHHHHHCCCCCCCCC--
T ss_conf 8898799999697999999999999989999-----865448716899999999999957998861111022112320--
Q ss_pred HHHHHHHHCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHH
Q ss_conf 33446450435576889843468811104445210136467789998988433455667878888644236777600132
Q 002744 624 AEHVQQVCGLCNDLADDPVVTNCGHAFCKACLFDSSASKFVAKCPTCSIPLTVDFTANEGAGNRTSKTTIKGFKSSSILN 703 (885)
Q Consensus 624 ~~~~~~~c~~~~~~~~~~~~~~c~~~~c~~c~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 703 (885)
. ....|.. ..
T Consensus 82 ~---------------------------------------~~~~~~~-------------------------~~------ 91 (346)
T d1z3ix1 82 A---------------------------------------LDLFPQN-------------------------YS------ 91 (346)
T ss_dssp G---------------------------------------GGTSCSS-------------------------CC------
T ss_pred H---------------------------------------HHHCCCC-------------------------CC------
T ss_conf 0---------------------------------------3312334-------------------------10------
Q ss_pred HHCCCCCCCCHHHHHHHHHHHHHHHCCCCCCEEEECCCHHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHCCCC-
Q ss_conf 1001236830589999999999883089961999916714899999998838992899833889999999998411699-
Q 002744 704 RIQLDEFQSSTKIEALREEIRFMVERDGSAKGIVFSQFTSFLDLINYSLHKSGVNCVQLVGSMSIPARDAAINRFTEDP- 782 (885)
Q Consensus 704 ~~~~~~~~~s~Kl~~L~~lL~~~~~~~~~~KvIIFsq~~~~l~~L~~~L~~~gi~~~~i~G~~~~~~R~~~i~~F~~~~- 782 (885)
........|+|+..|.++|..... .+++||||||+|+.++++|+.+|...|+++.+++|+++..+|+.+++.|+++.
T Consensus 92 -~~~~~~~~S~Kl~~L~~ll~~~~~-~~g~KvlIFs~~~~~ld~l~~~l~~~g~~~~~l~G~~~~~~R~~~i~~F~~~~~ 169 (346)
T d1z3ix1 92 -TKAVEPQLSGKMLVLDYILAMTRT-TTSDKVVLVSNYTQTLDLFEKLCRNRRYLYVRLDGTMSIKKRAKIVERFNNPSS 169 (346)
T ss_dssp -SSSCCGGGSHHHHHHHHHHHHHHH-HCCCEEEEEESCHHHHHHHHHHHHHHTCCEEEECSSCCHHHHHHHHHHHHSTTC
T ss_pred -CCCCCCCCCHHHHHHHHHHHHHHH-HCCCCEEEEEEHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHCCCC
T ss_conf -000140017899999999999887-518951688630145679999976300241101110027889999986510234
Q ss_pred CCEEEEEECCCCCCCCCCCCCCEEEEECCCCCCCHHHHHHHHHHHCCCCCCEEEEEEEECCCHHHHHHHHHHHHHHHHHH
Q ss_conf 93599984588742123345598999689999164789956435049966599999984897999999999999998721
Q 002744 783 DCKIFLMSLKAGGVALNLTVASHVFLMDPWWNPAVEQQAQDRIHRIGQYKPIRIVRFLIENTIEERILKLQEKKKLVFEG 862 (885)
Q Consensus 783 ~~~VlLlSt~agg~GLNL~~A~~VI~~D~~wnp~~~~QaigRi~RiGQ~k~V~VyrLv~~~TiEe~i~~~~~~K~~~~~~ 862 (885)
...|||+|+++||+||||+.|++||+|||+|||+.+.||+||+||+||+++|+||||+++|||||+|+++|..|..+++.
T Consensus 170 ~~~vlLls~~agg~GlnL~~a~~vi~~d~~wnp~~~~Qa~~R~~R~GQ~~~V~v~rli~~~TiEe~i~~~~~~K~~l~~~ 249 (346)
T d1z3ix1 170 PEFIFMLSSKAGGCGLNLIGANRLVMFDPDWNPANDEQAMARVWRDGQKKTCYIYRLLSTGTIEEKILQRQAHKKALSSC 249 (346)
T ss_dssp CCCEEEEEGGGSCTTCCCTTEEEEEECSCCSSHHHHHHHHTTSSSTTCCSCEEEEEEEETTSHHHHHHHHHHHHHHTSCC
T ss_pred CCEEEEECCHHHHHCCCCCCCEEEEEECCCCCCCHHHHHHHCCCCCCCCCCEEEEEEEECCCHHHHHHHHHHHHHHHHHH
T ss_conf 33025403314443356564307999457886155867633340348998438999873898999999999999999998
Q ss_pred HCCCCCCCCCCCCHHHHHHHHC
Q ss_conf 1179820015888999985114
Q 002744 863 TVGGSADAFGKLTEADMRFLFV 884 (885)
Q Consensus 863 ~l~~~~~~~~~~~~~~~~~lf~ 884 (885)
++++.......++.+|++.||.
T Consensus 250 v~~~~~~~~~~~~~~~l~~lf~ 271 (346)
T d1z3ix1 250 VVDEEQDVERHFSLGELRELFS 271 (346)
T ss_dssp CCSCSSSCCCSSCHHHHHHHTC
T ss_pred HHCCCHHHHHCCCHHHHHHHHC
T ss_conf 7588655540289999999964
|
| >d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} | Back information, alignment and structure |
|---|
| >d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} | Back information, alignment and structure |
|---|
| >d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} | Back information, alignment and structure |
|---|
| >d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} | Back information, alignment and structure |
|---|
| >d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} | Back information, alignment and structure |
|---|
| >d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} | Back information, alignment and structure |
|---|
| >d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} | Back information, alignment and structure |
|---|
| >d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} | Back information, alignment and structure |
|---|
| >d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} | Back information, alignment and structure |
|---|
| >d1tf5a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1nkta4 c.37.1.19 (A:397-615) Translocation ATPase SecA, nucleotide-binding domains {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1tf5a3 c.37.1.19 (A:1-226,A:349-395) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1c4oa1 c.37.1.19 (A:2-409) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} | Back information, alignment and structure |
|---|
| >d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} | Back information, alignment and structure |
|---|
| >d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|