Citrus Sinensis ID: 002763


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880---
MASHQRNRGSGFKVSVCGQEEIEQLSRDGSHYSLSTGVLPSLGARSNRRVKLRRFIVSPYDRRYRVWETYLVLLVIYTAWASPFEFGFLRKPQRPLSVIDNVVNGFFAVDIILTFFVAYLDKATYLLVDCPKQIAWKYASSWLVFDVISTIPSELAQKISPKPLQSYGLFNMLRLWRLRRVSALFSRLEKDRNYNYFWVRCCKLIFVTLFAVHCAGCFYYLLAARYHNPERTWIGASLGQNFLEKSLWIRYVTSMYWSITTLTTVGYGDLHPVNTREMVFDILFMLFNLGLTAYLIGNMTNLVVHGTSRTRKFRDTIQAASSFAQRNQLPIRLQDQMLAHLCLKFRTDSEGLQQQETLDSLPKAIRSSISHYLFYSLMDKVYLFRGVSNDLLFQLVSEMKAEYFPPKEDVILQNEAPTDFYILVTGAVDLLVLKNGVEQVVGEAKTGEICGEIGVLCYRPQLFTVRTKRLSQLLRLNRTTFLNIVQANVGDGTIIMNNLLQHLKDLKDPIMEGVLLETENMLARGRMDLPLSLCFAALRGDDLLLHQLLKRGLDPNESDNNGRTALHIAASKGSENCVLLLLDYEADPNSIDSDGNVPLWEAMLGGHENVIKLLMENHADINSGDVGHFACTAAEQNNLELLKEIVCYGGDVTRQRNNGSTALHVAVCEDNVEIVRFLLDQKADVDKPDVHGWTPRDLADQQGHEEIKCIFQSCKETKAQSIISVAERPQQEVHYLGRFTSEPAIRPITHEVSFEGVDGSGSQNHSRRRTNNFHNSLFGIMSAAHNVEKDILFPPQHTKVFKAPGINSARVTIGCPEKGEVAGKLVLLPSTFQELLDIGEKKFGISPAKVLNKGGAEVEDIEVIRDGDHLVFVSDGGQNTSNQ
ccccccccccccEEEEcccHHHHHccccccccccccccccccccccccccccccEEEccccHHHHHHHHHHHHHHHHHHHHccEEEEEEcccccccEEHHHHHHHHHHHHHHHHccEEEEEcccEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccccccHHHHHHHcHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHccEEEcccccEEEEccccccEEEEEEEcEEEEEEEccccEEEEEEEccccEEEEccccccccEEEEEEEcccEEEEEEcHHHHHHHHHHcHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccccccccHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccccEEEEcccccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccHHHHHHHHHHHccHHHHHHHHHcccccccccccccHHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHcHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccccccccccEEEEccccccccccEEEEccccHHHHHHHHHHHccccccEEEcccccEEccEEEEEcccEEEEEEccccccccc
ccccccccccccccccccccEEEEEccccccccccHcccccccccccccccccEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEHHHHHHHHHHHHEEEEEEHHHcccccEEEEccHHHHHHHHHHcHHHHHHHHHccHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEccccccccccccHHccHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccccccHHHHHHHccHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHcHHccccccEEEEEccccccEEEEEEcEEEEEEEccccEEEEEEEccccEEEEEEEEcccccccEEEEEcHHHHHEccHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccHHHHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHccHcccccccccccccccccHHHHHccccccccccccccccccccccccccccccHccccccccccHHHHHHHcccccccccccccccccccccccccEEEEEEcccccccccEEEEccccHHHHHHHHHHHccccccEEEcccccEEccEEEEEcccEEEEEEccccccccc
mashqrnrgsgfkvsvCGQEEIEQlsrdgshyslstgvlpslgarsnrrVKLRRFivspydrryRVWETYLVLLVIYTawaspfefgflrkpqrplsvidnVVNGFFAVDIILTFFVAYLDKATYLLVDCPKQIAWKYASSWLVFDVISTipselaqkispkplqsyglfnmLRLWRLRRVSALFSRLekdrnynyfWVRCCKLIFVTLFAVHCAGCFYYLLAAryhnpertwigaslgqnflEKSLWIRYVTSMYWSITTlttvgygdlhpvntrEMVFDILFMLFNLGLTAYLIGNMTNLVVHGTSRTRKFRDTIQAASSFAqrnqlpirLQDQMLAHLCLKfrtdseglqqqetlDSLPKAIRSSISHYLFYSLMDKVYLFRGVSNDLLFQLVSEMkaeyfppkedvilqneaptdfYILVTGAVDLLVLKNGVEQVVgeaktgeicgeigvlcyrpqlftVRTKRLSQLLRLNRTTFLNIVQANVGDGTIIMNNLLQHLkdlkdpimegVLLETENMLARGRMDLPLSLCFAALRGDDLLLHQLLKrgldpnesdnngrTALHIAASKGSENCVLLLLDyeadpnsidsdgnvplwEAMLGGHENVIKLLMENhadinsgdvghfACTAAEQNNLELLKEIVCYggdvtrqrnngstaLHVAVCEDNVEIVRFLLdqkadvdkpdvhgwtprdladqqgHEEIKCIFQSCKETKAQSIISVAerpqqevhylgrftsepairpithevsfegvdgsgsqnhsrrrtnnfHNSLFGIMSAahnvekdilfppqhtkvfkapginsarvtigcpekgevagklvllpsTFQELLDIGekkfgispakvlnkggaevedievirdgdhlvfvsdggqntsnq
mashqrnrgsgfkvsvCGQEEIEqlsrdgshyslstgvlpslgarsnrrvklrrfivspydrryrVWETYLVLLVIYTAWASPFEFGFLRKPQRPLSVIDNVVNGFFAVDIILTFFVAYLDKATYLLVDCPKQIAWKYASSWLVFDVISTIPSelaqkispkplqSYGLFNMLRLWRLRRVSALFSrlekdrnynYFWVRCCKLIFVTLFAVHCAGCFYYLLAARYHNPERTWIGASLGQNFLEKSLWIRYVTSMYWSITTLTTVGYGDLHPVNTREMVFDILFMLFNLGLTAYLIGNMTNLVVHGTSRTRKFRDTIQAASSfaqrnqlpIRLQDQMLAHLCLKFRTDSEGLQQQETLDSLPKAIRSSISHYLFYSLMDKVYLFRGVSNDLLFQLVSEMKAEYFPPKEDVILQNEAPTDFYILVTGAVDLLVLKNGVEQVVGEaktgeicgeigVLCYRPQLFTVRTKRLSQLLRLNRTTFLNIVQANVGDGTIIMNNLLQHLKDLKDPIMEGVLLETENMLARGRMDLPLSLCFAALRGDDLLLHQLLKRgldpnesdnnGRTALHIAASKGSENCVLLLLDYEADPNSIDSDGNVPLWEAMLGGHENVIKLLMENHADINSGDVGHFACTAAEQNNLELLKEIVCYGGDVTRQRNNGSTALHVAVCEDNVEIVRFLLDqkadvdkpdvhgWTPRDLADQQGHEEIKCIFQSCKETKAQSIISvaerpqqevhylgrftsepaiRPITHEVSFEGVdgsgsqnhsrrrTNNFHNSLFGIMSAAHNVEKDILFPPQHTKVFKAPGINSARVTIGCPEKGEVAGKLVLLPSTFQELLDIGEKKFGISPAKVLNKGGAEVEDIEVIRDGDHLVfvsdggqntsnq
MASHQRNRGSGFKVSVCGQEEIEQLSRDGSHYSLSTGVLPSLGARSNRRVKLRRFIVSPYDRRYRVWETYLVLLVIYTAWASPFEFGFLRKPQRPLSVIDNVVNGFFAVDIILTFFVAYLDKATYLLVDCPKQIAWKYASSWLVFDVISTIPSELAQKISPKPLQSYGLFNMLRLWRLRRVSALFSRLEKDRNYNYFWVRCCKLIFVTLFAVHCAGCFYYLLAARYHNPERTWIGASLGQNFLEKSLWIRYVTSMYWSITTLTTVGYGDLHPVNTREMVFDILFMLFNLGLTAYLIGNMTNLVVHGTSRTRKFRDTIQAASSFAQRNQLPIRLQDQMLAHLCLKFRTDSEGLQQQETLDSLPKAIRSSISHYLFYSLMDKVYLFRGVSNDLLFQLVSEMKAEYFPPKEDVILQNEAPTDFYILVTGAVDLLVLKNGVEQVVGEAKTGEICGEIGVLCYRPQLFTVRTKRLSQLLRLNRTTFLNIVQANVGDGTIIMNNLLQHLKDLKDPIMEGVLLETENMLARGRMDLPLSLCFAAlrgddlllhqllkrgldPNESDNNGRTALHIAASKGSENCVLLLLDYEADPNSIDSDGNVPLWEAMLGGHENVIKLLMENHADINSGDVGHFACTAAEQNNLELLKEIVCYGGDVTRQRNNGSTALHVAVCEDNVEIVRFLLDQKADVDKPDVHGWTPRDLADQQGHEEIKCIFQSCKETKAQSIISVAERPQQEVHYLGRFTSEPAIRPITHEVSFEGVDGSGSQNHSRRRTNNFHNSLFGIMSAAHNVEKDILFPPQHTKVFKAPGINSARVTIGCPEKGEVAGKLVLLPSTFQELLDIGEKKFGISPAKVLNKGGAEVEDIEVIRDGDHLVFVSDGGQNTSNQ
*************************************VLPSLGARSNRRVKLRRFIVSPYDRRYRVWETYLVLLVIYTAWASPFEFGFLRKPQRPLSVIDNVVNGFFAVDIILTFFVAYLDKATYLLVDCPKQIAWKYASSWLVFDVISTIPSELAQKISPKPLQSYGLFNMLRLWRLRRVSALFSRLEKDRNYNYFWVRCCKLIFVTLFAVHCAGCFYYLLAARYHNPERTWIGASLGQNFLEKSLWIRYVTSMYWSITTLTTVGYGDLHPVNTREMVFDILFMLFNLGLTAYLIGNMTNLVVHGTSRTRKFRDTIQAASSFAQRNQLPIRLQDQMLAHLCLKFRT***************KAIRSSISHYLFYSLMDKVYLFRGVSNDLLFQLVSEMKAEYFPPKEDVILQNEAPTDFYILVTGAVDLLVLKNGVEQVVGEAKTGEICGEIGVLCYRPQLFTVRTKRLSQLLRLNRTTFLNIVQANVGDGTIIMNNLLQHLKDLKDPIMEGVLLETENMLARGRMDLPLSLCFAALRGDDLLLHQLLKRG*************LHIAASKGSENCVLLLLDYEADPNSIDSDGNVPLWEAMLGGHENVIKLLMENHADINSGDVGHFACTAAEQNNLELLKEIVCYGGDVTRQRNNGSTALHVAVCEDNVEIVRFLLDQKADVDKPDVHGWTPRDLADQQGHEEIKCIFQSCKETKAQSIISVAERPQQEVHYLGRFTSEPAIRPIT***********************FHNSLFGIMSAAHNVEKDILFPPQHTKVFKAPGINSARVTIGCPEKGEVAGKLVLLPSTFQELLDIGEKKFGISPAKVLNKGGAEVEDIEVIRDGDHLVFV**********
*****************************************************RFIVSPYDRRYRVWETYLVLLVIYTAWASPFEFGFLRKPQRPLSVIDNVVNGFFAVDIILTFFVAYLDKATYLLVDCPKQIAWKYASSWLVFDVISTIPSELAQKISPKPLQSYGLFNMLRLWRLRRVSALFSRLEKDRNYNYFWVRCCKLIFVTLFAVHCAGCFYYLLAARYHNPERTWIGASLGQNFLEKSLWIRYVTSMYWSITTLTTVGYGDLHPVNTREMVFDILFMLFNLGLTAYLIGNMTNLVVHG************AASSFAQRNQLPIRLQDQMLAHLCLKFRTDSEGLQQQETLDSLPKAIRSSISHYLFYSLMDKVYLFRGVSNDLLFQLVSEMKAEYFPPKEDVILQNEAPTDFYILVTGAVDLLVLKNGVEQVVGEAKTGEICGEIGVLCYRPQLFTVRTKRLSQLLRLNRTTFLNIVQANVGDGTIIMNNLLQHLK****************************LCFAAL*G****************************AASKGSENCVLLLLDYEADPNSIDSDGNVPLWEAMLGGHENVIKLLMENHADINSGDVGHFACTAAEQNNLELLKEIVCYGGDVTRQRNNGSTALHVAVCEDNVEIVRFLLDQKADVDKPDVHGWTPRDLA************************************************************************************************************************EVAGKLVLLPSTFQELLDIGEKKFGISPAKVLNKGGAEVEDIEVIRDGDHLVFV**********
*************VSVCGQEEIEQLSRDGSHYSLSTGVLPSLGARSNRRVKLRRFIVSPYDRRYRVWETYLVLLVIYTAWASPFEFGFLRKPQRPLSVIDNVVNGFFAVDIILTFFVAYLDKATYLLVDCPKQIAWKYASSWLVFDVISTIPSELAQKISPKPLQSYGLFNMLRLWRLRRVSALFSRLEKDRNYNYFWVRCCKLIFVTLFAVHCAGCFYYLLAARYHNPERTWIGASLGQNFLEKSLWIRYVTSMYWSITTLTTVGYGDLHPVNTREMVFDILFMLFNLGLTAYLIGNMTNLVVHGTSRTRKFRDTIQAASSFAQRNQLPIRLQDQMLAHLCLKFRTDSEGLQQQETLDSLPKAIRSSISHYLFYSLMDKVYLFRGVSNDLLFQLVSEMKAEYFPPKEDVILQNEAPTDFYILVTGAVDLLVLKNGVEQVVGEAKTGEICGEIGVLCYRPQLFTVRTKRLSQLLRLNRTTFLNIVQANVGDGTIIMNNLLQHLKDLKDPIMEGVLLETENMLARGRMDLPLSLCFAALRGDDLLLHQLLKRGLDPNESDNNGRTALHIAASKGSENCVLLLLDYEADPNSIDSDGNVPLWEAMLGGHENVIKLLMENHADINSGDVGHFACTAAEQNNLELLKEIVCYGGDVTRQRNNGSTALHVAVCEDNVEIVRFLLDQKADVDKPDVHGWTPRDLADQQGHEEIKCIFQSCKETKAQSIISVAERPQQEVHYLGRFTSEPAIRPITHEVSFEG**********RRRTNNFHNSLFGIMSAAHNVEKDILFPPQHTKVFKAPGINSARVTIGCPEKGEVAGKLVLLPSTFQELLDIGEKKFGISPAKVLNKGGAEVEDIEVIRDGDHLVFVSDGGQNTSNQ
******************QEEIEQLSRDGSHYSLSTGVLPSLGARSNRRVKLRRFIVSPYDRRYRVWETYLVLLVIYTAWASPFEFGFLRKPQRPLSVIDNVVNGFFAVDIILTFFVAYLDKATYLLVDCPKQIAWKYASSWLVFDVISTIPSELAQKISPKPLQSYGLFNMLRLWRLRRVSALFSRLEKDRNYNYFWVRCCKLIFVTLFAVHCAGCFYYLLAARYHNPERTWIGASLGQNFLEKSLWIRYVTSMYWSITTLTTVGYGDLHPVNTREMVFDILFMLFNLGLTAYLIGNMTNLVVHGTSRTRKFRDTIQAASSFAQRNQLPIRLQDQMLAHLCLKFRTDSEGLQQQETLDSLPKAIRSSISHYLFYSLMDKVYLFRGVSNDLLFQLVSEMKAEYFPPKEDVILQNEAPTDFYILVTGAVDLLVLKNGVEQVVGEAKTGEICGEIGVLCYRPQLFTVRTKRLSQLLRLNRTTFLNIVQANVGDGTIIMNNLLQHLKDLKDPIMEGVLLETENMLARGRMDLPLSLCFAALRGDDLLLHQLLKRGLDPNESDNNGRTALHIAASKGSENCVLLLLDYEADPNSIDSDGNVPLWEAMLGGHENVIKLLMENHADINSGDVGHFACTAAEQNNLELLKEIVCYGGDVTRQRNNGSTALHVAVCEDNVEIVRFLLDQKADVDKPDVHGWTPRDLADQQGHEEIKCIFQSCK*************PQQ*********S******************************************A*******************PGINSARVTIGCPEKGEVAGKLVLLPSTFQELLDIGEKKFGISPAKVLNKGGAEVEDIEVIRDGDHLVFVSDG*******
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASHQRNRGSGFKVSVCGQEEIEQLSRDGSHYSLSTGVLPSLGARSNRRVKLRRFIVSPYDRRYRVWETYLVLLVIYTAWASPFEFGFLRKPQRPLSVIDNVVNGFFAVDIILTFFVAYLDKATYLLVDCPKQIAWKYASSWLVFDVISTIPSELAQKISPKPLQSYGLFNMLRLWRLRRVSALFSRLEKDRNYNYFWVRCCKLIFVTLFAVHCAGCFYYLLAARYHNPERTWIGASLGQNFLEKSLWIRYVTSMYWSITTLTTVGYGDLHPVNTREMVFDILFMLFNLGLTAYLIGNMTNLVVHGTSRTRKFRDTIQAASSFAQRNQLPIRLQDQMLAHLCLKFRTDSEGLQQQETLDSLPKAIRSSISHYLFYSLMDKVYLFRGVSNDLLFQLVSEMKAEYFPPKEDVILQNEAPTDFYILVTGAVDLLVLKNGVEQVVGEAKTGEICGEIGVLCYRPQLFTVRTKRLSQLLRLNRTTFLNIVQANVGDGTIIMNNLLQHLKDLKDPIMEGVLLETENMLARGRMDLPLSLCFAALRGDDLLLHQLLKRGLDPNESDNNGRTALHIAASKGSENCVLLLLDYEADPNSIDSDGNVPLWEAMLGGHENVIKLLMENHADINSGDVGHFACTAAEQNNLELLKEIVCYGGDVTRQRNNGSTALHVAVCEDNVEIVRFLLDQKADVDKPDVHGWTPRDLADQQGHEEIKCIFQSCKETKAQSIISVAERPQQEVHYLGRFTSEPAIRPITHEVSFEGVDGSGSQNHSRRRTNNFHNSLFGIMSAAHNVEKDILFPPQHTKVFKAPGINSARVTIGCPEKGEVAGKLVLLPSTFQELLDIGEKKFGISPAKVLNKGGAEVEDIEVIRDGDHLVFVSDGGQNTSNQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query883 2.2.26 [Sep-21-2011]
Q38998857 Potassium channel AKT1 OS yes no 0.956 0.985 0.720 0.0
P0C550935 Potassium channel AKT1 OS N/A no 0.961 0.908 0.647 0.0
Q0JKV1935 Potassium channel AKT1 OS yes no 0.961 0.908 0.645 0.0
Q8GXE6888 Potassium channel AKT6 OS no no 0.956 0.951 0.643 0.0
Q9SCX5880 Probable potassium channe no no 0.951 0.954 0.632 0.0
Q8H569907 Potassium channel AKT3 OS no no 0.935 0.910 0.551 0.0
Q75HP9855 Potassium channel AKT2 OS no no 0.887 0.916 0.422 1e-180
Q39128677 Potassium channel KAT1 OS no no 0.530 0.691 0.634 1e-178
Q38898802 Potassium channel AKT2/3 no no 0.759 0.836 0.482 1e-174
Q38849697 Potassium channel KAT2 OS no no 0.562 0.713 0.602 1e-171
>sp|Q38998|AKT1_ARATH Potassium channel AKT1 OS=Arabidopsis thaliana GN=AKT1 PE=1 SV=2 Back     alignment and function desciption
 Score = 1298 bits (3360), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 623/865 (72%), Positives = 730/865 (84%), Gaps = 20/865 (2%)

Query: 16  VCGQ--EEIEQLSRDGSHYSLSTGVLPSLGARSNRRVKLRRFIVSPYDRRYRVWETYLVL 73
           +CGQ  +EIEQLSR+ SH+SLSTG+LPSLGARSNRRVKLRRF+VSPYD +YR+WE +LV+
Sbjct: 7   LCGQVQDEIEQLSRESSHFSLSTGILPSLGARSNRRVKLRRFVVSPYDHKYRIWEAFLVV 66

Query: 74  LVIYTAWASPFEFGFLRKPQRPLSVIDNVVNGFFAVDIILTFFVAYLDKATYLLVDCPKQ 133
           LV+YTAW SPFEFGFLRKP+ PLS+ DN+VN FFA+DII+TFFV YLDK+TYL+VD  KQ
Sbjct: 67  LVVYTAWVSPFEFGFLRKPRPPLSITDNIVNAFFAIDIIMTFFVGYLDKSTYLIVDDRKQ 126

Query: 134 IAWKYASSWLVFDVISTIPSELAQKISPKPLQSYGLFNMLRLWRLRRVSALFSRLEKDRN 193
           IA+KY  SW + D++STIPSE A +IS    QSYGLFNMLRLWRLRRV ALF+RLEKDRN
Sbjct: 127 IAFKYLRSWFLLDLVSTIPSEAAMRISS---QSYGLFNMLRLWRLRRVGALFARLEKDRN 183

Query: 194 YNYFWVRCCKLIFVTLFAVHCAGCFYYLLAARYHNPERTWIGASLGQNFLEKSLWIRYVT 253
           +NYFWVRC KL+ VTLFAVHCA CFYYL+AAR  NP +TWIGA++  NFLE+SLW+RYVT
Sbjct: 184 FNYFWVRCAKLVCVTLFAVHCAACFYYLIAARNSNPAKTWIGANVA-NFLEESLWMRYVT 242

Query: 254 SMYWSITTLTTVGYGDLHPVNTREMVFDILFMLFNLGLTAYLIGNMTNLVVHGTSRTRKF 313
           SMYWSITTLTTVGYGDLHPVNT+EM+FDI +MLFNLGLTAYLIGNMTNLVVHGTSRTR F
Sbjct: 243 SMYWSITTLTTVGYGDLHPVNTKEMIFDIFYMLFNLGLTAYLIGNMTNLVVHGTSRTRNF 302

Query: 314 RDTIQAASSFAQRNQLPIRLQDQMLAHLCLKFRTDSEGLQQQETLDSLPKAIRSSISHYL 373
           RDTIQAAS+FA RN LP RLQDQMLAHLCLK+RTDSEGLQQQETLD+LPKAIRSSISH+L
Sbjct: 303 RDTIQAASNFAHRNHLPPRLQDQMLAHLCLKYRTDSEGLQQQETLDALPKAIRSSISHFL 362

Query: 374 FYSLMDKVYLFRGVSNDLLFQLVSEMKAEYFPPKEDVILQNEAPTDFYILVTGAVDLLVL 433
           FYSLMDKVYLFRGVSNDLLFQLVSEMKAEYFPPKEDVILQNEAPTDFYILV G  DL+ +
Sbjct: 363 FYSLMDKVYLFRGVSNDLLFQLVSEMKAEYFPPKEDVILQNEAPTDFYILVNGTADLVDV 422

Query: 434 KNGVEQVVGEAKTGEICGEIGVLCYRPQLFTVRTKRLSQLLRLNRTTFLNIVQANVGDGT 493
             G E +V E K G+I GEIGVLCYRPQLFTVRTKRL QLLR+NRTTFLNI+QANVGDGT
Sbjct: 423 DTGTESIVREVKAGDIIGEIGVLCYRPQLFTVRTKRLCQLLRMNRTTFLNIIQANVGDGT 482

Query: 494 IIMNNLLQHLKDLKDPIMEGVLLETENMLARGRMDLPLSLCFAALRGDDLLLHQLLKRGL 553
           IIMNNLLQHLK++ DP+M  VLLE ENMLARG+MDLPL+LCFAA+R DDLLLHQLLKRGL
Sbjct: 483 IIMNNLLQHLKEMNDPVMTNVLLEIENMLARGKMDLPLNLCFAAIREDDLLLHQLLKRGL 542

Query: 554 DPNESDNNGRTALHIAASKGSENCVLLLLDYEADPNSIDSDGNVPLWEAMLGGHENVIKL 613
           DPNESDNNGRT LHIAASKG+ NCVLLLL+Y ADPN  D++G+VPLWEAM+ GHE V+K+
Sbjct: 543 DPNESDNNGRTPLHIAASKGTLNCVLLLLEYHADPNCRDAEGSVPLWEAMVEGHEKVVKV 602

Query: 614 LMENHADINSGDVGHFACTAAEQNNLELLKEIVCYGGDVTRQRNNGSTALHVAVCEDNVE 673
           L+E+ + I++GDVGHFACTAAEQ NL+LLKEIV +GGDVTR R  G++ALH AVCE+N+E
Sbjct: 603 LLEHGSTIDAGDVGHFACTAAEQGNLKLLKEIVLHGGDVTRPRATGTSALHTAVCEENIE 662

Query: 674 IVRFLLDQKADVDKPDVHGWTPRDLADQQGHEEIKCIFQSCKETKAQSIISVAERP--QQ 731
           +V++LL+Q ADV+K D+HGWTPRDLA+QQGHE+IK +F+     +   I + +  P  + 
Sbjct: 663 MVKYLLEQGADVNKQDMHGWTPRDLAEQQGHEDIKALFREKLHERRVHIETSSSVPILKT 722

Query: 732 EVHYLGRFTSEPAIRPITHEVSFEGVDGSGSQNHSRRRTNNFHNSLFGIMSAAHNVEKDI 791
            + +LGRFTSEP IRP + EVSF        +  +RR+TNNF NSLFGI+ A  +V K+ 
Sbjct: 723 GIRFLGRFTSEPNIRPASREVSFR-----IRETRARRKTNNFDNSLFGIL-ANQSVPKNG 776

Query: 792 LFPPQHTKVFKAPGINSARVTIGCPEKGEVAGKLVLLPSTFQELLDIGEKKFGISPAKVL 851
           L       V +    N  RVTI C EK ++AGKLVLLP +F+ELL++G  KFGI   KV+
Sbjct: 777 L-----ATVDEGRTGNPVRVTISCAEKDDIAGKLVLLPGSFKELLELGSNKFGIVATKVM 831

Query: 852 NK-GGAEVEDIEVIRDGDHLVFVSD 875
           NK   AE++D++VIRDGDHL+F +D
Sbjct: 832 NKDNNAEIDDVDVIRDGDHLIFATD 856




Highly selective inward-rectifying potassium channel that mediate potassium uptake by plant roots in response to low K(+) conditions, by a calcium-, CBL-, and CIPK-dependent pathway. Involved in the stomatal regulation by monitoring the turgor pressure in guard cells. Assuming opened or closed conformations in response to the voltage difference across the membrane, the channel is activated by hyperpolarization. May interact with the cytoskeleton or with regulatory proteins.
Arabidopsis thaliana (taxid: 3702)
>sp|P0C550|AKT1_ORYSI Potassium channel AKT1 OS=Oryza sativa subsp. indica GN=AKT1 PE=2 SV=1 Back     alignment and function description
>sp|Q0JKV1|AKT1_ORYSJ Potassium channel AKT1 OS=Oryza sativa subsp. japonica GN=AKT1 PE=2 SV=1 Back     alignment and function description
>sp|Q8GXE6|AKT6_ARATH Potassium channel AKT6 OS=Arabidopsis thaliana GN=AKT6 PE=1 SV=2 Back     alignment and function description
>sp|Q9SCX5|AKT5_ARATH Probable potassium channel AKT5 OS=Arabidopsis thaliana GN=AKT5 PE=2 SV=2 Back     alignment and function description
>sp|Q8H569|AKT3_ORYSJ Potassium channel AKT3 OS=Oryza sativa subsp. japonica GN=Os07g0175400 PE=3 SV=1 Back     alignment and function description
>sp|Q75HP9|AKT2_ORYSJ Potassium channel AKT2 OS=Oryza sativa subsp. japonica GN=Os05g0428700 PE=2 SV=1 Back     alignment and function description
>sp|Q39128|KAT1_ARATH Potassium channel KAT1 OS=Arabidopsis thaliana GN=KAT1 PE=1 SV=2 Back     alignment and function description
>sp|Q38898|AKT2_ARATH Potassium channel AKT2/3 OS=Arabidopsis thaliana GN=AKT2 PE=1 SV=1 Back     alignment and function description
>sp|Q38849|KAT2_ARATH Potassium channel KAT2 OS=Arabidopsis thaliana GN=KAT2 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query883
255576976901 Potassium channel AKT1, putative [Ricinu 0.993 0.973 0.822 0.0
282161430880 shaker-like potassium channel 1 [Populus 0.986 0.989 0.817 0.0
449464346873 PREDICTED: potassium channel AKT1-like [ 0.977 0.988 0.826 0.0
225445408872 PREDICTED: potassium channel AKT1-like [ 0.978 0.990 0.804 0.0
297738905872 unnamed protein product [Vitis vinifera] 0.978 0.990 0.802 0.0
262316884872 inward rectifying shaker-like K+ channel 0.978 0.990 0.800 0.0
282161432877 shaker-like potassium channel 2 [Populus 0.987 0.994 0.792 0.0
224114381877 predicted protein [Populus trichocarpa] 0.987 0.994 0.789 0.0
224088071848 predicted protein [Populus trichocarpa] 0.950 0.989 0.786 0.0
147861116840 hypothetical protein VITISV_015412 [Viti 0.945 0.994 0.790 0.0
>gi|255576976|ref|XP_002529373.1| Potassium channel AKT1, putative [Ricinus communis] gi|223531193|gb|EEF33040.1| Potassium channel AKT1, putative [Ricinus communis] Back     alignment and taxonomy information
 Score = 1504 bits (3895), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 724/880 (82%), Positives = 787/880 (89%), Gaps = 3/880 (0%)

Query: 6   RNRGSGFKVSVCGQEEIEQLSRDGSHYSLSTGVLPSLGARSNRRVKLRRFIVSPYDRRYR 65
           RNRG  F+VSVCGQEEIEQLSRDGS YSL+  VLPSLGARSNRRVKLR FI+SPYDRRYR
Sbjct: 5   RNRGV-FRVSVCGQEEIEQLSRDGSQYSLTNAVLPSLGARSNRRVKLRTFIISPYDRRYR 63

Query: 66  VWETYLVLLVIYTAWASPFEFGFLRKPQRPLSVIDNVVNGFFAVDIILTFFVAYLDKATY 125
           +W+TYLVLLV+YTAW SPFEFGFL KP+ PLS+ DNVVNGFFAVDI+LTFFVAYLD +TY
Sbjct: 64  IWQTYLVLLVVYTAWVSPFEFGFLEKPEGPLSITDNVVNGFFAVDILLTFFVAYLDHSTY 123

Query: 126 LLVDCPKQIAWKYASSWLVFDVISTIPSELAQKISPKPLQSYGLFNMLRLWRLRRVSALF 185
           LLVD PK+IAWKY SSWL FDVISTIPSELA+KISPKP QSYG FNMLRLWRLRRVSALF
Sbjct: 124 LLVDDPKRIAWKYTSSWLAFDVISTIPSELARKISPKPFQSYGFFNMLRLWRLRRVSALF 183

Query: 186 SRLEKDRNYNYFWVRCCKLIFVTLFAVHCAGCFYYLLAARYHNPERTWIGASLGQNFLEK 245
           SRLEKDRNYNYFWVRC KLI VTLFAVH AGCFYYL+AARYHNP RTWIG SLG NFLE+
Sbjct: 184 SRLEKDRNYNYFWVRCAKLICVTLFAVHSAGCFYYLIAARYHNPGRTWIGQSLGDNFLEQ 243

Query: 246 SLWIRYVTSMYWSITTLTTVGYGDLHPVNTREMVFDILFMLFNLGLTAYLIGNMTNLVVH 305
           SLWIRYVTS+YWSITTLTTVGYGDLHPVNTREM+FDI +MLFNLGLTAYLIGNMTNLVVH
Sbjct: 244 SLWIRYVTSIYWSITTLTTVGYGDLHPVNTREMIFDIFYMLFNLGLTAYLIGNMTNLVVH 303

Query: 306 GTSRTRKFRDTIQAASSFAQRNQLPIRLQDQMLAHLCLKFRTDSEGLQQQETLDSLPKAI 365
           GTSRTR+FRDTIQAASSFAQRNQLP+RLQDQMLAHLCLKFRTDSEGLQQQETLDSLPKAI
Sbjct: 304 GTSRTRRFRDTIQAASSFAQRNQLPLRLQDQMLAHLCLKFRTDSEGLQQQETLDSLPKAI 363

Query: 366 RSSISHYLFYSLMDKVYLFRGVSNDLLFQLVSEMKAEYFPPKEDVILQNEAPTDFYILVT 425
           RSSISHYLFYSL+DKVYLF GVSNDLLFQLVSEMKAEYFPPKEDVILQNEAPTDFYILVT
Sbjct: 364 RSSISHYLFYSLLDKVYLFSGVSNDLLFQLVSEMKAEYFPPKEDVILQNEAPTDFYILVT 423

Query: 426 GAVDLLVLKNGVEQVVGEAKTGEICGEIGVLCYRPQLFTVRTKRLSQLLRLNRTTFLNIV 485
           GAVDLLV KNG EQVVG+AKTG++CGEIGVLCYRPQLFTVRTKRLSQLLRLNRTTFLNIV
Sbjct: 424 GAVDLLVYKNGAEQVVGQAKTGDLCGEIGVLCYRPQLFTVRTKRLSQLLRLNRTTFLNIV 483

Query: 486 QANVGDGTIIMNNLLQHLKDLKDPIMEGVLLETENMLARGRMDLPLSLCFAALRGDDLLL 545
           QAN+GDGTIIMNNLLQHLK+ KDPIMEGVL+ETEN LARGR+DLPLSLCFAALRGDD LL
Sbjct: 484 QANIGDGTIIMNNLLQHLKEQKDPIMEGVLVETENTLARGRLDLPLSLCFAALRGDDSLL 543

Query: 546 HQLLKRGLDPNESDNNGRTALHIAASKGSENCVLLLLDYEADPNSIDSDGNVPLWEAMLG 605
           HQLLKRGLDPNESDN GR+ALHIAASKGSENCVL+LLDY ADPNS DS+GNVPLWEAM+G
Sbjct: 544 HQLLKRGLDPNESDNTGRSALHIAASKGSENCVLVLLDYGADPNSKDSEGNVPLWEAMVG 603

Query: 606 GHENVIKLLMENHADINSGDVGHFACTAAEQNNLELLKEIVCYGGDVTRQRNNGSTALHV 665
           GHE V KLLMEN A+I SGDVGHFACTAAEQNNL LLKEI   GGDVT  R NG+TALHV
Sbjct: 604 GHEGVTKLLMENGANIQSGDVGHFACTAAEQNNLNLLKEIARLGGDVTCPRKNGTTALHV 663

Query: 666 AVCEDNVEIVRFLLDQKADVDKPDVHGWTPRDLADQQGHEEIKCIFQSCKETKAQSIISV 725
           AVCEDN EIVR+LLDQ A +DKPD+HGWTPRDLADQQGHEEIK IF++CKE K ++++S+
Sbjct: 664 AVCEDNTEIVRYLLDQGAKIDKPDIHGWTPRDLADQQGHEEIKFIFETCKEPKTETVVSI 723

Query: 726 AERPQQE-VHYLGRFTSEPAIRPITHEVSFEGVDG-SGSQNHSRRRTNNFHNSLFGIMSA 783
            E+PQ   + +LGRFTSEP IRP++ + SF G D  S SQN  RRRTNNFHNSLFG+MSA
Sbjct: 724 PEKPQPPGIRFLGRFTSEPNIRPLSRDGSFTGTDDRSWSQNRPRRRTNNFHNSLFGMMSA 783

Query: 784 AHNVEKDILFPPQHTKVFKAPGINSARVTIGCPEKGEVAGKLVLLPSTFQELLDIGEKKF 843
           AH  EK++ FP   +      G N ARV I CPEK E+AGKLVLLP   QEL++IG KKF
Sbjct: 784 AHKGEKELPFPVTPSIGVDNYGTNPARVVISCPEKVEIAGKLVLLPRNLQELVEIGSKKF 843

Query: 844 GISPAKVLNKGGAEVEDIEVIRDGDHLVFVSDGGQNTSNQ 883
           G+S AKVLNK  AE++DIEVIRDGDH++FVSD  +  + Q
Sbjct: 844 GLSHAKVLNKDRAEIDDIEVIRDGDHILFVSDRTKEINRQ 883




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|282161430|gb|ADA79674.1| shaker-like potassium channel 1 [Populus euphratica] Back     alignment and taxonomy information
>gi|449464346|ref|XP_004149890.1| PREDICTED: potassium channel AKT1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|225445408|ref|XP_002281787.1| PREDICTED: potassium channel AKT1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|297738905|emb|CBI28150.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|262316884|emb|CAZ64538.1| inward rectifying shaker-like K+ channel [Vitis vinifera] Back     alignment and taxonomy information
>gi|282161432|gb|ADA79675.1| shaker-like potassium channel 2 [Populus euphratica] Back     alignment and taxonomy information
>gi|224114381|ref|XP_002332383.1| predicted protein [Populus trichocarpa] gi|222832207|gb|EEE70684.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224088071|ref|XP_002308313.1| predicted protein [Populus trichocarpa] gi|222854289|gb|EEE91836.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147861116|emb|CAN80462.1| hypothetical protein VITISV_015412 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query883
TAIR|locus:2043839857 KT1 "AT2G26650" [Arabidopsis t 0.956 0.985 0.702 0.0
TAIR|locus:2127866880 KT5 "K+ transporter 5" [Arabid 0.951 0.954 0.616 3.5e-281
TAIR|locus:2170468677 KAT1 "potassium channel in Ara 0.530 0.691 0.634 5.2e-175
TAIR|locus:2005531697 KAT2 "potassium channel in Ara 0.562 0.713 0.602 1.2e-173
TAIR|locus:2132065802 KT2/3 "potassium transport 2/3 0.773 0.851 0.466 1e-167
TAIR|locus:2005524662 KAT3 "AT4G32650" [Arabidopsis 0.542 0.723 0.502 2.9e-131
TAIR|locus:2169866820 GORK "gated outwardly-rectifyi 0.755 0.813 0.358 1.7e-107
TAIR|locus:2075442828 SKOR "STELAR K+ outward rectif 0.762 0.812 0.336 4.5e-105
FB|FBgn0263257 1853 cngl "CNG channel-like" [Droso 0.502 0.239 0.261 9.5e-29
RGD|620304950 Kcnh6 "potassium voltage-gated 0.473 0.44 0.252 5e-26
TAIR|locus:2043839 KT1 "AT2G26650" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 3167 (1119.9 bits), Expect = 0., P = 0.
 Identities = 608/865 (70%), Positives = 714/865 (82%)

Query:    16 VCGQ--EEIEQLSRDGSHYSLSTGVLPSLGARSNRRVKLRRFIVSPYDRRYRVWETYLVL 73
             +CGQ  +EIEQLSR+ SH+SLSTG+LPSLGARSNRRVKLRRF+VSPYD +YR+WE +LV+
Sbjct:     7 LCGQVQDEIEQLSRESSHFSLSTGILPSLGARSNRRVKLRRFVVSPYDHKYRIWEAFLVV 66

Query:    74 LVIYTAWASPFEFGFLRKPQRPLSVIDNVVNGFFAVDIILTFFVAYLDKATYLLVDCPKQ 133
             LV+YTAW SPFEFGFLRKP+ PLS+ DN+VN FFA+DII+TFFV YLDK+TYL+VD  KQ
Sbjct:    67 LVVYTAWVSPFEFGFLRKPRPPLSITDNIVNAFFAIDIIMTFFVGYLDKSTYLIVDDRKQ 126

Query:   134 IAWKYASSWLVFDVISTIPSELAQKISPKPLQSYGLFNMLRLWRLRRVSALFSRLEKDRN 193
             IA+KY  SW + D++STIPSE A +IS    QSYGLFNMLRLWRLRRV ALF+RLEKDRN
Sbjct:   127 IAFKYLRSWFLLDLVSTIPSEAAMRISS---QSYGLFNMLRLWRLRRVGALFARLEKDRN 183

Query:   194 YNYFWVRCCKLIFVTLFAVHCAGCFYYLLAARYHNPERTWIGASLGQNFLEKSLWIRYVT 253
             +NYFWVRC KL+ VTLFAVHCA CFYYL+AAR  NP +TWIGA++  NFLE+SLW+RYVT
Sbjct:   184 FNYFWVRCAKLVCVTLFAVHCAACFYYLIAARNSNPAKTWIGANVA-NFLEESLWMRYVT 242

Query:   254 SMYWSITTLTTVGYGDLHPVNTREMVFDILFMLFNLGLTAYLIGNMTNLVVHGTSRTRKF 313
             SMYWSITTLTTVGYGDLHPVNT+EM+FDI +MLFNLGLTAYLIGNMTNLVVHGTSRTR F
Sbjct:   243 SMYWSITTLTTVGYGDLHPVNTKEMIFDIFYMLFNLGLTAYLIGNMTNLVVHGTSRTRNF 302

Query:   314 RDTIQAASSFAQRNQLPIRLQDQMLAHLCLKFRTDSEGLQQQETLDSLPKAIRSSISHYL 373
             RDTIQAAS+FA RN LP RLQDQMLAHLCLK+RTDSEGLQQQETLD+LPKAIRSSISH+L
Sbjct:   303 RDTIQAASNFAHRNHLPPRLQDQMLAHLCLKYRTDSEGLQQQETLDALPKAIRSSISHFL 362

Query:   374 FYSLMDKVYLFRGVSNDLLFQLVSEMKAEYFPPKEDVILQNEAPTDFYILVTGAVDLLVL 433
             FYSLMDKVYLFRGVSNDLLFQLVSEMKAEYFPPKEDVILQNEAPTDFYILV G  DL+ +
Sbjct:   363 FYSLMDKVYLFRGVSNDLLFQLVSEMKAEYFPPKEDVILQNEAPTDFYILVNGTADLVDV 422

Query:   434 KNGVEQVVGEAKTGEICGEIGVLCYRPQLFTVRTKRLSQLLRLNRTTFLNIVQANVGDGT 493
               G E +V E K G+I GEIGVLCYRPQLFTVRTKRL QLLR+NRTTFLNI+QANVGDGT
Sbjct:   423 DTGTESIVREVKAGDIIGEIGVLCYRPQLFTVRTKRLCQLLRMNRTTFLNIIQANVGDGT 482

Query:   494 IIMNNLLQHLKDLKDPIMEGVLLETENMLARGRMDLPLSLCFAAXXXXXXXXXXXXXXXX 553
             IIMNNLLQHLK++ DP+M  VLLE ENMLARG+MDLPL+LCFAA                
Sbjct:   483 IIMNNLLQHLKEMNDPVMTNVLLEIENMLARGKMDLPLNLCFAAIREDDLLLHQLLKRGL 542

Query:   554 XPNESDNNGRTALHIAASKGSENCVLLLLDYEADPNSIDSDGNVPLWEAMLGGHENVIKL 613
              PNESDNNGRT LHIAASKG+ NCVLLLL+Y ADPN  D++G+VPLWEAM+ GHE V+K+
Sbjct:   543 DPNESDNNGRTPLHIAASKGTLNCVLLLLEYHADPNCRDAEGSVPLWEAMVEGHEKVVKV 602

Query:   614 LMENHADINSGDVGHFACTAAEQNNLELLKEIVCYGGDVTRQRNNGSTALHVAVCEDNVE 673
             L+E+ + I++GDVGHFACTAAEQ NL+LLKEIV +GGDVTR R  G++ALH AVCE+N+E
Sbjct:   603 LLEHGSTIDAGDVGHFACTAAEQGNLKLLKEIVLHGGDVTRPRATGTSALHTAVCEENIE 662

Query:   674 IVRFLLDQKADVDKPDVHGWTPRDLADQQGHEEIKCIFQSCKETKAQSIISVAERP--QQ 731
             +V++LL+Q ADV+K D+HGWTPRDLA+QQGHE+IK +F+     +   I + +  P  + 
Sbjct:   663 MVKYLLEQGADVNKQDMHGWTPRDLAEQQGHEDIKALFREKLHERRVHIETSSSVPILKT 722

Query:   732 EVHYLGRFTSEPAIRPITHEVSFEGVDGSGSQNHSRRRTNNFHNSLFGIMSAAHNVEKDI 791
              + +LGRFTSEP IRP + EVSF        +  +RR+TNNF NSLFGI+ A  +V K+ 
Sbjct:   723 GIRFLGRFTSEPNIRPASREVSFRI-----RETRARRKTNNFDNSLFGIL-ANQSVPKNG 776

Query:   792 LFPPQHTKVFKAPGINSARVTIGCPEKGEVAGKLVLLPSTFQELLDIGEKKFGISPAKVL 851
             L      +     G N  RVTI C EK ++AGKLVLLP +F+ELL++G  KFGI   KV+
Sbjct:   777 LATVDEGRT----G-NPVRVTISCAEKDDIAGKLVLLPGSFKELLELGSNKFGIVATKVM 831

Query:   852 NK-GGAEVEDIEVIRDGDHLVFVSD 875
             NK   AE++D++VIRDGDHL+F +D
Sbjct:   832 NKDNNAEIDDVDVIRDGDHLIFATD 856




GO:0005242 "inward rectifier potassium channel activity" evidence=ISS;IDA
GO:0016020 "membrane" evidence=IEA
GO:0030551 "cyclic nucleotide binding" evidence=ISS
GO:0005886 "plasma membrane" evidence=TAS
GO:0048767 "root hair elongation" evidence=RCA;IMP
GO:0005515 "protein binding" evidence=IPI
GO:0042802 "identical protein binding" evidence=IPI
GO:0009651 "response to salt stress" evidence=IMP
GO:0006813 "potassium ion transport" evidence=IC;IMP
GO:0009414 "response to water deprivation" evidence=IMP
GO:0090333 "regulation of stomatal closure" evidence=IMP
GO:0000041 "transition metal ion transport" evidence=RCA
GO:0006826 "iron ion transport" evidence=RCA
GO:0007155 "cell adhesion" evidence=RCA
GO:0010014 "meristem initiation" evidence=RCA
GO:0010090 "trichome morphogenesis" evidence=RCA
GO:0010106 "cellular response to iron ion starvation" evidence=RCA
GO:0010167 "response to nitrate" evidence=RCA
GO:0015706 "nitrate transport" evidence=RCA
GO:0016049 "cell growth" evidence=RCA
GO:0045010 "actin nucleation" evidence=RCA
GO:0045595 "regulation of cell differentiation" evidence=RCA
GO:0048589 "developmental growth" evidence=RCA
GO:0048765 "root hair cell differentiation" evidence=RCA
GO:0071555 "cell wall organization" evidence=RCA
GO:0010107 "potassium ion import" evidence=IDA
TAIR|locus:2127866 KT5 "K+ transporter 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2170468 KAT1 "potassium channel in Arabidopsis thaliana 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2005531 KAT2 "potassium channel in Arabidopsis thaliana 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2132065 KT2/3 "potassium transport 2/3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2005524 KAT3 "AT4G32650" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2169866 GORK "gated outwardly-rectifying K+ channel" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2075442 SKOR "STELAR K+ outward rectifier" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
FB|FBgn0263257 cngl "CNG channel-like" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
RGD|620304 Kcnh6 "potassium voltage-gated channel, subfamily H (eag-related), member 6" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P0C550AKT1_ORYSINo assigned EC number0.64700.96140.9080N/Ano
Q0JKV1AKT1_ORYSJNo assigned EC number0.64590.96140.9080yesno
Q38998AKT1_ARATHNo assigned EC number0.72020.95690.9859yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query883
PLN03192823 PLN03192, PLN03192, Voltage-dependent potassium ch 0.0
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 4e-32
pfam1183469 pfam11834, DUF3354, Domain of unknown function (DU 1e-31
pfam00520194 pfam00520, Ion_trans, Ion transport protein 2e-30
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 5e-28
cd00038115 cd00038, CAP_ED, effector domain of the CAP family 6e-24
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 2e-21
smart00100120 smart00100, cNMP, Cyclic nucleotide-monophosphate 3e-20
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 7e-19
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 1e-14
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 2e-14
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 2e-14
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 1e-13
pfam0002791 pfam00027, cNMP_binding, Cyclic nucleotide-binding 4e-13
COG0664214 COG0664, Crp, cAMP-binding proteins - catabolite g 1e-12
pfam0788574 pfam07885, Ion_trans_2, Ion channel 1e-12
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 9e-12
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 1e-11
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 1e-11
PHA03095 471 PHA03095, PHA03095, ankyrin-like protein; Provisio 5e-11
PHA02876 682 PHA02876, PHA02876, ankyrin repeat protein; Provis 9e-11
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 1e-10
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 1e-10
PHA02946446 PHA02946, PHA02946, ankyin-like protein; Provision 1e-10
PHA02878477 PHA02878, PHA02878, ankyrin repeat protein; Provis 2e-10
PHA02876682 PHA02876, PHA02876, ankyrin repeat protein; Provis 8e-10
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 5e-09
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 7e-09
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 2e-08
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 2e-08
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 3e-08
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 4e-08
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 5e-08
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 9e-08
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 1e-07
pfam0002333 pfam00023, Ank, Ankyrin repeat 2e-07
pfam0002333 pfam00023, Ank, Ankyrin repeat 2e-07
PHA02876682 PHA02876, PHA02876, ankyrin repeat protein; Provis 5e-07
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 8e-07
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 2e-06
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 2e-06
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 2e-06
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 2e-06
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 8e-06
PHA03095 471 PHA03095, PHA03095, ankyrin-like protein; Provisio 1e-05
smart0024830 smart00248, ANK, ankyrin repeats 2e-05
smart0024830 smart00248, ANK, ankyrin repeats 2e-05
PHA02798 489 PHA02798, PHA02798, ankyrin-like protein; Provisio 3e-05
PHA02878477 PHA02878, PHA02878, ankyrin repeat protein; Provis 1e-04
PHA02859209 PHA02859, PHA02859, ankyrin repeat protein; Provis 2e-04
TIGR00870 743 TIGR00870, trp, transient-receptor-potential calci 2e-04
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 3e-04
pfam0002333 pfam00023, Ank, Ankyrin repeat 4e-04
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 5e-04
pfam1360630 pfam13606, Ank_3, Ankyrin repeat 0.002
pfam1360630 pfam13606, Ank_3, Ankyrin repeat 0.002
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 0.003
PRK10537393 PRK10537, PRK10537, voltage-gated potassium channe 0.004
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
 Score =  760 bits (1963), Expect = 0.0
 Identities = 384/851 (45%), Positives = 519/851 (60%), Gaps = 68/851 (7%)

Query: 33  SLSTGVLPSLG--ARSNRRVKLRRFIVSPYDRRYRVWETYLVLLVIYTAWASPFEFGFLR 90
           +LS  +LP LG  + +   +    +I+SP D RYR WET +V+LV Y+AW  PFE  FL 
Sbjct: 28  NLSKVILPPLGVPSYNQNHIGSDGWIISPMDSRYRWWETLMVVLVAYSAWVYPFEVAFLN 87

Query: 91  -KPQRPLSVIDNVVNGFFAVDIILTFFVAYLDKATYLLVDCPKQIAWKYASSWLVFDVIS 149
             P+R L + DNVV+ FFAVDI+LTFFVAY+D  T LLV   K+IA +Y S+W + DV S
Sbjct: 88  ASPKRGLEIADNVVDLFFAVDIVLTFFVAYIDPRTQLLVRDRKKIAVRYLSTWFLMDVAS 147

Query: 150 TIPSE-LAQKISPKPLQ--SYGLFNMLRLWRLRRVSALFSRLEKDRNYNYFWVRCCKLIF 206
           TIP + LA  I+       SY L  +LR WRLRRV  LF+RLEKD  ++YFW+RC +L+ 
Sbjct: 148 TIPFQALAYLITGTVKLNLSYSLLGLLRFWRLRRVKQLFTRLEKDIRFSYFWIRCARLLS 207

Query: 207 VTLFAVHCAGCFYYLLAARYHNPERTWIGASLGQNFLEKSLWIRYVTSMYWSITTLTTVG 266
           VTLF VHCAGC YYL+A RY +  +TWIGA +  NF E SLWIRY++++YWSITT+TTVG
Sbjct: 208 VTLFLVHCAGCLYYLIADRYPHQGKTWIGAVI-PNFRETSLWIRYISAIYWSITTMTTVG 266

Query: 267 YGDLHPVNTREMVFDILFMLFNLGLTAYLIGNMTNLVVHGTSRTRKFRDTIQAASSFAQR 326
           YGDLH VNT EM+F I +MLFNLGLTAYLIGNMTNLVV GT RT +FR++I+AAS+F  R
Sbjct: 267 YGDLHAVNTIEMIFIIFYMLFNLGLTAYLIGNMTNLVVEGTRRTMEFRNSIEAASNFVGR 326

Query: 327 NQLPIRLQDQMLAHLCLKFRTDSEGLQQQETLDSLPKAIRSSISHYLFYSLMDKVYLFRG 386
           N+LP RL+DQ+LA++CL+F+  +E L QQ+ +D LPK+I  SI  +LF  +++KVYLF+G
Sbjct: 327 NRLPPRLKDQILAYMCLRFK--AESLNQQQLIDQLPKSICKSICQHLFLPVVEKVYLFKG 384

Query: 387 VSNDLLFQLVSEMKAEYFPPKEDVILQNEAPTDFYILVTGAVDLLVLKNGVEQVVGEAKT 446
           VS ++L  LV++MKAEY PP+EDVI+QNEAP D YI+V+G V+++  +   E+VVG    
Sbjct: 385 VSREILLLLVTKMKAEYIPPREDVIMQNEAPDDVYIVVSGEVEIIDSEGEKERVVGTLGC 444

Query: 447 GEICGEIGVLCYRPQLFTVRTKRLSQLLRLNRTTFLNIVQANVGDGTIIMNNLLQHLKDL 506
           G+I GE+G LC RPQ FT RTK LSQLLRL  +T +  +Q    D  +I+ N LQH K+L
Sbjct: 445 GDIFGEVGALCCRPQSFTFRTKTLSQLLRLKTSTLIEAMQTRQEDNVVILKNFLQHHKEL 504

Query: 507 KDPIMEGVLLETENMLARGRMDLPLSLCFAALRGDDLLLHQLLKRGLDPNESDNNGRTAL 566
            D  +    L  +N       ++  +L   A  G+  LL +LLK  LDP+  D+ GRT L
Sbjct: 505 HD--LNVGDLLGDNGGEHDDPNMASNLLTVASTGNAALLEELLKAKLDPDIGDSKGRTPL 562

Query: 567 HIAASKGSENCVLLLLDYEADPNSIDSDGNVPLWEAMLGGHENVIKLLMENHADINSGDV 626
           HIAASKG E+CVL+LL +  + +  D++GN  LW A+   H  + ++L    +  +    
Sbjct: 563 HIAASKGYEDCVLVLLKHACNVHIRDANGNTALWNAISAKHHKIFRILYHFASISDPHAA 622

Query: 627 GHFACTAAEQNNLELLKEIVCYGGDVTRQRNNGSTALHVAVCEDNVEIVRFLLDQKADVD 686
           G   CTAA++N+L  +KE++  G +V  + + G+TAL VA+ ED+V++VR L+   ADVD
Sbjct: 623 GDLLCTAAKRNDLTAMKELLKQGLNVDSEDHQGATALQVAMAEDHVDMVRLLIMNGADVD 682

Query: 687 KPDVHGWTPRDLADQQGHEEIKCIFQSCKETKAQSIISVAERPQQEVHYLGRFTSEPAIR 746
           K +          D     E++ + Q  K     SI  V   P  E        S P   
Sbjct: 683 KANTD--------DDFSPTELRELLQ--KRELGHSITIVDSVPADEPDLGRDGGSRP--- 729

Query: 747 PITHEVSFEGVDGSGSQNHSRRRTNNFHNSLFGIMSAAHNVEKDILFPPQHTKVFKAPGI 806
                     + G+ S N  R R +                            ++K  G 
Sbjct: 730 --------GRLQGTSSDNQCRPRVS----------------------------IYK--GH 751

Query: 807 NSARVTIGCPEKGEVAGKLVLLPSTFQELLDIGEKKFGISPAKVL--NKGGAEVEDIEVI 864
              R    C E    AGKL+ LP + +EL  I  +K G    K +  N+ GAE++ IEVI
Sbjct: 752 PLLRNERCCNE----AGKLINLPPSLEELKAIAGEKLGFDARKAMVTNEEGAEIDSIEVI 807

Query: 865 RDGDHLVFVSD 875
           RD D L  V D
Sbjct: 808 RDNDKLFVVED 818


Length = 823

>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|221253 pfam11834, DUF3354, Domain of unknown function (DUF3354) Back     alignment and domain information
>gnl|CDD|215968 pfam00520, Ion_trans, Ion transport protein Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|237999 cd00038, CAP_ED, effector domain of the CAP family of transcription factors; members include CAP (or cAMP receptor protein (CRP)), which binds cAMP, FNR (fumarate and nitrate reduction), which uses an iron-sulfur cluster to sense oxygen) and CooA, a heme containing CO sensor Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|197516 smart00100, cNMP, Cyclic nucleotide-monophosphate binding domain Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|215664 pfam00027, cNMP_binding, Cyclic nucleotide-binding domain Back     alignment and domain information
>gnl|CDD|223736 COG0664, Crp, cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|219619 pfam07885, Ion_trans_2, Ion channel Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165256 PHA02946, PHA02946, ankyin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|222931 PHA02798, PHA02798, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165195 PHA02859, PHA02859, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|233161 TIGR00870, trp, transient-receptor-potential calcium channel protein Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|205784 pfam13606, Ank_3, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|205784 pfam13606, Ank_3, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|236711 PRK10537, PRK10537, voltage-gated potassium channel; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 883
PLN03192823 Voltage-dependent potassium channel; Provisional 100.0
KOG0498727 consensus K+-channel ERG and related proteins, con 100.0
KOG0500536 consensus Cyclic nucleotide-gated cation channel C 100.0
KOG0501971 consensus K+-channel KCNQ [Inorganic ion transport 100.0
KOG0499815 consensus Cyclic nucleotide-gated cation channel C 100.0
KOG3713477 consensus Voltage-gated K+ channel KCNB/KCNC [Inor 100.0
KOG4412226 consensus 26S proteasome regulatory complex, subun 100.0
KOG4412226 consensus 26S proteasome regulatory complex, subun 99.98
PHA02791284 ankyrin-like protein; Provisional 99.97
PHA02791284 ankyrin-like protein; Provisional 99.96
PHA03100480 ankyrin repeat protein; Provisional 99.96
PHA02878477 ankyrin repeat protein; Provisional 99.96
KOG0509 600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.96
PHA02875413 ankyrin repeat protein; Provisional 99.96
PHA02946446 ankyin-like protein; Provisional 99.96
KOG0509 600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.96
PHA02874434 ankyrin repeat protein; Provisional 99.96
PHA02875413 ankyrin repeat protein; Provisional 99.96
KOG1545507 consensus Voltage-gated shaker-like K+ channel KCN 99.96
PHA02946446 ankyin-like protein; Provisional 99.95
PHA02798489 ankyrin-like protein; Provisional 99.95
PHA03100480 ankyrin repeat protein; Provisional 99.95
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 99.95
PHA02878477 ankyrin repeat protein; Provisional 99.95
PHA03095471 ankyrin-like protein; Provisional 99.95
KOG0508 615 consensus Ankyrin repeat protein [General function 99.95
PHA02874434 ankyrin repeat protein; Provisional 99.95
PHA02795437 ankyrin-like protein; Provisional 99.95
PHA02859209 ankyrin repeat protein; Provisional 99.94
KOG4390632 consensus Voltage-gated A-type K+ channel KCND [In 99.94
PHA02989494 ankyrin repeat protein; Provisional 99.94
PHA02716764 CPXV016; CPX019; EVM010; Provisional 99.94
PHA03095471 ankyrin-like protein; Provisional 99.94
PF1183469 DUF3354: Domain of unknown function (DUF3354); Int 99.94
PHA02876682 ankyrin repeat protein; Provisional 99.94
PHA02876 682 ankyrin repeat protein; Provisional 99.93
KOG0510 929 consensus Ankyrin repeat protein [General function 99.93
KOG0510 929 consensus Ankyrin repeat protein [General function 99.93
PHA02798489 ankyrin-like protein; Provisional 99.93
PHA02989494 ankyrin repeat protein; Provisional 99.93
KOG0508 615 consensus Ankyrin repeat protein [General function 99.93
PLN03192823 Voltage-dependent potassium channel; Provisional 99.93
PHA02917 661 ankyrin-like protein; Provisional 99.92
PHA02730 672 ankyrin-like protein; Provisional 99.91
PHA02917 661 ankyrin-like protein; Provisional 99.9
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 99.9
PHA02859209 ankyrin repeat protein; Provisional 99.89
PHA02792631 ankyrin-like protein; Provisional 99.88
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 99.88
PHA02730672 ankyrin-like protein; Provisional 99.88
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.88
PHA02795437 ankyrin-like protein; Provisional 99.87
PHA02792631 ankyrin-like protein; Provisional 99.87
KOG0505 527 consensus Myosin phosphatase, regulatory subunit [ 99.86
KOG0514452 consensus Ankyrin repeat protein [General function 99.84
KOG1419654 consensus Voltage-gated K+ channel KCNQ [Inorganic 99.84
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.84
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.84
PHA02741169 hypothetical protein; Provisional 99.83
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.83
KOG0505527 consensus Myosin phosphatase, regulatory subunit [ 99.83
PHA02743166 Viral ankyrin protein; Provisional 99.83
PHA02884300 ankyrin repeat protein; Provisional 99.82
PHA02741169 hypothetical protein; Provisional 99.82
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.81
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.81
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.8
PHA02736154 Viral ankyrin protein; Provisional 99.79
PHA02736154 Viral ankyrin protein; Provisional 99.78
PHA02884300 ankyrin repeat protein; Provisional 99.78
KOG0514452 consensus Ankyrin repeat protein [General function 99.77
PHA02743166 Viral ankyrin protein; Provisional 99.77
KOG0195 448 consensus Integrin-linked kinase [Signal transduct 99.72
KOG0195448 consensus Integrin-linked kinase [Signal transduct 99.71
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.69
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.68
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 99.68
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 99.66
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.64
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 99.63
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.62
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.58
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 99.54
PRK09392236 ftrB transcriptional activator FtrB; Provisional 99.54
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.52
PF00520200 Ion_trans: Ion transport protein calcium channel s 99.52
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.49
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.45
KOG1420 1103 consensus Ca2+-activated K+ channel Slowpoke, alph 99.45
cd00038115 CAP_ED effector domain of the CAP family of transc 99.43
PRK11753211 DNA-binding transcriptional dual regulator Crp; Pr 99.42
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.39
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.38
PF0002791 cNMP_binding: Cyclic nucleotide-binding domain; In 99.36
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.36
KOG1113368 consensus cAMP-dependent protein kinase types I an 99.36
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.35
KOG1710396 consensus MYND Zn-finger and ankyrin repeat protei 99.35
smart00100120 cNMP Cyclic nucleotide-monophosphate binding domai 99.33
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.32
PF0788579 Ion_trans_2: Ion channel; InterPro: IPR013099 This 99.31
PRK10402226 DNA-binding transcriptional activator YeiL; Provis 99.31
COG0664214 Crp cAMP-binding proteins - catabolite gene activa 99.31
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.3
KOG1710396 consensus MYND Zn-finger and ankyrin repeat protei 99.3
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.29
COG2905610 Predicted signal-transduction protein containing c 99.29
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.26
KOG0614732 consensus cGMP-dependent protein kinase [Signal tr 99.25
PRK11161235 fumarate/nitrate reduction transcriptional regulat 99.23
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.22
KOG0614732 consensus cGMP-dependent protein kinase [Signal tr 99.21
PLN02868413 acyl-CoA thioesterase family protein 99.13
TIGR03697193 NtcA_cyano global nitrogen regulator NtcA, cyanoba 99.11
PRK09391230 fixK transcriptional regulator FixK; Provisional 99.05
PRK13918202 CRP/FNR family transcriptional regulator; Provisio 98.98
KOG1113368 consensus cAMP-dependent protein kinase types I an 98.96
PRK10537393 voltage-gated potassium channel; Provisional 98.95
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 98.86
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 98.85
KOG0818 669 consensus GTPase-activating proteins of the GIT fa 98.77
KOG0818 669 consensus GTPase-activating proteins of the GIT fa 98.66
PF1360630 Ank_3: Ankyrin repeat 98.65
KOG3684489 consensus Ca2+-activated K+ channel proteins (inte 98.65
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.64
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.6
PF1360630 Ank_3: Ankyrin repeat 98.6
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.56
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.54
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.51
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.51
KOG0522 560 consensus Ankyrin repeat protein [General function 98.49
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.48
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.41
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 98.34
KOG0522 560 consensus Ankyrin repeat protein [General function 98.31
KOG0520975 consensus Uncharacterized conserved protein, conta 98.19
KOG2968 1158 consensus Predicted esterase of the alpha-beta hyd 98.18
KOG0511 516 consensus Ankyrin repeat protein [General function 98.13
KOG2384223 consensus Major histocompatibility complex protein 98.13
PF0841277 Ion_trans_N: Ion transport protein N-terminal; Int 98.13
KOG0520 975 consensus Uncharacterized conserved protein, conta 98.09
KOG0521785 consensus Putative GTPase activating proteins (GAP 98.07
PF01007336 IRK: Inward rectifier potassium channel; InterPro: 98.02
KOG2384223 consensus Major histocompatibility complex protein 97.97
KOG0521785 consensus Putative GTPase activating proteins (GAP 97.94
KOG23021956 consensus T-type voltage-gated Ca2+ channel, pore- 97.92
KOG0511 516 consensus Ankyrin repeat protein [General function 97.9
KOG4404350 consensus Tandem pore domain K+ channel TASK3/THIK 97.87
KOG1418433 consensus Tandem pore domain K+ channel [Inorganic 97.86
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 97.8
KOG3193 1087 consensus K+ channel subunit [Inorganic ion transp 97.45
PLN032231634 Polycystin cation channel protein; Provisional 97.38
KOG2968 1158 consensus Predicted esterase of the alpha-beta hyd 97.27
KOG4404350 consensus Tandem pore domain K+ channel TASK3/THIK 96.98
PRK11832207 putative DNA-binding transcriptional regulator; Pr 96.94
KOG3827400 consensus Inward rectifier K+ channel [Inorganic i 96.78
KOG2505591 consensus Ankyrin repeat protein [General function 96.76
KOG2505591 consensus Ankyrin repeat protein [General function 96.7
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 96.42
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 96.15
KOG2301 1592 consensus Voltage-gated Ca2+ channels, alpha1 subu 96.08
PF04831153 Popeye: Popeye protein conserved region; InterPro: 95.87
KOG36141381 consensus Ca2+/Mg2+-permeable cation channels (LTR 95.85
KOG1418433 consensus Tandem pore domain K+ channel [Inorganic 95.71
PF0360760 DCX: Doublecortin; InterPro: IPR003533 X-linked li 95.06
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 94.7
KOG23011592 consensus Voltage-gated Ca2+ channels, alpha1 subu 94.7
KOG3542 1283 consensus cAMP-regulated guanine nucleotide exchan 94.67
PF0201778 CIDE-N: CIDE-N domain; InterPro: IPR003508 This do 94.63
cd0161578 CIDE_N CIDE_N domain, found at the N-terminus of t 94.43
KOG3599798 consensus Ca2+-modulated nonselective cation chann 94.36
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 94.05
smart0026674 CAD Domains present in proteins implicated in post 93.91
cd0653879 CIDE_N_FSP27 CIDE_N domain of FSP27 proteins. The 93.75
cd0653978 CIDE_N_A CIDE_N domain of CIDE-A proteins. The CID 93.36
KOG0498727 consensus K+-channel ERG and related proteins, con 93.33
smart0053789 DCX Domain in the Doublecortin (DCX) gene product. 93.02
cd0653577 CIDE_N_CAD CIDE_N domain of CAD nuclease. The CIDE 92.79
cd0653781 CIDE_N_B CIDE_N domain of CIDE-B proteins. The CID 92.61
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 92.53
cd0653680 CIDE_N_ICAD CIDE_N domain of ICAD. The CIDE_N (cel 91.98
PF00520200 Ion_trans: Ion transport protein calcium channel s 90.73
PF00060148 Lig_chan: Ligand-gated ion channel; InterPro: IPR0 90.0
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 88.72
PF08016425 PKD_channel: Polycystin cation channel; InterPro: 88.72
KOG23021956 consensus T-type voltage-gated Ca2+ channel, pore- 86.35
cd0161780 DCX Ubiquitin-like domain of DCX. DCX The ubiquiti 83.26
KOG3542 1283 consensus cAMP-regulated guanine nucleotide exchan 81.18
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
Probab=100.00  E-value=6.3e-127  Score=1162.22  Aligned_cols=779  Identities=48%  Similarity=0.811  Sum_probs=691.4

Q ss_pred             ccccCCCCCCCCccc--cccccccCCeEECCCChhHHHHHHHHHHHHHHHHHHhhhhhccccC-CCCCceehhhHhHHHH
Q 002763           31 HYSLSTGVLPSLGAR--SNRRVKLRRFIVSPYDRRYRVWETYLVLLVIYTAWASPFEFGFLRK-PQRPLSVIDNVVNGFF  107 (883)
Q Consensus        31 ~~~~~~~~~~~~~~~--~~~~~~~~~~ii~P~s~~~~~w~~~~~~~~~~~~~~~p~~~~f~~~-~~~~~~~i~~~~~~~F  107 (883)
                      .-+.+.+++|++|.+  .+++.+.++|+|+|+++++++|+++++++++|++|++||+++|... ....++++|++++++|
T Consensus        26 ~~~~~~~~~~~~~~~~~~~~~~~~~~~ii~P~~~~~~~Wd~~~~~~~~y~~~~~p~~~~F~~~~~~~~~~~~d~i~~~~F  105 (823)
T PLN03192         26 LRNLSKVILPPLGVPSYNQNHIGSDGWIISPMDSRYRWWETLMVVLVAYSAWVYPFEVAFLNASPKRGLEIADNVVDLFF  105 (823)
T ss_pred             hhhcchhhccccCCCccccCccccCCeEECCCCcHHHHHHHHHHHHHHHHHHHHHHHHHeeCCCCCCCeeeHHHHHHHHH
Confidence            445778999999987  5778889999999999999999999999999999999999999654 3446889999999999


Q ss_pred             HHhhheeeeEEEEeCCeeEEEeCHHHHHHHHhhhhhHHHHHhccchhhhhhhCCCc---chhhhHHHHHHHHHHHHHHHH
Q 002763          108 AVDIILTFFVAYLDKATYLLVDCPKQIAWKYASSWLVFDVISTIPSELAQKISPKP---LQSYGLFNMLRLWRLRRVSAL  184 (883)
Q Consensus       108 ~~Di~l~f~~ay~~~~~~~~v~~~~~i~~~Yl~~~f~iDlis~iP~~~~~~~~~~~---~~~~~~l~~lRl~Rl~r~~~~  184 (883)
                      ++||+++|+++|+++++.++|+||++|+++|+|+||++|++|++|++++..+....   ...+.+++++|++|+.|+.++
T Consensus       106 ~iDi~l~f~~ay~d~~~~~lV~d~~~I~~~Yl~~~f~~Dlis~lP~~~i~~~~~~~~~~~~~~~~l~llrl~Rl~ri~~~  185 (823)
T PLN03192        106 AVDIVLTFFVAYIDPRTQLLVRDRKKIAVRYLSTWFLMDVASTIPFQALAYLITGTVKLNLSYSLLGLLRFWRLRRVKQL  185 (823)
T ss_pred             HHHHHhheeEEEEeCCCcEEEeCHHHHHHHHHHHhHHHHHHHHhHHHHHHHHhcCCccchHHHHHHHHHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999998875543322   235678899999999999999


Q ss_pred             HHhhhhccchhHHHHHHHHHHHHHHHHHHHHHHHhhhheeeecCCCCCccccccCCcccccchhHHHHHHHHHHhhhhhc
Q 002763          185 FSRLEKDRNYNYFWVRCCKLIFVTLFAVHCAGCFYYLLAARYHNPERTWIGASLGQNFLEKSLWIRYVTSMYWSITTLTT  264 (883)
Q Consensus       185 ~~~l~~~~~~~~~~~~~~~l~~~~l~~~h~~aci~~~i~~~~~~~~~~w~~~~~~~~~~~~~~~~~Y~~s~ywai~T~tT  264 (883)
                      ++++++..++++.+.+++++++++++++||+||+||+++..++..+.+|++... .++.+.++|.+|+.|+||+++||||
T Consensus       186 ~~~le~~~~~~~~~~~~~kli~~~l~~~H~~aC~~y~i~~~~~~~~~~Wi~~~~-~~~~~~s~~~~Yi~slYwai~TmtT  264 (823)
T PLN03192        186 FTRLEKDIRFSYFWIRCARLLSVTLFLVHCAGCLYYLIADRYPHQGKTWIGAVI-PNFRETSLWIRYISAIYWSITTMTT  264 (823)
T ss_pred             HHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcCCCCCchHHHhh-hccccCcHHHHHHHHHHHHHHHHhh
Confidence            999999999999999999999999999999999999998777777889998643 6778899999999999999999999


Q ss_pred             cccCCcccCCchhhHHHHHHHHHHHHHHHHHHHHHHHHHHhhchhHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHH
Q 002763          265 VGYGDLHPVNTREMVFDILFMLFNLGLTAYLIGNMTNLVVHGTSRTRKFRDTIQAASSFAQRNQLPIRLQDQMLAHLCLK  344 (883)
Q Consensus       265 VGYGDi~p~t~~e~i~~i~~~l~g~~~~a~~i~~i~~~~~~~~~~~~~~~~~~~~~~~~m~~~~lp~~l~~ri~~~~~~~  344 (883)
                      |||||++|.|..|++|++++|++|++++||++|+|++++.+.++++++|+++++.+++||+++++|++||+||++|++++
T Consensus       265 VGYGDi~p~t~~E~i~~i~~ml~g~~~~a~~ig~i~~li~~~~~~~~~f~~~~~~~~~ym~~~~lp~~lq~ri~~y~~~~  344 (823)
T PLN03192        265 VGYGDLHAVNTIEMIFIIFYMLFNLGLTAYLIGNMTNLVVEGTRRTMEFRNSIEAASNFVGRNRLPPRLKDQILAYMCLR  344 (823)
T ss_pred             ccCCCcCCCccchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcCCCHHHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhhccccchHHHHHhhchHHHHHHHHHHHHHhHhhhccccccCCHHHHHHHHHhchhhccCCCCeEEecCCCCCeEEEEE
Q 002763          345 FRTDSEGLQQQETLDSLPKAIRSSISHYLFYSLMDKVYLFRGVSNDLLFQLVSEMKAEYFPPKEDVILQNEAPTDFYILV  424 (883)
Q Consensus       345 ~~~~~~~~~~~~~l~~Lp~~lr~~i~~~l~~~~l~~~~lF~~~s~~~l~~l~~~~~~~~~~~ge~I~~~ge~~~~ly~i~  424 (883)
                      |+.  ++.++++++++||++||.+|+++++.++++++++|+++|++++.+|+..+++++|+|||.|+.|||.++++|||+
T Consensus       345 ~~~--~~~~~~~~l~~Lp~~Lr~~i~~~l~~~~l~~~~lF~~~s~~~l~~L~~~~~~~~~~pge~I~~qge~~~~lY~I~  422 (823)
T PLN03192        345 FKA--ESLNQQQLIDQLPKSICKSICQHLFLPVVEKVYLFKGVSREILLLLVTKMKAEYIPPREDVIMQNEAPDDVYIVV  422 (823)
T ss_pred             Hhh--ccccHHHHHHHcCHHHHHHHHHHHHHHHHhhCcchhcCCHHHHHHHHHhhheeeeCCCCEEEECCCCCceEEEEE
Confidence            976  467889999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EceEEEEEEeCCceEEEEEecCCCeeehhhhhcCCCceeEEEEccceeEEeechhhHHHHHhhcccchHHHHHHHHhhhc
Q 002763          425 TGAVDLLVLKNGVEQVVGEAKTGEICGEIGVLCYRPQLFTVRTKRLSQLLRLNRTTFLNIVQANVGDGTIIMNNLLQHLK  504 (883)
Q Consensus       425 ~G~v~i~~~~~~~~~~i~~l~~g~~fGe~~ll~~~p~~~tv~a~~~~~l~~l~r~~f~~ll~~~~~~~~~i~~~l~~~lk  504 (883)
                      +|+|+++...++++.++..+++|++|||++++++.|++++++|.+.|++++|++++|.++++.+|++...+++++.++.+
T Consensus       423 ~G~V~i~~~~~~~e~~l~~l~~Gd~FGE~~~l~~~p~~~t~ra~~~s~ll~l~~~~f~~ll~~~p~d~~~i~~~~l~~~~  502 (823)
T PLN03192        423 SGEVEIIDSEGEKERVVGTLGCGDIFGEVGALCCRPQSFTFRTKTLSQLLRLKTSTLIEAMQTRQEDNVVILKNFLQHHK  502 (823)
T ss_pred             ecEEEEEEecCCcceeeEEccCCCEecchHHhcCCCCCCeEEEcccEEEEEEEHHHHHHHHHHhhHHHHHHHHHHHHHhh
Confidence            99999988777888899999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccCCcchhhhhhhHHHHHhcCCCCchhHHHHHHhcCCHHHHHHHHHcCCCCCCCCCCCCcHHHHHHHcCCHHHHHHHHhC
Q 002763          505 DLKDPIMEGVLLETENMLARGRMDLPLSLCFAALRGDDLLLHQLLKRGLDPNESDNNGRTALHIAASKGSENCVLLLLDY  584 (883)
Q Consensus       505 ~~~~~~~~~~l~~~~~~~~~~~~~~~t~L~~Aa~~g~~~~v~~Ll~~g~d~n~~d~~g~TpLh~Aa~~g~~~~v~~Ll~~  584 (883)
                      +++++.+...+.+.+..  .++.++.++||.||..||.++++.|+++|+|+|..|.+|+||||+||.+|+.+++++|+++
T Consensus       503 ~l~~l~v~~ll~~~~~~--~~~~~~~~~L~~Aa~~g~~~~l~~Ll~~G~d~n~~d~~G~TpLh~Aa~~g~~~~v~~Ll~~  580 (823)
T PLN03192        503 ELHDLNVGDLLGDNGGE--HDDPNMASNLLTVASTGNAALLEELLKAKLDPDIGDSKGRTPLHIAASKGYEDCVLVLLKH  580 (823)
T ss_pred             hhccccHHHHHhhcccc--cCCccchhHHHHHHHcCCHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHcChHHHHHHHHhc
Confidence            99988877777665544  3455678999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCCCCCCCCCHHHHHHHcCcHHHHHHHHHcCCCCCCCCcchhHHHHHHhCCHHHHHHHHHcCCCccccCCCCChHHH
Q 002763          585 EADPNSIDSDGNVPLWEAMLGGHENVIKLLMENHADINSGDVGHFACTAAEQNNLELLKEIVCYGGDVTRQRNNGSTALH  664 (883)
Q Consensus       585 ga~~~~~d~~g~tpL~~A~~~g~~~iv~~Ll~~g~~~~~~~~~~~l~~a~~~~~~~~~~~Ll~~g~~~~~~d~~g~T~Lh  664 (883)
                      |+|+|.+|.+|+||||+|+..||.+++++|++.++..+..+.++++|.|+..|+.++++.|+++|+|+|.+|.+|.||||
T Consensus       581 gadin~~d~~G~TpL~~A~~~g~~~iv~~L~~~~~~~~~~~~~~~L~~Aa~~g~~~~v~~Ll~~Gadin~~d~~G~TpLh  660 (823)
T PLN03192        581 ACNVHIRDANGNTALWNAISAKHHKIFRILYHFASISDPHAAGDLLCTAAKRNDLTAMKELLKQGLNVDSEDHQGATALQ  660 (823)
T ss_pred             CCCCCCcCCCCCCHHHHHHHhCCHHHHHHHHhcCcccCcccCchHHHHHHHhCCHHHHHHHHHCCCCCCCCCCCCCCHHH
Confidence            99999999999999999999999999999999999888888889999999999999999999999999999999999999


Q ss_pred             HHHHcCCHHHHHHHHhCCCCCCCCCCCC-CCHHHHHHHcCCHHHHHHHhhcccccccccccccCCCcccccccccccCCC
Q 002763          665 VAVCEDNVEIVRFLLDQKADVDKPDVHG-WTPRDLADQQGHEEIKCIFQSCKETKAQSIISVAERPQQEVHYLGRFTSEP  743 (883)
Q Consensus       665 ~A~~~g~~~~v~~Ll~~ga~~~~~d~~g-~Tpl~~A~~~~~~~i~~~L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  743 (883)
                      +|+..|+.+++++|+++|||++..|.+| .||++++......         +....   .....             ..+
T Consensus       661 ~A~~~g~~~iv~~Ll~~GAdv~~~~~~g~~t~~~l~~~~~~~---------~~~~~---~~~~~-------------~~~  715 (823)
T PLN03192        661 VAMAEDHVDMVRLLIMNGADVDKANTDDDFSPTELRELLQKR---------ELGHS---ITIVD-------------SVP  715 (823)
T ss_pred             HHHHCCcHHHHHHHHHcCCCCCCCCCCCCCCHHHHHHHHHHh---------hhCce---eeecc-------------CCC
Confidence            9999999999999999999999999988 9999887543221         11100   00000             000


Q ss_pred             cccCCCccccccccCCCCCcccccccccccccchhhhcccccccccCCCCCCCCCcccCCCCCCCceEEEe--cCCC---
Q 002763          744 AIRPITHEVSFEGVDGSGSQNHSRRRTNNFHNSLFGIMSAAHNVEKDILFPPQHTKVFKAPGINSARVTIG--CPEK---  818 (883)
Q Consensus       744 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ns~~~~~s~~~~~~~~~~~~~~~~~~~~~~~~~~~rvti~--~p~~---  818 (883)
                      ...+   ...        .....                     ..+. ..     .........+|++++  ||..   
T Consensus       716 ~~~~---~~~--------~~~~~---------------------~~~~-~~-----~~~~~~~~~~~~~~~~~~p~~~~~  757 (823)
T PLN03192        716 ADEP---DLG--------RDGGS---------------------RPGR-LQ-----GTSSDNQCRPRVSIYKGHPLLRNE  757 (823)
T ss_pred             cccc---ccc--------ccccc---------------------cccc-cc-----ccccccccCceEEEecCCCccccc
Confidence            0000   000        00000                     0000 00     000022345688888  7733   


Q ss_pred             --CccccEEEEccccHHHHHHHHhhhcCCCcc--eeecCCCCeeeeeeeeecCCEEEEEecCC
Q 002763          819 --GEVAGKLVLLPSTFQELLDIGEKKFGISPA--KVLNKGGAEVEDIEVIRDGDHLVFVSDGG  877 (883)
Q Consensus       819 --~~~~g~~~~~p~~~~~l~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~l~~~~~~~  877 (883)
                        ..++|+++++|+|++||+++|++||||++.  .++++||||||||||||||||||+|+++.
T Consensus       758 ~~~~~~g~~~~~~~~~~e~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  820 (823)
T PLN03192        758 RCCNEAGKLINLPPSLEELKAIAGEKLGFDARKAMVTNEEGAEIDSIEVIRDNDKLFVVEDED  820 (823)
T ss_pred             ccccccCeEEeCCccHHHHHHHHHHHhCCCcccceeecCCCceeeeeEEEecCCEEEEeeccc
Confidence              236999999999999999999999999874  48999999999999999999999999853



>KOG0498 consensus K+-channel ERG and related proteins, contain PAS/PAC sensor domain [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0500 consensus Cyclic nucleotide-gated cation channel CNGA1-3 and related proteins [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0501 consensus K+-channel KCNQ [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0499 consensus Cyclic nucleotide-gated cation channel CNCG4 [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG3713 consensus Voltage-gated K+ channel KCNB/KCNC [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG1545 consensus Voltage-gated shaker-like K+ channel KCNA [Inorganic ion transport and metabolism] Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG4390 consensus Voltage-gated A-type K+ channel KCND [Inorganic ion transport and metabolism] Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PF11834 DUF3354: Domain of unknown function (DUF3354); InterPro: IPR021789 Potassium channels take part in important processes of higher plants, including opening and closing of stomatal pores and leaf movement Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG1419 consensus Voltage-gated K+ channel KCNQ [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PRK09392 ftrB transcriptional activator FtrB; Provisional Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>PF00520 Ion_trans: Ion transport protein calcium channel signature potassium channel signature sodium channel signature; InterPro: IPR005821 This group of proteins is found in sodium, potassium, and calcium ion channels proteins Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>KOG1420 consensus Ca2+-activated K+ channel Slowpoke, alpha subunit [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>cd00038 CAP_ED effector domain of the CAP family of transcription factors; members include CAP (or cAMP receptor protein (CRP)), which binds cAMP, FNR (fumarate and nitrate reduction), which uses an iron-sulfur cluster to sense oxygen) and CooA, a heme containing CO sensor Back     alignment and domain information
>PRK11753 DNA-binding transcriptional dual regulator Crp; Provisional Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>PF00027 cNMP_binding: Cyclic nucleotide-binding domain; InterPro: IPR000595 Proteins that bind cyclic nucleotides (cAMP or cGMP) share a structural domain of about 120 residues [, , ] Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>KOG1113 consensus cAMP-dependent protein kinase types I and II, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>smart00100 cNMP Cyclic nucleotide-monophosphate binding domain Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>PF07885 Ion_trans_2: Ion channel; InterPro: IPR013099 This entry includes the two membrane helix type ion channels found in bacteria [] Back     alignment and domain information
>PRK10402 DNA-binding transcriptional activator YeiL; Provisional Back     alignment and domain information
>COG0664 Crp cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG2905 Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms] Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>KOG0614 consensus cGMP-dependent protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK11161 fumarate/nitrate reduction transcriptional regulator; Provisional Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0614 consensus cGMP-dependent protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PLN02868 acyl-CoA thioesterase family protein Back     alignment and domain information
>TIGR03697 NtcA_cyano global nitrogen regulator NtcA, cyanobacterial Back     alignment and domain information
>PRK09391 fixK transcriptional regulator FixK; Provisional Back     alignment and domain information
>PRK13918 CRP/FNR family transcriptional regulator; Provisional Back     alignment and domain information
>KOG1113 consensus cAMP-dependent protein kinase types I and II, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>PRK10537 voltage-gated potassium channel; Provisional Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG3684 consensus Ca2+-activated K+ channel proteins (intermediate/small conductance classes) [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>KOG2968 consensus Predicted esterase of the alpha-beta hydrolase superfamily (Neuropathy target esterase), contains cAMP-binding domains [General function prediction only] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>PF08412 Ion_trans_N: Ion transport protein N-terminal; InterPro: IPR013621 This domain is found to the N terminus of IPR005821 from INTERPRO in voltage- and cyclic nucleotide-gated K/Na ion channels Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>PF01007 IRK: Inward rectifier potassium channel; InterPro: IPR013521 Potassium channels are the most diverse group of the ion channel family [, ] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG2302 consensus T-type voltage-gated Ca2+ channel, pore-forming alpha1I subunit [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG4404 consensus Tandem pore domain K+ channel TASK3/THIK-1 [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG1418 consensus Tandem pore domain K+ channel [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG3193 consensus K+ channel subunit [Inorganic ion transport and metabolism] Back     alignment and domain information
>PLN03223 Polycystin cation channel protein; Provisional Back     alignment and domain information
>KOG2968 consensus Predicted esterase of the alpha-beta hydrolase superfamily (Neuropathy target esterase), contains cAMP-binding domains [General function prediction only] Back     alignment and domain information
>KOG4404 consensus Tandem pore domain K+ channel TASK3/THIK-1 [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11832 putative DNA-binding transcriptional regulator; Provisional Back     alignment and domain information
>KOG3827 consensus Inward rectifier K+ channel [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>KOG2301 consensus Voltage-gated Ca2+ channels, alpha1 subunits [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PF04831 Popeye: Popeye protein conserved region; InterPro: IPR006916 The Popeye (POP) family of proteins, is restricted to vertebrates and is preferentially expressed in developing and adult striated muscle Back     alignment and domain information
>KOG3614 consensus Ca2+/Mg2+-permeable cation channels (LTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG1418 consensus Tandem pore domain K+ channel [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF03607 DCX: Doublecortin; InterPro: IPR003533 X-linked lissencephaly is a severe brain malformation affecting males Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>KOG2301 consensus Voltage-gated Ca2+ channels, alpha1 subunits [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG3542 consensus cAMP-regulated guanine nucleotide exchange factor [Signal transduction mechanisms] Back     alignment and domain information
>PF02017 CIDE-N: CIDE-N domain; InterPro: IPR003508 This domain consists of caspase-activated (CAD) nucleases, which induce DNA fragmentation and chromatin condensation during apoptosis, and the cell death activator proteins CIDE-A and CIDE-B, which are inhibitors of CAD nuclease Back     alignment and domain information
>cd01615 CIDE_N CIDE_N domain, found at the N-terminus of the CIDE (cell death-inducing DFF45-like effector) proteins, as well as CAD nuclease (caspase-activated DNase/DNA fragmentation factor, DFF40) and its inhibitor, ICAD(DFF45) Back     alignment and domain information
>KOG3599 consensus Ca2+-modulated nonselective cation channel polycystin [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>smart00266 CAD Domains present in proteins implicated in post-mortem DNA fragmentation Back     alignment and domain information
>cd06538 CIDE_N_FSP27 CIDE_N domain of FSP27 proteins Back     alignment and domain information
>cd06539 CIDE_N_A CIDE_N domain of CIDE-A proteins Back     alignment and domain information
>KOG0498 consensus K+-channel ERG and related proteins, contain PAS/PAC sensor domain [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>smart00537 DCX Domain in the Doublecortin (DCX) gene product Back     alignment and domain information
>cd06535 CIDE_N_CAD CIDE_N domain of CAD nuclease Back     alignment and domain information
>cd06537 CIDE_N_B CIDE_N domain of CIDE-B proteins Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>cd06536 CIDE_N_ICAD CIDE_N domain of ICAD Back     alignment and domain information
>PF00520 Ion_trans: Ion transport protein calcium channel signature potassium channel signature sodium channel signature; InterPro: IPR005821 This group of proteins is found in sodium, potassium, and calcium ion channels proteins Back     alignment and domain information
>PF00060 Lig_chan: Ligand-gated ion channel; InterPro: IPR001320 The ability of synapses to modify their synaptic strength in response to activity is a fundamental property of the nervous system and may be an essential component of learning and memory Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF08016 PKD_channel: Polycystin cation channel; InterPro: IPR013122 Polycystic kidney diseases (PKD) are disorders characterised by large numbers of cysts distributed throughout grossly-enlarged kidneys Back     alignment and domain information
>KOG2302 consensus T-type voltage-gated Ca2+ channel, pore-forming alpha1I subunit [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>cd01617 DCX Ubiquitin-like domain of DCX Back     alignment and domain information
>KOG3542 consensus cAMP-regulated guanine nucleotide exchange factor [Signal transduction mechanisms] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query883
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 2e-20
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 2e-06
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 3e-20
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 4e-20
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 4e-08
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 3e-19
2xeh_A157 Structural Determinants For Improved Thermal Stabil 9e-19
2xee_A157 Structural Determinants For Improved Thermal Stabil 2e-17
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 4e-17
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 9e-09
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 4e-17
2v5q_C167 Crystal Structure Of Wild-type Plk-1 Kinase Domain 1e-16
1n11_A437 D34 Region Of Human Ankyrin-R And Linker Length = 4 5e-16
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 8e-16
2qyj_A166 Crystal Structure Of A Designed Full Consensus Anky 1e-15
4f6r_D169 Tubulin:stathmin-Like Domain Complex Length = 169 1e-15
4f6r_D169 Tubulin:stathmin-Like Domain Complex Length = 169 2e-12
2bkg_A166 Crystal Structure Of E3_19 An Designed Ankyrin Repe 1e-15
3q9u_C158 In Silico And In Vitro Co-Evolution Of A High Affin 2e-15
2p2c_P169 Inhibition Of Caspase-2 By A Designed Ankyrin Repea 8e-15
1svx_A169 Crystal Structure Of A Designed Selected Ankyrin Re 2e-14
3nog_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 3e-14
2j8s_D169 Drug Export Pathway Of Multidrug Exporter Acrb Reve 4e-14
2y1l_E169 Caspase-8 In Complex With Darpin-8.4 Length = 169 7e-14
4atz_D154 Ad5 Knob In Complex With A Designed Ankyrin Repeat 7e-14
3noc_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 1e-13
4dui_A169 Darpin D1 Binding To Tubulin Beta Chain (not In Com 2e-13
2bkk_B169 Crystal Structure Of Aminoglycoside Phosphotransfer 2e-13
4drx_E169 Gtp-Tubulin In Complex With A Darpin Length = 169 3e-13
2v4h_C136 Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 1e-12
3zuv_B136 Crystal Structure Of A Designed Selected Ankyrin Re 5e-12
4grg_A135 Crystal Structure Of Ige Complexed With E2_79, An A 1e-11
4b93_B269 Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyri 2e-11
1uoh_A226 Human Gankyrin Length = 226 3e-11
1uoh_A226 Human Gankyrin Length = 226 3e-05
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 6e-11
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 1e-08
2xzt_G136 Caspase-3 In Complex With Darpin-3.4_i78s Length = 7e-11
2y0b_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4_ 2e-10
2xzd_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4 2e-10
3aji_A231 Structure Of Gankyrin-S6atpase Photo-Cross-Linked S 4e-10
3aji_A231 Structure Of Gankyrin-S6atpase Photo-Cross-Linked S 5e-04
1qym_A227 X-Ray Structure Of Human Gankyrin Length = 227 4e-10
1qym_A227 X-Ray Structure Of Human Gankyrin Length = 227 1e-04
2dvw_A231 Structure Of The Oncoprotein Gankyrin In Complex Wi 5e-10
2dvw_A231 Structure Of The Oncoprotein Gankyrin In Complex Wi 4e-04
1ot8_A239 Structure Of The Ankyrin Domain Of The Drosophila N 5e-10
1k1b_A241 Crystal Structure Of The Ankyrin Repeat Domain Of B 1e-09
3hg0_D136 Crystal Structure Of A Darpin In Complex With Orf49 3e-09
1yyh_A253 Crystal Structure Of The Human Notch 1 Ankyrin Doma 5e-09
2qc9_A210 Mouse Notch 1 Ankyrin Repeat Intracellular Domain L 5e-09
2he0_A253 Crystal Structure Of A Human Notch1 Ankyrin Domain 5e-09
2f8y_A223 Crystal Structure Of Human Notch1 Ankyrin Repeats T 6e-09
1wdy_A285 Crystal Structure Of Ribonuclease Length = 285 1e-08
3zkj_A261 Crystal Structure Of Ankyrin Repeat And Socs Box-co 2e-08
2jab_A136 A Designed Ankyrin Repeat Protein Evolved To Picomo 2e-08
3d9h_A285 Crystal Structure Of The Splice Variant Of Human As 6e-08
2l6b_A115 Nrc Consensus Ankyrin Repeat Protein Solution Struc 6e-08
2vge_A229 Crystal Structure Of The C-Terminal Region Of Human 2e-07
3twu_A167 Crystal Structure Of Arc4 From Human Tankyrase 2 In 4e-07
3twr_A165 Crystal Structure Of Arc4 From Human Tankyrase 2 In 4e-07
3twq_A175 Crystal Structure Of Arc4 From Human Tankyrase 2 (A 4e-07
3eu9_A240 The Ankyrin Repeat Domain Of Huntingtin Interacting 4e-07
3utm_A351 Crystal Structure Of A Mouse Tankyrase-Axin Complex 4e-07
1bd8_A156 Structure Of Cdk Inhibitor P19ink4d Length = 156 4e-07
1bi8_B166 Mechanism Of G1 Cyclin Dependent Kinase Inhibition 5e-07
2f8x_K256 Crystal Structure Of Activated Notch, Csl And Maml 5e-07
1ap7_A168 P19-Ink4d From Mouse, Nmr, 20 Structures Length = 1 6e-07
1blx_B166 P19ink4dCDK6 COMPLEX Length = 166 6e-07
4g8k_A337 Intact Sensor Domain Of Human Rnase L In The Inacti 7e-07
2zgg_A92 Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom 1e-06
2zgd_A110 Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom 2e-06
1nfi_E213 I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 2e-06
1dcq_A278 Crystal Structure Of The Arf-Gap Domain And Ankyrin 3e-06
3c5r_A137 Crystal Structure Of The Bard1 Ankyrin Repeat Domai 3e-06
2ptm_A198 Structure And Rearrangements In The Carboxy-Termina 3e-06
3v30_A172 Crystal Structure Of The Peptide Bound Complex Of T 4e-06
3uxg_A172 Crystal Structure Of Rfxank Length = 172 5e-06
1awc_B153 Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 1 5e-06
1s70_B299 Complex Between Protein Ser/thr Phosphatase-1 (delt 5e-06
1ikn_D236 IkappabalphaNF-Kappab Complex Length = 236 6e-06
3b7b_A237 Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Le 7e-06
2rfm_A192 Structure Of A Thermophilic Ankyrin Repeat Protein 7e-06
1mx2_A168 Structure Of F71n Mutant Of P18ink4c Length = 168 1e-05
1mx4_A168 Structure Of P18ink4c (F82q) Length = 168 1e-05
3hra_A201 Crystal Structure Of Ef0377 An Ankyrin Repeat Prote 1e-05
2xen_A91 Structural Determinants For Improved Thermal Stabil 1e-05
3aaa_C123 Crystal Structure Of Actin Capping Protein In Compl 2e-05
1myo_A118 Solution Structure Of Myotrophin, Nmr, 44 Structure 2e-05
1ihb_A162 Crystal Structure Of P18-Ink4c(Ink6) Length = 162 3e-05
1bu9_A168 Solution Structure Of P18-Ink4c, 21 Structures Leng 3e-05
2qvs_B310 Crystal Structure Of Type Iia Holoenzyme Of Camp-De 4e-05
3f6q_A179 Crystal Structure Of Integrin-Linked Kinase Ankyrin 5e-05
2kbx_A171 Solution Structure Of Ilk-Pinch Complex Length = 17 6e-05
1mx6_A168 Structure Of P18ink4c (F92n) Length = 168 1e-04
3tnq_A416 Structure And Allostery Of The Pka Riib Tetrameric 1e-04
2fo1_E373 Crystal Structure Of The Csl-Notch-Mastermind Terna 1e-04
3tnp_B416 Structure And Allostery Of The Pka Riib Tetrameric 1e-04
3v2o_A183 Crystal Structure Of The Peptide Bound Complex Of T 1e-04
3v2o_A183 Crystal Structure Of The Peptide Bound Complex Of T 2e-04
3idb_B161 Crystal Structure Of (108-268)riib:c Holoenzyme Of 2e-04
1ymp_A135 The Crystal Structure Of A Partial Mouse Notch-1 An 2e-04
3v2x_A167 Crystal Structure Of The Peptide Bound Complex Of T 2e-04
3v2x_A167 Crystal Structure Of The Peptide Bound Complex Of T 2e-04
3idc_B164 Crystal Structure Of (102-265)riib:c Holoenzyme Of 2e-04
4a63_B239 Crystal Structure Of The P73-Aspp2 Complex At 2.6a 2e-04
3so8_A162 Crystal Structure Of Ankra Length = 162 2e-04
3so8_A162 Crystal Structure Of Ankra Length = 162 2e-04
1ycs_B239 P53-53bp2 Complex Length = 239 2e-04
1cx4_A305 Crystal Structure Of A Deletion Mutant Of The Type 2e-04
3ouf_A97 Structure Of A K+ Selective Nak Mutant Length = 97 3e-04
4h33_A137 Crystal Structure Of A Voltage-gated K+ Channel Por 4e-04
4hbd_A276 Crystal Structure Of Kank2 Ankyrin Repeats Length = 5e-04
1lnq_A336 Crystal Structure Of Mthk At 3.3 A Length = 336 6e-04
2a9h_A155 Nmr Structural Studies Of A Potassium Channel Chary 6e-04
3tet_A97 Crystal Structure Of Nak2k Channel Y66f Mutant Leng 8e-04
3t4d_A97 Crystal Structure Of Nak2k Channel Y55f Mutant Leng 8e-04
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure

Iteration: 1

Score = 98.2 bits (243), Expect = 2e-20, Method: Composition-based stats. Identities = 59/153 (38%), Positives = 76/153 (49%), Gaps = 31/153 (20%) Query: 555 PNESDNNGRTALHIAASKGSENCVLLLLDYEADPNSIDSDGNVPLWEAMLGGHENVIKLL 614 PN SD++GRT LH AA G + V LLL ADPN+ DSDG PL A GH+ ++KLL Sbjct: 30 PNASDSDGRTPLHYAAENGHKEIVKLLLSKGADPNAKDSDGRTPLHYAAENGHKEIVKLL 89 Query: 615 MENHADINSGDVGHFACTAAEQNNLELLKEIVCYGGDVTRQRNNGSTALHVAVCEDNVEI 674 + AD N+ D ++G T LH A + EI Sbjct: 90 LSKGADPNAKD-------------------------------SDGRTPLHYAAENGHKEI 118 Query: 675 VRFLLDQKADVDKPDVHGWTPRDLADQQGHEEI 707 V+ LL + AD + D G TP DLA + G+EEI Sbjct: 119 VKLLLSKGADPNTSDSDGRTPLDLAREHGNEEI 151
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 Back     alignment and structure
>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 Back     alignment and structure
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure
>pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 Back     alignment and structure
>pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 Back     alignment and structure
>pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 Back     alignment and structure
>pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 Back     alignment and structure
>pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 Back     alignment and structure
>pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 Back     alignment and structure
>pdb|3NOG|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 Back     alignment and structure
>pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 Back     alignment and structure
>pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 Back     alignment and structure
>pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 Back     alignment and structure
>pdb|2BKK|B Chain B, Crystal Structure Of Aminoglycoside Phosphotransferase Aph (3')-Iiia In Complex With The Inhibitor Ar_3a Length = 169 Back     alignment and structure
>pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 Back     alignment and structure
>pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 Back     alignment and structure
>pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 Back     alignment and structure
>pdb|4GRG|A Chain A, Crystal Structure Of Ige Complexed With E2_79, An Anti-Ige Inhibitor Length = 135 Back     alignment and structure
>pdb|4B93|B Chain B, Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyrin Repeat Domain Of Varp Length = 269 Back     alignment and structure
>pdb|1UOH|A Chain A, Human Gankyrin Length = 226 Back     alignment and structure
>pdb|1UOH|A Chain A, Human Gankyrin Length = 226 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|2XZT|G Chain G, Caspase-3 In Complex With Darpin-3.4_i78s Length = 136 Back     alignment and structure
>pdb|2Y0B|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4_s76r Length = 136 Back     alignment and structure
>pdb|2XZD|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4 Length = 136 Back     alignment and structure
>pdb|3AJI|A Chain A, Structure Of Gankyrin-S6atpase Photo-Cross-Linked Site-Specifically, And Incoporated By Genetic Code Expansion Length = 231 Back     alignment and structure
>pdb|3AJI|A Chain A, Structure Of Gankyrin-S6atpase Photo-Cross-Linked Site-Specifically, And Incoporated By Genetic Code Expansion Length = 231 Back     alignment and structure
>pdb|1QYM|A Chain A, X-Ray Structure Of Human Gankyrin Length = 227 Back     alignment and structure
>pdb|1QYM|A Chain A, X-Ray Structure Of Human Gankyrin Length = 227 Back     alignment and structure
>pdb|2DVW|A Chain A, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 231 Back     alignment and structure
>pdb|2DVW|A Chain A, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 231 Back     alignment and structure
>pdb|1OT8|A Chain A, Structure Of The Ankyrin Domain Of The Drosophila Notch Receptor Length = 239 Back     alignment and structure
>pdb|1K1B|A Chain A, Crystal Structure Of The Ankyrin Repeat Domain Of Bcl-3: A Unique Member Of The Ikappab Protein Family Length = 241 Back     alignment and structure
>pdb|3HG0|D Chain D, Crystal Structure Of A Darpin In Complex With Orf49 From Lactococcal Phage Tp901-1 Length = 136 Back     alignment and structure
>pdb|1YYH|A Chain A, Crystal Structure Of The Human Notch 1 Ankyrin Domain Length = 253 Back     alignment and structure
>pdb|2QC9|A Chain A, Mouse Notch 1 Ankyrin Repeat Intracellular Domain Length = 210 Back     alignment and structure
>pdb|2HE0|A Chain A, Crystal Structure Of A Human Notch1 Ankyrin Domain Mutant Length = 253 Back     alignment and structure
>pdb|2F8Y|A Chain A, Crystal Structure Of Human Notch1 Ankyrin Repeats To 1.55a Resolution. Length = 223 Back     alignment and structure
>pdb|1WDY|A Chain A, Crystal Structure Of Ribonuclease Length = 285 Back     alignment and structure
>pdb|3ZKJ|A Chain A, Crystal Structure Of Ankyrin Repeat And Socs Box-containing Protein 9 (asb9) In Complex With Elonginb And Elonginc Length = 261 Back     alignment and structure
>pdb|2JAB|A Chain A, A Designed Ankyrin Repeat Protein Evolved To Picomolar Affinity To Her2 Length = 136 Back     alignment and structure
>pdb|3D9H|A Chain A, Crystal Structure Of The Splice Variant Of Human Asb9 (Hasb9-2), An Ankyrin Repeat Protein Length = 285 Back     alignment and structure
>pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 Back     alignment and structure
>pdb|2VGE|A Chain A, Crystal Structure Of The C-Terminal Region Of Human Iaspp Length = 229 Back     alignment and structure
>pdb|3TWU|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human Mcl1 Length = 167 Back     alignment and structure
>pdb|3TWR|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human 3bp2 Length = 165 Back     alignment and structure
>pdb|3TWQ|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 (Apo Form) Length = 175 Back     alignment and structure
>pdb|3EU9|A Chain A, The Ankyrin Repeat Domain Of Huntingtin Interacting Protein 14 Length = 240 Back     alignment and structure
>pdb|3UTM|A Chain A, Crystal Structure Of A Mouse Tankyrase-Axin Complex Length = 351 Back     alignment and structure
>pdb|1BD8|A Chain A, Structure Of Cdk Inhibitor P19ink4d Length = 156 Back     alignment and structure
>pdb|1BI8|B Chain B, Mechanism Of G1 Cyclin Dependent Kinase Inhibition From The Structures Cdk6-P19ink4d Inhibitor Complex Length = 166 Back     alignment and structure
>pdb|2F8X|K Chain K, Crystal Structure Of Activated Notch, Csl And Maml On Hes-1 Promoter Dna Sequence Length = 256 Back     alignment and structure
>pdb|1AP7|A Chain A, P19-Ink4d From Mouse, Nmr, 20 Structures Length = 168 Back     alignment and structure
>pdb|1BLX|B Chain B, P19ink4dCDK6 COMPLEX Length = 166 Back     alignment and structure
>pdb|4G8K|A Chain A, Intact Sensor Domain Of Human Rnase L In The Inactive Signaling State Length = 337 Back     alignment and structure
>pdb|2ZGG|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 92 Back     alignment and structure
>pdb|2ZGD|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 110 Back     alignment and structure
>pdb|1NFI|E Chain E, I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 Back     alignment and structure
>pdb|1DCQ|A Chain A, Crystal Structure Of The Arf-Gap Domain And Ankyrin Repeats Of Papbeta Length = 278 Back     alignment and structure
>pdb|3C5R|A Chain A, Crystal Structure Of The Bard1 Ankyrin Repeat Domain And Its Functional Consequences Length = 137 Back     alignment and structure
>pdb|2PTM|A Chain A, Structure And Rearrangements In The Carboxy-Terminal Region Of Spih Channels Length = 198 Back     alignment and structure
>pdb|3V30|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Rfxank Length = 172 Back     alignment and structure
>pdb|3UXG|A Chain A, Crystal Structure Of Rfxank Length = 172 Back     alignment and structure
>pdb|1AWC|B Chain B, Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 153 Back     alignment and structure
>pdb|1S70|B Chain B, Complex Between Protein Ser/thr Phosphatase-1 (delta) And The Myosin Phosphatase Targeting Subunit 1 (mypt1) Length = 299 Back     alignment and structure
>pdb|1IKN|D Chain D, IkappabalphaNF-Kappab Complex Length = 236 Back     alignment and structure
>pdb|3B7B|A Chain A, Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Length = 237 Back     alignment and structure
>pdb|2RFM|A Chain A, Structure Of A Thermophilic Ankyrin Repeat Protein Length = 192 Back     alignment and structure
>pdb|1MX2|A Chain A, Structure Of F71n Mutant Of P18ink4c Length = 168 Back     alignment and structure
>pdb|1MX4|A Chain A, Structure Of P18ink4c (F82q) Length = 168 Back     alignment and structure
>pdb|3HRA|A Chain A, Crystal Structure Of Ef0377 An Ankyrin Repeat Protein Length = 201 Back     alignment and structure
>pdb|2XEN|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module Length = 91 Back     alignment and structure
>pdb|3AAA|C Chain C, Crystal Structure Of Actin Capping Protein In Complex With V-1 Length = 123 Back     alignment and structure
>pdb|1MYO|A Chain A, Solution Structure Of Myotrophin, Nmr, 44 Structures Length = 118 Back     alignment and structure
>pdb|1IHB|A Chain A, Crystal Structure Of P18-Ink4c(Ink6) Length = 162 Back     alignment and structure
>pdb|1BU9|A Chain A, Solution Structure Of P18-Ink4c, 21 Structures Length = 168 Back     alignment and structure
>pdb|2QVS|B Chain B, Crystal Structure Of Type Iia Holoenzyme Of Camp-Dependent Protein Kinase Length = 310 Back     alignment and structure
>pdb|3F6Q|A Chain A, Crystal Structure Of Integrin-Linked Kinase Ankyrin Repeat Domain In Complex With Pinch1 Lim1 Domain Length = 179 Back     alignment and structure
>pdb|2KBX|A Chain A, Solution Structure Of Ilk-Pinch Complex Length = 171 Back     alignment and structure
>pdb|1MX6|A Chain A, Structure Of P18ink4c (F92n) Length = 168 Back     alignment and structure
>pdb|3TNQ|A Chain A, Structure And Allostery Of The Pka Riib Tetrameric Holoenzyme Length = 416 Back     alignment and structure
>pdb|2FO1|E Chain E, Crystal Structure Of The Csl-Notch-Mastermind Ternary Complex Bound To Dna Length = 373 Back     alignment and structure
>pdb|3TNP|B Chain B, Structure And Allostery Of The Pka Riib Tetrameric Holoenzyme Length = 416 Back     alignment and structure
>pdb|3V2O|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 183 Back     alignment and structure
>pdb|3V2O|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 183 Back     alignment and structure
>pdb|3IDB|B Chain B, Crystal Structure Of (108-268)riib:c Holoenzyme Of Camp- Dependent Protein Kinase Length = 161 Back     alignment and structure
>pdb|1YMP|A Chain A, The Crystal Structure Of A Partial Mouse Notch-1 Ankyrin Domain: Repeats 4 Through 7 Preserve An Ankyrin Fold Length = 135 Back     alignment and structure
>pdb|3V2X|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 167 Back     alignment and structure
>pdb|3V2X|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 167 Back     alignment and structure
>pdb|3IDC|B Chain B, Crystal Structure Of (102-265)riib:c Holoenzyme Of Camp- Dependent Protein Kinase Length = 164 Back     alignment and structure
>pdb|4A63|B Chain B, Crystal Structure Of The P73-Aspp2 Complex At 2.6a Resolution Length = 239 Back     alignment and structure
>pdb|3SO8|A Chain A, Crystal Structure Of Ankra Length = 162 Back     alignment and structure
>pdb|3SO8|A Chain A, Crystal Structure Of Ankra Length = 162 Back     alignment and structure
>pdb|1YCS|B Chain B, P53-53bp2 Complex Length = 239 Back     alignment and structure
>pdb|1CX4|A Chain A, Crystal Structure Of A Deletion Mutant Of The Type Ii Beta Regulatory Subunit Of Camp-Dependent Protein Kinase Length = 305 Back     alignment and structure
>pdb|3OUF|A Chain A, Structure Of A K+ Selective Nak Mutant Length = 97 Back     alignment and structure
>pdb|4H33|A Chain A, Crystal Structure Of A Voltage-gated K+ Channel Pore Module In A Closed State In Lipid Membranes, Tetragonal Crystal Form Length = 137 Back     alignment and structure
>pdb|4HBD|A Chain A, Crystal Structure Of Kank2 Ankyrin Repeats Length = 276 Back     alignment and structure
>pdb|1LNQ|A Chain A, Crystal Structure Of Mthk At 3.3 A Length = 336 Back     alignment and structure
>pdb|2A9H|A Chain A, Nmr Structural Studies Of A Potassium Channel Charybdotoxin Complex Length = 155 Back     alignment and structure
>pdb|3TET|A Chain A, Crystal Structure Of Nak2k Channel Y66f Mutant Length = 97 Back     alignment and structure
>pdb|3T4D|A Chain A, Crystal Structure Of Nak2k Channel Y55f Mutant Length = 97 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query883
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 5e-45
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 5e-44
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-43
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-41
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 9e-40
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 6e-45
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-42
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 7e-32
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 3e-25
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 4e-09
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 1e-44
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 3e-35
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 3e-32
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 1e-25
3v31_A167 Ankyrin repeat family A protein 2; structural geno 6e-42
3v31_A167 Ankyrin repeat family A protein 2; structural geno 1e-33
3v31_A167 Ankyrin repeat family A protein 2; structural geno 3e-11
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 1e-41
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 9e-40
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 5e-36
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 3e-27
3v30_A172 DNA-binding protein rfxank; structural genomics co 4e-41
3v30_A172 DNA-binding protein rfxank; structural genomics co 2e-36
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 3e-40
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 3e-34
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 6e-28
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 2e-21
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 2e-10
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 5e-40
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-34
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 3e-33
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 8e-31
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 8e-27
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 7e-16
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 6e-40
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 1e-38
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 2e-37
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 6e-19
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 4e-11
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 8e-40
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 3e-32
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 6e-30
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 3e-29
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 3e-39
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 9e-37
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 5e-39
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 4e-36
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 3e-27
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 3e-27
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 3e-20
3hra_A201 Ankyrin repeat family protein; structural protein; 1e-38
3hra_A201 Ankyrin repeat family protein; structural protein; 4e-36
3hra_A201 Ankyrin repeat family protein; structural protein; 5e-24
3hra_A201 Ankyrin repeat family protein; structural protein; 4e-14
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 2e-38
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 2e-27
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 8e-20
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 8e-09
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-38
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 3e-32
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-29
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-28
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 3e-23
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 5e-23
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 6e-18
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 3e-38
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 3e-37
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 1e-30
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 4e-38
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 7e-30
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 3e-27
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 6e-38
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 2e-31
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 7e-38
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 8e-38
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 5e-18
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 1e-17
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 1e-10
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 3e-08
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 9e-38
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-36
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 1e-28
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 3e-13
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 2e-37
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 2e-33
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 9e-26
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 4e-37
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 3e-27
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 3e-17
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 4e-37
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 9e-36
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 3e-26
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-18
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 5e-09
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 2e-36
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 2e-30
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 4e-28
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 4e-14
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 2e-36
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 7e-23
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 3e-36
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 1e-29
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 4e-36
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 5e-36
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 6e-36
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 7e-24
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 5e-36
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 9e-32
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 2e-35
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 2e-31
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 8e-14
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 3e-35
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 8e-27
2rfa_A232 Transient receptor potential cation channel subfa 4e-35
2rfa_A232 Transient receptor potential cation channel subfa 4e-25
2rfa_A232 Transient receptor potential cation channel subfa 3e-09
2rfa_A232 Transient receptor potential cation channel subfa 3e-06
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 8e-35
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 1e-31
3deo_A183 Signal recognition particle 43 kDa protein; chloro 1e-34
3deo_A183 Signal recognition particle 43 kDa protein; chloro 2e-29
3deo_A183 Signal recognition particle 43 kDa protein; chloro 1e-21
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-34
1awc_B153 Protein (GA binding protein beta 1); complex (tran 6e-27
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 8e-34
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 2e-20
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 2e-33
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 2e-29
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 2e-33
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 4e-30
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 5e-30
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 2e-21
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 4e-18
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 5e-33
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 9e-27
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 2e-24
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 6e-33
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 3e-29
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 7e-31
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 2e-23
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 2e-13
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 3e-30
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 4e-26
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 1e-16
1sw6_A327 Regulatory protein SWI6; transcription regulation, 6e-30
1sw6_A327 Regulatory protein SWI6; transcription regulation, 6e-24
1sw6_A327 Regulatory protein SWI6; transcription regulation, 1e-12
1sw6_A327 Regulatory protein SWI6; transcription regulation, 1e-11
1sw6_A327 Regulatory protein SWI6; transcription regulation, 5e-05
2ptm_A198 Hyperpolarization-activated (IH) channel; ION chan 4e-28
2etb_A256 Transient receptor potential cation channel subfam 5e-28
2etb_A256 Transient receptor potential cation channel subfam 1e-26
2etb_A256 Transient receptor potential cation channel subfam 1e-22
2etb_A256 Transient receptor potential cation channel subfam 1e-17
2etb_A256 Transient receptor potential cation channel subfam 2e-10
2etb_A256 Transient receptor potential cation channel subfam 4e-08
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 1e-27
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 2e-25
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 5e-22
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 5e-13
3bpz_A202 Potassium/sodium hyperpolarization-activated cycli 3e-27
4f8a_A160 Potassium voltage-gated channel subfamily H membe; 2e-26
3jxi_A260 Vanilloid receptor-related osmotically activated p 2e-25
3jxi_A260 Vanilloid receptor-related osmotically activated p 9e-23
3jxi_A260 Vanilloid receptor-related osmotically activated p 2e-15
3jxi_A260 Vanilloid receptor-related osmotically activated p 3e-05
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 3e-25
2pnn_A273 Transient receptor potential cation channel subfa 4e-25
2pnn_A273 Transient receptor potential cation channel subfa 1e-22
2pnn_A273 Transient receptor potential cation channel subfa 1e-20
2pnn_A273 Transient receptor potential cation channel subfa 5e-08
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 1e-24
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 1e-19
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 2e-19
3ukn_A212 Novel protein similar to vertebrate potassium VOL 2e-22
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 1e-19
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 5e-19
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 3e-14
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 5e-11
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 3e-08
3idb_B161 CAMP-dependent protein kinase type II-beta regulat 3e-18
3gyd_A187 CNMP-BD protein, cyclic nucleotide-binding domain; 1e-16
3tnp_B416 CAMP-dependent protein kinase type II-beta regula 2e-16
3tnp_B416 CAMP-dependent protein kinase type II-beta regula 7e-13
3mdp_A142 Cyclic nucleotide-binding domain (CNMP-BD) protei; 4e-16
2pqq_A149 Putative transcriptional regulator; APC7345, strep 9e-16
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 1e-15
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 4e-14
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 7e-13
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 5e-07
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 7e-06
3ldc_A82 Calcium-gated potassium channel MTHK; transmembran 5e-15
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 9e-15
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 1e-14
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 1e-13
3of1_A246 CAMP-dependent protein kinase regulatory subunit; 3e-14
3of1_A246 CAMP-dependent protein kinase regulatory subunit; 6e-14
2z69_A154 DNR protein; beta barrel, dimerization helix, tran 4e-14
4din_B381 CAMP-dependent protein kinase type I-beta regulat 1e-13
4din_B381 CAMP-dependent protein kinase type I-beta regulat 4e-12
3ocp_A139 PRKG1 protein; serine/threonine kinase, TF2I and I 1e-13
1orq_C223 Potassium channel; voltage-dependent, KVAP, FAB co 1e-13
3shr_A299 CGMP-dependent protein kinase 1; cyclic nucleotide 5e-13
3shr_A299 CGMP-dependent protein kinase 1; cyclic nucleotide 4e-12
3ouf_A97 Potassium channel protein; ION channel, membrane, 7e-13
3kcc_A260 Catabolite gene activator; helix-turn-helix, CAMP, 2e-12
3beh_A355 MLL3241 protein; transmembrane protein, membrane p 2e-12
2q67_A114 Potassium channel protein; inverted teepee, helix 2e-12
2d93_A134 RAP guanine nucleotide exchange factor 6; CNMP_bin 2e-12
1o5l_A213 Transcriptional regulator, CRP family; TM1171, str 2e-12
4ev0_A216 Transcription regulator, CRP family; CAMP binding, 2e-12
3fx3_A237 Cyclic nucleotide-binding protein; helix_TURN_heli 2e-12
1wgp_A137 Probable cyclic nucleotide-gated ION channel 6; cy 2e-12
3vou_A148 ION transport 2 domain protein, voltage-gated SOD 2e-12
3d0s_A227 Transcriptional regulatory protein; CAMP receptor 3e-12
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 3e-12
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 6e-11
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 8e-11
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 9e-06
3pna_A154 CAMP-dependent protein kinase type I-alpha regula 4e-12
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 4e-12
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 5e-12
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 6e-10
1vp6_A138 CNBD, cyclic-nucleotide binding domain of mesorhiz 4e-12
4ava_A333 Lysine acetyltransferase; allosteric regulation, d 5e-12
2qcs_B291 CAMP-dependent protein kinase type I-alpha regula 6e-12
2qcs_B291 CAMP-dependent protein kinase type I-alpha regula 6e-12
3ryp_A210 Catabolite gene activator; CAMP receptor protein ( 6e-12
3dkw_A227 DNR protein; CRP-FNR, HTH, beta barrel, dimerizati 2e-11
3e97_A231 Transcriptional regulator, CRP/FNR family; YP_6044 2e-11
1o7f_A469 CAMP-dependent RAP1 guanine-nucleotide exchange fa 2e-11
1o7f_A469 CAMP-dependent RAP1 guanine-nucleotide exchange fa 3e-09
1lnq_A336 MTHK channels, potassium channel related protein; 2e-11
1zyb_A232 Transcription regulator, CRP family; NP_813211.1, 2e-10
2gau_A232 Transcriptional regulator, CRP/FNR family; structu 3e-10
2k1e_A103 Water soluble analogue of potassium channel, KCSA; 5e-10
2fmy_A220 COOA, carbon monoxide oxidation system transcripti 2e-09
3iwz_A230 CAP-like, catabolite activation-like protein; XCC, 2e-09
3eff_K139 Voltage-gated potassium channel; FULL length KCSA, 2e-09
2r9r_B514 Paddle chimera voltage gated potassium channel KV; 2e-09
2ih3_C122 Voltage-gated potassium channel; ION channel D-ami 8e-09
3e6c_C250 CPRK, cyclic nucleotide-binding protein; CPRK, hal 8e-09
2a9h_A155 Voltage-gated potassium channel; potassium channel 1e-08
3spc_A343 Inward-rectifier K+ channel KIR2.2; PIP, membrane 1e-08
3pjs_K166 KCSA, voltage-gated potassium channel; ION channel 2e-08
1ft9_A222 Carbon monoxide oxidation system transcription reg 3e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-06
3dv8_A220 Transcriptional regulator, CRP/FNR family; cyclic 3e-08
2oz6_A207 Virulence factor regulator; winged helix, helix-tu 3e-08
2qks_A321 KIR3.1-prokaryotic KIR channel chimera; G-protein 5e-08
3sya_A340 G protein-activated inward rectifier potassium CH; 5e-08
2bgc_A238 PRFA; bacterial infection, human pathogen, transcr 1e-06
3la7_A243 Global nitrogen regulator; activator, DNA-binding, 1e-06
1xl4_A301 Inward rectifier potassium channel; integral membr 2e-06
3um7_A309 Potassium channel subfamily K member 4; potassium 2e-06
1p7b_A333 Integral membrane channel and cytosolic domains; t 3e-06
3ukm_A280 Potassium channel subfamily K member 1; membrane p 7e-06
3uo9_A534 Glutaminase kidney isoform, mitochondrial; hydrola 4e-05
3b02_A195 Transcriptional regulator, CRP family; structural 5e-05
2zcw_A202 TTHA1359, transcriptional regulator, FNR/CRP famil 6e-05
1ors_C132 Potassium channel; voltage-dependent, voltage sens 2e-04
2byv_E 999 RAP guanine nucleotide exchange factor 4; EPAC2, C 7e-04
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
 Score =  167 bits (425), Expect = 5e-45
 Identities = 54/180 (30%), Positives = 86/180 (47%), Gaps = 8/180 (4%)

Query: 533 LCFAALRGDDLLLHQLLKRGLDPNESDNNGRTALHIAASKGSENCVLLLLDYEADPNSID 592
           L  AA  G    +  LL++          G T LH+AA  G      LLL+ +A PN+  
Sbjct: 117 LHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAG 176

Query: 593 SDGNVPLWEAMLGGHENVIKLLMENHADINSGDVG-----HFACTAAEQNNLELLKEIVC 647
            +G  PL  A+   + +++KLL+      +S         H    AA+QN +E+ + ++ 
Sbjct: 177 KNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHI---AAKQNQVEVARSLLQ 233

Query: 648 YGGDVTRQRNNGSTALHVAVCEDNVEIVRFLLDQKADVDKPDVHGWTPRDLADQQGHEEI 707
           YGG    +   G T LH+A  E + E+V  LL ++A+ +  +  G TP  L  Q+GH  +
Sbjct: 234 YGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPV 293


>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>2ptm_A Hyperpolarization-activated (IH) channel; ION channel, cyclic nucleotide binding domain, C-linker, CAM SPHCN1, HCN; HET: CMP; 1.93A {Strongylocentrotus purpuratus} Length = 198 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3bpz_A Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2; CNBD, C-linker, pacemaker, HCN, HCN2, CAP, PKA, CAMP, ION channel; HET: CMP; 1.65A {Mus musculus} PDB: 3ffq_A 1q3e_A* 1q43_A* 1q5o_A* 3u10_A* 2q0a_A* 3etq_A* 3u11_A* 3otf_A* 3u0z_A* Length = 202 Back     alignment and structure
>4f8a_A Potassium voltage-gated channel subfamily H membe; probable regulatory domain of potassium channel, membrane PR transport protein; 2.20A {Mus musculus} Length = 160 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>3ukn_A Novel protein similar to vertebrate potassium VOL channel, subfamily H (EAG-related)...; KCNH, ELK, ERG, CNBD, CNBHD, C-linker, ION channel; 2.20A {Danio rerio} PDB: 3ukt_B 3ukv_B Length = 212 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>3idb_B CAMP-dependent protein kinase type II-beta regulatory subunit, CAMP-dependent protein kinase catalytic subunit alpha; PKA, SPR, affinity; HET: TPO SEP ANP; 1.62A {Rattus norvegicus} PDB: 3idc_B* Length = 161 Back     alignment and structure
>3gyd_A CNMP-BD protein, cyclic nucleotide-binding domain; nucleotide binding protein, structural genomics; HET: MSE CMP; 1.79A {Methylobacillus flagellatus KT} Length = 187 Back     alignment and structure
>3tnp_B CAMP-dependent protein kinase type II-beta regula subunit; PKA RIIB tetrameric holoenzyme, transferase; HET: SEP TPO; 2.30A {Mus musculus} PDB: 3tnq_A* 1cx4_A* 2qvs_B* Length = 416 Back     alignment and structure
>3tnp_B CAMP-dependent protein kinase type II-beta regula subunit; PKA RIIB tetrameric holoenzyme, transferase; HET: SEP TPO; 2.30A {Mus musculus} PDB: 3tnq_A* 1cx4_A* 2qvs_B* Length = 416 Back     alignment and structure
>3mdp_A Cyclic nucleotide-binding domain (CNMP-BD) protei; structural genomics, joint center for structural genomics; HET: MSE; 1.90A {Geobacter metallireducens} Length = 142 Back     alignment and structure
>2pqq_A Putative transcriptional regulator; APC7345, streptomyces coelicolor structural genomics, PSI-2, protein structure initiative; 2.00A {Streptomyces coelicolor A3} Length = 149 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>3ldc_A Calcium-gated potassium channel MTHK; transmembrane, ION channel, open conformation, IO transport; 1.45A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3lde_A 3r65_A 3ous_A 3ldd_A Length = 82 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>3of1_A CAMP-dependent protein kinase regulatory subunit; cyclic nucleotide binding domain, evolution, PKA signaling, transfer; HET: CMP; 2.21A {Saccharomyces cerevisiae} Length = 246 Back     alignment and structure
>3of1_A CAMP-dependent protein kinase regulatory subunit; cyclic nucleotide binding domain, evolution, PKA signaling, transfer; HET: CMP; 2.21A {Saccharomyces cerevisiae} Length = 246 Back     alignment and structure
>2z69_A DNR protein; beta barrel, dimerization helix, transcription regulator; 2.10A {Pseudomonas aeruginosa} Length = 154 Back     alignment and structure
>4din_B CAMP-dependent protein kinase type I-beta regulat subunit, CAMP-dependent protein kinase catalytic subunit A; isoform diversity; HET: TPO SEP ATP; 3.70A {Homo sapiens} Length = 381 Back     alignment and structure
>4din_B CAMP-dependent protein kinase type I-beta regulat subunit, CAMP-dependent protein kinase catalytic subunit A; isoform diversity; HET: TPO SEP ATP; 3.70A {Homo sapiens} Length = 381 Back     alignment and structure
>3ocp_A PRKG1 protein; serine/threonine kinase, TF2I and IRAG, transferase; HET: CMP; 2.49A {Homo sapiens} PDB: 3od0_A* 3ogj_A* Length = 139 Back     alignment and structure
>1orq_C Potassium channel; voltage-dependent, KVAP, FAB complex, MEM protein; 3.20A {Aeropyrum pernix} SCOP: f.14.1.1 PDB: 2a0l_A Length = 223 Back     alignment and structure
>3shr_A CGMP-dependent protein kinase 1; cyclic nucleotide binding domains, cyclic nucleotide protein transferase, PKG; HET: CMP; 2.50A {Bos taurus} Length = 299 Back     alignment and structure
>3shr_A CGMP-dependent protein kinase 1; cyclic nucleotide binding domains, cyclic nucleotide protein transferase, PKG; HET: CMP; 2.50A {Bos taurus} Length = 299 Back     alignment and structure
>3ouf_A Potassium channel protein; ION channel, membrane, membrane protein; 1.55A {Bacillus cereus} PDB: 3t4z_A 3tcu_A 3t1c_A 3tet_A 3t4d_A 3t2m_A 3e86_A 3e83_A 3e89_A 3e8b_A 3e8f_A 3e8g_A 3e8h_A 3k0d_A 3k0g_A 3k06_A 3k08_A 3k04_A 3k03_A Length = 97 Back     alignment and structure
>3kcc_A Catabolite gene activator; helix-turn-helix, CAMP, CAMP-binding, DNA-binding nucleotide-binding, transcription, transcription regulation; HET: CMP; 1.66A {Escherichia coli} Length = 260 Back     alignment and structure
>3beh_A MLL3241 protein; transmembrane protein, membrane protein; HET: LDA; 3.10A {Mesorhizobium loti} PDB: 2zd9_A* Length = 355 Back     alignment and structure
>2q67_A Potassium channel protein; inverted teepee, helix bundle, tetramer, central cavity, ION metal transport, membrane protein; 2.30A {Bacillus cereus} PDB: 2q68_A 2q6a_A 2q69_A 2ahy_A 2ahz_A Length = 114 Back     alignment and structure
>2d93_A RAP guanine nucleotide exchange factor 6; CNMP_binding domain, PDZ domain containing guanine nucleotide exchange factor 2, PDZ-GEF2, RA-GEF-2; NMR {Homo sapiens} Length = 134 Back     alignment and structure
>1o5l_A Transcriptional regulator, CRP family; TM1171, structural GE JCSG, PSI, protein structure initiative, joint center for S genomics; 2.30A {Thermotoga maritima} SCOP: b.82.3.2 Length = 213 Back     alignment and structure
>4ev0_A Transcription regulator, CRP family; CAMP binding, winged helix-turn-helix motif, DNA binding, transcription activator; HET: CMP; 2.40A {Thermus thermophilus} Length = 216 Back     alignment and structure
>3fx3_A Cyclic nucleotide-binding protein; helix_TURN_helix, CAMP regulatory protein, structural genomi 2, protein structure initiative; 2.20A {Ruegeria pomeroyi} PDB: 3h3z_A* Length = 237 Back     alignment and structure
>1wgp_A Probable cyclic nucleotide-gated ION channel 6; cyclic nucleotide monophosphate, CNMP, CNMP-binding, structural genomics; NMR {Arabidopsis thaliana} SCOP: b.82.3.2 Length = 137 Back     alignment and structure
>3vou_A ION transport 2 domain protein, voltage-gated SOD channel; 4-helical bundle, ION channel, membrane, transport protein; 3.20A {Bacillus weihenstephanensis} Length = 148 Back     alignment and structure
>3d0s_A Transcriptional regulatory protein; CAMP receptor protein (CRP), dimer, inactive(APO, unliganded allostery, DNA binding, cyclic AMP; 2.00A {Mycobacterium tuberculosis} PDB: 3i54_A* 3i59_A* 3mzh_A* 3h3u_A* 3r6s_A* Length = 227 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>3pna_A CAMP-dependent protein kinase type I-alpha regula subunit; beta-barrel, CAMP-binding, catalytic subunit, transferase; HET: CMP; 1.50A {Bos taurus} PDB: 3fhi_B* 3iia_A 3plq_A* 1u7e_B* 3pvb_B* Length = 154 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>1vp6_A CNBD, cyclic-nucleotide binding domain of mesorhizobium LOTI CNG potassium channel; dimer helical bundle beta barrel core with cyclic AMP bound; HET: CMP; 1.70A {Mesorhizobium loti} SCOP: b.82.3.2 PDB: 3cl1_A* 2k0g_A* 2kxl_A 3clp_A* 1u12_A 3co2_A Length = 138 Back     alignment and structure
>4ava_A Lysine acetyltransferase; allosteric regulation, domain coupling; HET: ACO; 1.70A {Mycobacterium tuberculosis} PDB: 4avb_A* 4avc_A* Length = 333 Back     alignment and structure
>2qcs_B CAMP-dependent protein kinase type I-alpha regula subunit, CAMP-dependent protein kinase, alpha-catalytic SU; cyclic adenosine monophosphate; HET: SEP TPO ANP TAM; 2.20A {Bos taurus} PDB: 1rl3_A* 1rgs_A* 1ne6_A* 1ne4_A* Length = 291 Back     alignment and structure
>2qcs_B CAMP-dependent protein kinase type I-alpha regula subunit, CAMP-dependent protein kinase, alpha-catalytic SU; cyclic adenosine monophosphate; HET: SEP TPO ANP TAM; 2.20A {Bos taurus} PDB: 1rl3_A* 1rgs_A* 1ne6_A* 1ne4_A* Length = 291 Back     alignment and structure
>3ryp_A Catabolite gene activator; CAMP receptor protein (CRP), allostery, DNA binding cyclic A transcription regulator; HET: CMP; 1.60A {Escherichia coli} PDB: 2cgp_A* 3hif_A 1g6n_A* 3ryr_A* 1i5z_A* 1j59_A* 1lb2_A* 1run_A* 1zrc_A* 1zrd_A* 1zre_A* 1zrf_A* 2gzw_A* 2wc2_A 3iyd_G* 3n4m_A* 3qop_A* 3rdi_A* 3rou_A* 3rpq_A* ... Length = 210 Back     alignment and structure
>3dkw_A DNR protein; CRP-FNR, HTH, beta barrel, dimerization helix, homodimer, transcription regulator; 3.60A {Pseudomonas aeruginosa} Length = 227 Back     alignment and structure
>3e97_A Transcriptional regulator, CRP/FNR family; YP_604437.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.86A {Deinococcus geothermalis dsm 11300} Length = 231 Back     alignment and structure
>1o7f_A CAMP-dependent RAP1 guanine-nucleotide exchange factor; EPAC2, CAMP-GEF2, campb binding doamin, regulation; 2.5A {Mus musculus} SCOP: a.4.5.31 b.82.3.2 b.82.3.2 Length = 469 Back     alignment and structure
>1o7f_A CAMP-dependent RAP1 guanine-nucleotide exchange factor; EPAC2, CAMP-GEF2, campb binding doamin, regulation; 2.5A {Mus musculus} SCOP: a.4.5.31 b.82.3.2 b.82.3.2 Length = 469 Back     alignment and structure
>1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A Length = 336 Back     alignment and structure
>1zyb_A Transcription regulator, CRP family; NP_813211.1, structural genomics, joint center for structura genomics, JCSG; 2.15A {Bacteroides thetaiotaomicron} SCOP: a.4.5.4 b.82.3.2 Length = 232 Back     alignment and structure
>2gau_A Transcriptional regulator, CRP/FNR family; structural genomics, porphyromona gingivalis, PSI, protein structure initiative; 1.90A {Porphyromonas gingivalis} SCOP: a.4.5.4 b.82.3.2 Length = 232 Back     alignment and structure
>2k1e_A Water soluble analogue of potassium channel, KCSA; homotetramer, ION transport, ionic channel, membrane, transmembrane, transport; NMR {Escherichia coli} PDB: 2kb1_A Length = 103 Back     alignment and structure
>2fmy_A COOA, carbon monoxide oxidation system transcription RE COOA-1; DNA transcription regulator, DNA binding protein; HET: HEM; 2.20A {Carboxydothermus hydrogenoformans} PDB: 2hkx_A* Length = 220 Back     alignment and structure
>3iwz_A CAP-like, catabolite activation-like protein; XCC, pathogenicity, CRP, CLP, C-DI-GMP receptor, quorum SENS binding, transcription; 2.30A {Xanthomonas campestris PV} Length = 230 Back     alignment and structure
>3eff_K Voltage-gated potassium channel; FULL length KCSA, bulge helix, cell membrane, ION transport, ionic channel, membrane, transmembrane; 3.80A {Streptomyces lividans} Length = 139 Back     alignment and structure
>2r9r_B Paddle chimera voltage gated potassium channel KV; voltage sensor, voltage dependent, ION CH shaker, membrane protein, eukaryotic; HET: NAP PGW; 2.40A {Rattus norvegicus} PDB: 3lnm_B* 3lut_B* 2a79_B* Length = 514 Back     alignment and structure
>2ih3_C Voltage-gated potassium channel; ION channel D-amino acid semi-synthetic, membrane protein; HET: 1EM; 1.72A {Streptomyces lividans} PDB: 2ih1_C* 1r3j_C* 1k4d_C* 1r3i_C* 1k4c_C* 1r3k_C* 1r3l_C* 2bob_C* 2boc_C* 2hvj_C* 2hvk_C* 2itc_C 2itd_C 3gb7_C* 3iga_C* 1jvm_A 1s5h_C* 3ifx_A* 1j95_A 2jk5_C* ... Length = 122 Back     alignment and structure
>3e6c_C CPRK, cyclic nucleotide-binding protein; CPRK, halorespiration; HET: DNA 3C4; 1.80A {Desulfitobacterium hafniense} SCOP: a.4.5.4 b.82.3.2 PDB: 3e6b_A* 3e5u_C* 3e6d_A 3e5x_A* 3e5q_A 2h6b_A* 2h6c_A Length = 250 Back     alignment and structure
>2a9h_A Voltage-gated potassium channel; potassium channel, KCSA, structure, membrane protein, metal transport; HET: PCA; NMR {Streptomyces lividans} SCOP: f.14.1.1 Length = 155 Back     alignment and structure
>3spc_A Inward-rectifier K+ channel KIR2.2; PIP, membrane protein, lipid, receptor, metal transport; HET: P8P; 2.45A {Gallus gallus} PDB: 3jyc_A* 3spi_A* 3sph_A* 3spj_A 3spg_A* Length = 343 Back     alignment and structure
>3pjs_K KCSA, voltage-gated potassium channel; ION channel, conducts K+ IONS, cell membrane, transport PROT; 3.80A {Streptomyces lividans} PDB: 1f6g_A Length = 166 Back     alignment and structure
>1ft9_A Carbon monoxide oxidation system transcription regulator; heme sensor, catabolite gene activator protein; HET: HEM; 2.60A {Rhodospirillum rubrum} SCOP: a.4.5.4 b.82.3.1 Length = 222 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3dv8_A Transcriptional regulator, CRP/FNR family; cyclic nucleotide-binding domain, structural genomics, joint for structural genomics; 2.55A {Eubacterium rectale atcc 33656} Length = 220 Back     alignment and structure
>2oz6_A Virulence factor regulator; winged helix, helix-turn-helix, transcription factor, CAMP-B proteins, CAMP receptor protein; HET: CMP; 2.80A {Pseudomonas aeruginosa} SCOP: a.4.5.4 b.82.3.2 Length = 207 Back     alignment and structure
>2qks_A KIR3.1-prokaryotic KIR channel chimera; G-protein gated inward rectifier, potassium channel selectivity filter, metal transport; HET: BNG; 2.20A {Burkholderia xenovorans} Length = 321 Back     alignment and structure
>3sya_A G protein-activated inward rectifier potassium CH; ION channel, potassium channel, inward rectification, sodium PIP2 binding, G protein binding; HET: PIO; 2.98A {Mus musculus} PDB: 3syo_A 3syc_A 3syp_A 3syq_A* Length = 340 Back     alignment and structure
>2bgc_A PRFA; bacterial infection, human pathogen, transcriptional regulat transcription; HET: PR3; 2.3A {Listeria monocytogenes} SCOP: a.4.5.4 b.82.3.3 PDB: 2beo_A* 1omi_A Length = 238 Back     alignment and structure
>3la7_A Global nitrogen regulator; activator, DNA-binding, transcription, transcription regulation; HET: BOG; 1.90A {Anabaena} PDB: 3la2_A* 3la3_A* 2xko_A* 2xgx_A* 2xhk_A* 2xkp_A* Length = 243 Back     alignment and structure
>1xl4_A Inward rectifier potassium channel; integral membrane protein, ION channel, inwardly rectifying channel, metal transport; 2.60A {Magnetospirillum magnetotacticum} SCOP: b.1.18.16 f.14.1.1 PDB: 1xl6_A* 2wlh_A 2wli_B 2wlj_A* 2wlk_A* 2wlm_A 2wlo_A 2wln_A 3zrs_A 2wli_A 2x6c_A* 2x6b_A* 2x6a_A* Length = 301 Back     alignment and structure
>3um7_A Potassium channel subfamily K member 4; potassium ION channel, metal transport; 3.31A {Homo sapiens} Length = 309 Back     alignment and structure
>1p7b_A Integral membrane channel and cytosolic domains; transmembrane helices, ION conduction, immunoglobulin fold, assembly; 3.65A {Burkholderia pseudomallei} SCOP: b.1.18.16 f.14.1.1 PDB: 2wll_B* 2wll_A* Length = 333 Back     alignment and structure
>3ukm_A Potassium channel subfamily K member 1; membrane protein, eukaryotic, two-pore DO potassium channel, K2P channel, membrane; HET: UND; 3.40A {Homo sapiens} Length = 280 Back     alignment and structure
>3uo9_A Glutaminase kidney isoform, mitochondrial; hydrolase-hydrolase inhibitor complex; HET: 04A; 2.30A {Homo sapiens} PDB: 3unw_A* 3ss3_A 3ss4_A 3ss5_A* Length = 534 Back     alignment and structure
>3b02_A Transcriptional regulator, CRP family; structural genomics, riken structural genomics/proteomics in RSGI; 1.92A {Thermus thermophilus} PDB: 2zdb_A Length = 195 Back     alignment and structure
>2zcw_A TTHA1359, transcriptional regulator, FNR/CRP family; stationary phase, DNA-binding, transcription regulation; 1.50A {Thermus thermophilus} Length = 202 Back     alignment and structure
>1ors_C Potassium channel; voltage-dependent, voltage sensor, KVAP, FAB complex, membrane protein; 1.90A {Aeropyrum pernix} SCOP: f.14.1.1 Length = 132 Back     alignment and structure
>2byv_E RAP guanine nucleotide exchange factor 4; EPAC2, CAMP-GEF2, CAMP, cyclic nucleotide, regulation, auto-inhibition, CDC25 homology domain; 2.7A {Mus musculus} Length = 999 Back     alignment and structure

Structure Templates Detected by HHsearch ?

No hit with probability above 80.00


Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 883
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-34
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-27
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 6e-27
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-22
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-21
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 4e-16
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 5e-16
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 4e-28
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 4e-15
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-05
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 3e-24
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 7e-11
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 3e-10
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 5e-05
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 2e-23
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 2e-22
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 5e-19
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 1e-17
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 2e-13
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 2e-10
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 6e-08
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 8e-07
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 8e-21
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 2e-17
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 3e-16
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 2e-15
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 6e-10
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 4e-05
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 7e-19
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 4e-11
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 3e-10
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 5e-09
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 8e-04
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 1e-18
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 4e-16
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 2e-12
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 3e-09
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 8e-08
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 3e-18
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 8e-11
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 3e-08
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 2e-04
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 7e-17
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 3e-07
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 7e-07
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 7e-07
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 1e-15
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 2e-13
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 3e-05
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 2e-15
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 5e-14
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 2e-12
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 1e-09
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 2e-09
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 2e-05
d1lnqa280 f.14.1.1 (A:19-98) Potassium channel-related prote 4e-15
d1q3ea_193 b.82.3.2 (A:) HCN pacemaker channel {Mouse (Mus mu 1e-14
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 2e-13
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 5e-09
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 0.003
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 3e-13
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 1e-08
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 6e-05
d1cx4a1136 b.82.3.2 (A:130-265) Regulatory subunit of Protein 2e-12
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-12
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 4e-09
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 3e-08
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-07
d1ne6a1136 b.82.3.2 (A:109-244) Regulatory subunit of Protein 4e-12
d1cx4a2147 b.82.3.2 (A:266-412) Regulatory subunit of Protein 7e-12
d1r3jc_103 f.14.1.1 (C:) Potassium channel protein {Streptomy 7e-12
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 1e-11
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 7e-06
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 7e-04
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 3e-11
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 4e-10
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 0.001
d1p7ba2116 f.14.1.1 (A:36-151) Inward rectifier potassium cha 3e-10
d1o7fa2155 b.82.3.2 (A:13-167) Regulatory domain of Epac2, do 6e-10
d1xl4a2116 f.14.1.1 (A:23-138) Inward rectifier potassium cha 3e-09
d1o7fa3124 b.82.3.2 (A:322-445) Regulatory domain of Epac2, d 3e-09
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 1e-08
d1vp6a_133 b.82.3.2 (A:) Putative ion channel CnbD {Mesorhizo 2e-08
d2gaua2142 b.82.3.2 (A:10-151) Transcriptional regulator PG03 5e-08
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 1e-07
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 0.002
d1wgpa_137 b.82.3.2 (A:) Probable cyclic nucleotide-gated ion 2e-07
d1ne6a2132 b.82.3.2 (A:245-376) Regulatory subunit of Protein 2e-07
d2oz6a2134 b.82.3.2 (A:9-142) Cyclic AMP receptor-like protei 4e-07
d1i5za2132 b.82.3.2 (A:6-137) Catabolite gene activator prote 7e-07
d1myoa_118 d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) 2e-04
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  134 bits (338), Expect = 1e-34
 Identities = 51/183 (27%), Positives = 80/183 (43%), Gaps = 2/183 (1%)

Query: 533 LCFAALRGDDLLLHQLLKRGLDPNESDNNGRTALHIAASKGSENCVLLLLDYEADPNSID 592
           L  A+  G   ++  LL+RG  PN S+    T LH+AA  G       LL  +A  N+  
Sbjct: 4   LHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKA 63

Query: 593 SDGNVPLWEAMLGGHENVIKLLMENHADI--NSGDVGHFACTAAEQNNLELLKEIVCYGG 650
            D   PL  A   GH N++KLL+EN+A+    +         AA + ++E +  ++    
Sbjct: 64  KDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEA 123

Query: 651 DVTRQRNNGSTALHVAVCEDNVEIVRFLLDQKADVDKPDVHGWTPRDLADQQGHEEIKCI 710
                   G T LHVA     V +   LL++ A  +    +G TP  +A    + +I  +
Sbjct: 124 SQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKL 183

Query: 711 FQS 713
              
Sbjct: 184 LLP 186


>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1lnqa2 f.14.1.1 (A:19-98) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Length = 80 Back     information, alignment and structure
>d1q3ea_ b.82.3.2 (A:) HCN pacemaker channel {Mouse (Mus musculus) [TaxId: 10090]} Length = 193 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1cx4a1 b.82.3.2 (A:130-265) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 136 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ne6a1 b.82.3.2 (A:109-244) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]} Length = 136 Back     information, alignment and structure
>d1cx4a2 b.82.3.2 (A:266-412) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 147 Back     information, alignment and structure
>d1r3jc_ f.14.1.1 (C:) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]} Length = 103 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1p7ba2 f.14.1.1 (A:36-151) Inward rectifier potassium channel Kirbac1.1 {Burkholderia pseudomallei [TaxId: 28450]} Length = 116 Back     information, alignment and structure
>d1o7fa2 b.82.3.2 (A:13-167) Regulatory domain of Epac2, domains 1 and 3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 155 Back     information, alignment and structure
>d1xl4a2 f.14.1.1 (A:23-138) Inward rectifier potassium channel kirbac3.1 {Magnetospirillum magnetotacticum [TaxId: 188]} Length = 116 Back     information, alignment and structure
>d1o7fa3 b.82.3.2 (A:322-445) Regulatory domain of Epac2, domains 1 and 3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 124 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1vp6a_ b.82.3.2 (A:) Putative ion channel CnbD {Mesorhizobium loti [TaxId: 381]} Length = 133 Back     information, alignment and structure
>d2gaua2 b.82.3.2 (A:10-151) Transcriptional regulator PG0396, N-terminal domain {Porphyromonas gingivalis [TaxId: 837]} Length = 142 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1wgpa_ b.82.3.2 (A:) Probable cyclic nucleotide-gated ion channel 6 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 137 Back     information, alignment and structure
>d1ne6a2 b.82.3.2 (A:245-376) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]} Length = 132 Back     information, alignment and structure
>d2oz6a2 b.82.3.2 (A:9-142) Cyclic AMP receptor-like protein Vfr {Pseudomonas aeruginosa [TaxId: 287]} Length = 134 Back     information, alignment and structure
>d1i5za2 b.82.3.2 (A:6-137) Catabolite gene activator protein, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 132 Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 118 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query883
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 100.0
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1q3ea_193 HCN pacemaker channel {Mouse (Mus musculus) [TaxId 99.98
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.98
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.97
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.97
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.97
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.97
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.96
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.96
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.95
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.95
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.94
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.94
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.94
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.93
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.93
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.92
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.92
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.92
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.91
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.9
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.9
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.88
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.88
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.86
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.83
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.83
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.83
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.83
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.81
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.81
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.81
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.8
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.8
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.79
d1cx4a2147 Regulatory subunit of Protein kinase A {Rat (Rattu 99.77
d1cx4a1136 Regulatory subunit of Protein kinase A {Rat (Rattu 99.77
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.76
d1ne6a2132 Regulatory subunit of Protein kinase A {Cow (Bos t 99.73
d1ne6a1136 Regulatory subunit of Protein kinase A {Cow (Bos t 99.73
d1o7fa2155 Regulatory domain of Epac2, domains 1 and 3 {Mouse 99.72
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.72
d1zyba2147 Probable transcription regulator BT4300, N-termina 99.7
d1vp6a_133 Putative ion channel CnbD {Mesorhizobium loti [Tax 99.7
d1wgpa_137 Probable cyclic nucleotide-gated ion channel 6 {Th 99.69
d1o7fa3124 Regulatory domain of Epac2, domains 1 and 3 {Mouse 99.67
d2gaua2142 Transcriptional regulator PG0396, N-terminal domai 99.65
d1r3jc_103 Potassium channel protein {Streptomyces coelicolor 99.57
d1i5za2132 Catabolite gene activator protein, N-terminal doma 99.56
d2oz6a2134 Cyclic AMP receptor-like protein Vfr {Pseudomonas 99.55
d1ft9a2132 CO-sensing protein CooA, N-terminal domain {Rhodos 99.5
d3e5ua2139 Chlorophenol reduction protein CprK {Desulfitobact 99.5
d1o5la1129 CRP-like transcriptional regulator TM1171, N-termi 99.47
d1xl4a2116 Inward rectifier potassium channel kirbac3.1 {Magn 99.39
d1p7ba2116 Inward rectifier potassium channel Kirbac1.1 {Burk 99.33
d2zcwa2112 Transcriptional regulator TTHA1359, N-terminal dom 99.31
d1lnqa280 Potassium channel-related protein MthK {Archaeon M 98.81
d1orsc_132 Potassium channel KVAP {Archaeon Aeropyrum pernix 98.28
d2h8pc157 Potassium channel protein {Streptomyces coelicolor 98.08
d1d4ba_122 Cell death-inducing effector B (CIDE-B), N-termina 90.94
d1f2ri_100 Inhibitor of caspase-activated DNase (ICAD), DFF45 83.62
d1c9fa_87 Caspase-activated DNase (CAD), DFF40, N-terminal d 82.3
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Transcription factor inhibitor I-kappa-B-beta, IKBB
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=100.00  E-value=3.5e-33  Score=239.30  Aligned_cols=192  Identities=21%  Similarity=0.197  Sum_probs=175.1

Q ss_pred             CCCHHHHHHHHHCCCHHHHHHHHHCCCC---CCCCCCCCCCHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCCCCHHHHHH
Q ss_conf             7731688999862999999999986999---9878899995999999719999999998199999878999998789999
Q 002763          527 MDLPLSLCFAALRGDDLLLHQLLKRGLD---PNESDNNGRTALHIAASKGSENCVLLLLDYEADPNSIDSDGNVPLWEAM  603 (883)
Q Consensus       527 ~d~~t~L~~Aa~~g~~~~v~~Ll~~g~d---~n~~d~~g~tpLh~Aa~~g~~~~v~~Ll~~ga~~n~~d~~g~tpL~~A~  603 (883)
                      .||.|+||.||..|+.++++.|++.|++   ++..|.+|.||||+||..|+.+++++|+++|++++.+|..|.||||.|+
T Consensus         7 ~~G~t~Lh~A~~~~~~~~v~~Ll~~~a~~~~i~~~~~~g~TpL~~A~~~g~~~iv~~Ll~~ga~i~~~d~~g~tpL~~A~   86 (255)
T d1oy3d_           7 EDGDTALHLAVIHQHEPFLDFLLGFSAGHEYLDLQNDLGQTALHLAAILGEASTVEKLYAAGAGVLVAERGGHTALHLAC   86 (255)
T ss_dssp             TTCCCHHHHHHHTTCHHHHHHHHHHHTTSGGGGCCCTTSCCHHHHHHHHTCHHHHHHHHHTTCCSSCCCTTSCCHHHHHT
T ss_pred             CCCCCHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHH
T ss_conf             59978999999858899999999869990011575899997240687624543232222333332232222210233332


Q ss_pred             HCCCHHHHHHHHHCCCCCCC-------------------------------------------------CCCCHHHHHHH
Q ss_conf             82969999999983999899-------------------------------------------------99633688999
Q 002763          604 LGGHENVIKLLMENHADINS-------------------------------------------------GDVGHFACTAA  634 (883)
Q Consensus       604 ~~g~~~~v~~Ll~~ga~~~~-------------------------------------------------~d~~~~l~~a~  634 (883)
                      ..++.+++++|++.+.....                                                 .++.++++.|+
T Consensus        87 ~~~~~~~~~~Ll~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~in~~d~~g~TpLh~A~  166 (255)
T d1oy3d_          87 RVRAHTCACVLLQPRPSHPRDASDTYLTQSQDCTPDTSHAPAAVDSQPNPENEEEPRDEDWRLQLEAENYDGHTPLHVAV  166 (255)
T ss_dssp             TTTCHHHHHHHSSSCCSSCCCC-----------------------------------CCCGGGGTTCCCTTSCCHHHHHH
T ss_pred             CCCCHHHHHHHHHHCCCHHCCCCHHHHHHHHHHCCCCHHHHHHHHHHCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCC
T ss_conf             26825899999861420101220256667765224306779999862030678998765328663310046763223332


Q ss_pred             HHCCHHHHHHHHHCCCCCCCC-CCCCCHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHCCCHHHHHHHHH
Q ss_conf             719999999999739984335-8999708899998199999999984999999999999998899997499989999850
Q 002763          635 EQNNLELLKEIVCYGGDVTRQ-RNNGSTALHVAVCEDNVEIVRFLLDQKADVDKPDVHGWTPRDLADQQGHEEIKCIFQS  713 (883)
Q Consensus       635 ~~~~~~~~~~Ll~~g~d~~~~-d~~g~T~Lh~A~~~g~~~~v~~Ll~~ga~i~~~d~~G~Tpl~~A~~~~~~~i~~~L~~  713 (883)
                      ..++.++++.|++.+.+.+.. +..|.||||+|+..|+.+++++|+++|++++.+|..|.||||+|+..++.+++++|++
T Consensus       167 ~~~~~~~v~~Ll~~~~~~~~~~~~~g~TpL~~A~~~~~~~~v~~Ll~~gadin~~d~~g~t~L~~A~~~~~~~i~~~Ll~  246 (255)
T d1oy3d_         167 IHKDAEMVRLLRDAGADLNKPEPTCGRTPLHLAVEAQAASVLELLLKAGADPTARMYGGRTPLGSALLRPNPILARLLRA  246 (255)
T ss_dssp             HTTCHHHHHHHHHHTCCTTCCCTTTCCCHHHHHHHTTCHHHHHHHHHTTCCTTCCCTTSCCHHHHHHTSSCHHHHHHHHH
T ss_pred             CCCCCCCCCCHHCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHCCCHHHHHHHHH
T ss_conf             23222222100001333122133444332200123339999999998789988879999999999998788999999997


Q ss_pred             CCCCC
Q ss_conf             21122
Q 002763          714 CKETK  718 (883)
Q Consensus       714 ~~~~~  718 (883)
                      +|+..
T Consensus       247 ~Ga~~  251 (255)
T d1oy3d_         247 HGAPE  251 (255)
T ss_dssp             TTCCC
T ss_pred             CCCCC
T ss_conf             69899



>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q3ea_ b.82.3.2 (A:) HCN pacemaker channel {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1cx4a2 b.82.3.2 (A:266-412) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1cx4a1 b.82.3.2 (A:130-265) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ne6a2 b.82.3.2 (A:245-376) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ne6a1 b.82.3.2 (A:109-244) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1o7fa2 b.82.3.2 (A:13-167) Regulatory domain of Epac2, domains 1 and 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zyba2 b.82.3.2 (A:1-147) Probable transcription regulator BT4300, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1vp6a_ b.82.3.2 (A:) Putative ion channel CnbD {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1wgpa_ b.82.3.2 (A:) Probable cyclic nucleotide-gated ion channel 6 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1o7fa3 b.82.3.2 (A:322-445) Regulatory domain of Epac2, domains 1 and 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2gaua2 b.82.3.2 (A:10-151) Transcriptional regulator PG0396, N-terminal domain {Porphyromonas gingivalis [TaxId: 837]} Back     information, alignment and structure
>d1r3jc_ f.14.1.1 (C:) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1i5za2 b.82.3.2 (A:6-137) Catabolite gene activator protein, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2oz6a2 b.82.3.2 (A:9-142) Cyclic AMP receptor-like protein Vfr {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ft9a2 b.82.3.1 (A:2-133) CO-sensing protein CooA, N-terminal domain {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d3e5ua2 b.82.3.2 (A:9-147) Chlorophenol reduction protein CprK {Desulfitobacterium hafniense [TaxId: 49338]} Back     information, alignment and structure
>d1o5la1 b.82.3.2 (A:1-129) CRP-like transcriptional regulator TM1171, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xl4a2 f.14.1.1 (A:23-138) Inward rectifier potassium channel kirbac3.1 {Magnetospirillum magnetotacticum [TaxId: 188]} Back     information, alignment and structure
>d1p7ba2 f.14.1.1 (A:36-151) Inward rectifier potassium channel Kirbac1.1 {Burkholderia pseudomallei [TaxId: 28450]} Back     information, alignment and structure
>d1lnqa2 f.14.1.1 (A:19-98) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d1orsc_ f.14.1.1 (C:) Potassium channel KVAP {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2h8pc1 f.14.1.1 (C:22-78) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1d4ba_ d.15.2.1 (A:) Cell death-inducing effector B (CIDE-B), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f2ri_ d.15.2.1 (I:) Inhibitor of caspase-activated DNase (ICAD), DFF45, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1c9fa_ d.15.2.1 (A:) Caspase-activated DNase (CAD), DFF40, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure