Citrus Sinensis ID: 002771

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880--
MGYLTQPYQLVICLQLSLLFFQCSAKLCSQEQSSALLQFKQLFSFAKTSSSQCDGYQQSYPKMKYWKEDADCCSSWDGVTCDMVTGQVIGLDLSCSWLHGSISSNSSLFFLPRLQKLNLGSNDFNYSKISSGFSQLRSLTLLNLSSSNFTGSIPPSLGNLTQLVYLDLSNNSFIGEIPNMFTNQSKLSYLNFGGNQLTGQIPSSVGELANLATVYLYFNSLKGTIPSRIFSLTSLKQVDFRHNQLSGSVPSSVYELVNLTRLDLSSNKLSGTVELYDFAKLKNLKWLVLSNNSLSLTTKLTVSSSFLNLSRLGLSACKISKFPVILKTQLQLEWLDLSENQIHGRVPGWMWDVGIHTLSYLDLSQNFLRSIKRLPWKNLKNLYLDSNLLRGRLLDLPPLMTIFSISNNYLTGEIPSSFCNLSSIQYLEMSNNSFSGQIPQCLVNSTVKFLDLRMNNFQGIIPQTYAKDCNLTFLKLNGNKLEGPLPPSLINCFSLHVIDVGNNNLSGEIPQCFGNSALKVFDMRMNRFNGSIPQMFAKSCDLRSLNLNGNQLEGPLSPSLINCRYLEVLDIGNNHINDTFPYWLEILPELRVLILRSNRFWGPIGNTKTRAPFSKLRILDLSHNQLTGVLPTRYLNNFRAMIHGENNSVTVEVKYLSLLNSSYYACYESIILTMKGIDLQLERVLTIFTTIDLSSNRFQGGIPAIVGKLNSLKGLNISHNNLTGGIPSSLANLTELESLDLSSNKLVGQIPMQMASLKSLSVLNLSHNQLEGPVPRGTQFNTFQNDSYAGNPGLCGFPLSESCDMDEAPDPSSPTSFHEGDDSPSWFDWKFAKMGYASGLVIGLSIAYMVFATGRPWWFVKMIEEKQATKVRRVSRRGRARR
ccccHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccEEEccccccEEEEEcccccccccccccccccccccccEEEccccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccHHccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccEEEccHHHccccccccEEEccccccEEEcccccccccccccEEEccccccccccHHccccccccEEEcccccccEEccHHHHHHHcccccEEEccccccccccccccccccEEEccccccccccccccccccEEEEEcccccccccHHHHccccccEEEccccEEEEEcccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccccccccccccccccEEEccccccEEEccccccccccccEEEcccccccccccHHHHccccccEEEcccccccccccHHHcccccccEEEccccccEEEccccccccccccccEEEcccccccccccHHHHHHHHHcccccccccEEEEEEEEcccccccEEEEEEEEEEcccHHHHHHHccccEEEEcccccccccccHHHHccccccccccccccccccccccHHccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEEEEEEEEEHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHcccc
ccHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccEEEEcccccEEEEEEcccccccccccccHHHHHcccccEEEEEEEccEEccccHHHHHcccccEEEEEEccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccHHHHccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHHccccccEEEEEccccccccccHHHHcccccccEEEccccccccccHHHHccccccEEEcccccccccccHHHHHcccccccEEEccccccccccccccccHHHHHHHcccccccccccccccEEEEEccccccccccHHHcccccccEEEcccccccccccHHccccccEEEEccccccccccccHccccccccEEEccccccEEcccHHHHHcccccEEEccccEEEEEcccHcccccEEEEEcccccccccccHHHccccccEEEEEccccccccccHHHHcccccEEEEcccccccccccHHHccccccEEEEEccccccccccccccccccccccEEEcccccccccccHHHHHHHHHHHHHHcccccccccccHHccccccEEEEcEEccccccccHHHcccccEEEEEcccccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccccEEcccHHHHHcccccEEEccccEEEEEccccccHHHccHHHcccccEEEcccccccccccccccccccccccccccccccccEEEEEEEHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHccEEEHHHHcccccc
MGYLTQPYQLVICLQLSLLFFQCSAKLCSQEQSSALLQFKQLFSFaktsssqcdgyqqsypkmkywkedadccsswdgvtcdmvtGQVIGLDLScswlhgsissnsslfflprlqklnlgsndfnyskissgfsQLRSLTLLnlsssnftgsippslgnltQLVYldlsnnsfigeipnmftnqsKLSYlnfggnqltgqipssvGELANLATVYLYFNSlkgtipsrifsltslkqvdfrhnqlsgsvpssVYELVNLtrldlssnklsgtvelydfaklknlKWLVLSnnslslttkltvsssflnlsrlglsackiskfpVILKTQLQLEWldlsenqihgrvpgwmwdvgIHTLSYLDLSQNFLRSIKrlpwknlknlyldsnllrgrlldlpplmtIFSIsnnyltgeipssfcnlssIQYLEmsnnsfsgqipqclvnSTVKFLDLRMNnfqgiipqtyakdcnltflklngnklegplppslincfslhvidvgnnnlsgeipqcfgnsaLKVFDMRMnrfngsipqmFAKScdlrslnlngnqlegplspslincryLEVLdignnhindtfPYWLEILPELRVLILRSnrfwgpigntktrapfsklRILDlshnqltgvlptryLNNFRAmihgennsVTVEVKYLSLLNSSYYACYESIILTMKGIDLQLERVLTIFTtidlssnrfqggipAIVGKlnslkglnishnnltggipsslanltelesldlssnklvgqipmqMASLKSLSVLNLshnqlegpvprgtqfntfqndsyagnpglcgfplsescdmdeapdpssptsfhegddspswfdWKFAKMGYASGLVIGLSIAYMVFATGRPWWFVKMIEEKQATKVRRVsrrgrarr
MGYLTQPYQLVICLQLSLLFFQCSAKLCSQEQSSALLQFKQLFSFAKtsssqcdgYQQSYPKMKYWKEDADCCSSWDGVTCDMVTGQVIGLDLSCSWLHGSISSNSSLFFLPRLQKLNLGSNDFNYSKISSGFSQLRSLTLLNLSSSNFTGSIPPSLGNLTQLVYLDLSNNSFIGEIPNMFTNQSKLSYLNFGGNQLTGQIPSSVGELANLATVYLYFNSLKGTIPSRIFSLTSLKQVDFRHnqlsgsvpssVYELVNLTrldlssnklsGTVELYDFAKLKNLKWLVLSNNSLSLTTKLTVSSSFLNLSRLGLSACKISKFPVILKTQLQLEWLDLSENQIHGRVPGWMWDVGIHTLSYLDLSQNFLRSIKRLPWKNLKNLYLDSNLLRGRLLDLPPLMTIFSISNNYLTGEIPSSFCNLSSIQYLEMSNNSFSGQIPQCLVNSTVKFLDLRMNNFQGIIPQTYAKDCNLTFLKLNGNKLEGPLPPSLINCFSLHVIDVGNNNLSGEIPQCFGNSALKVFDMRMNRFNGSIPQMFAKSCDLRSLNLNGNQLEGPLSPSLINCRYLEVLDIGNNHINDTFPYWLEILPELRVLILRSNRFWGPIGNTKTRAPFSKLRILDLSHNQLTGVLPTRYLNNFRAMIHGENNSVTVEVKYLSLLNSSYYACYESIILTMKGIDLQLERVLTIFTTidlssnrfqGGIPAIVGKLNSLKGLNISHNNLTGGIPSSLANLTELESLDLSSNKLVGQIPMQMASLKSLSVLNLSHNQLEGPVPRGTQFNTFQNDSYAGNPGLCGFPLSESCDMDEAPDPSSPTSFHEGDDSPSWFDWKFAKMGYASGLVIGLSIAYMVFATGRPWWFVKMIeekqatkvrrvsrrgrarr
MGYLTQPYQLVICLQLSLLFFQCSAKLCSQEQSSALLQFKQLFSFAKTSSSQCDGYQQSYPKMKYWKEDADCCSSWDGVTCDMVTGQVIGLDLSCSWLHGSISSNSSLFFLPRLQKLNLGSNDFNYSKISSGFsqlrsltllnlsssNFTGSIPPSLGNLTQLVYLDLSNNSFIGEIPNMFTNQSKLSYLNFGGNQLTGQIPSSVGELANLATVYLYFNSLKGTIPSRIFSLTSLKQVDFRHNQLSGSVPSSVYELVNLTRLDLSSNKLSGTVELYDFAklknlkwlvlsnnslslttkltvsssFLNLSRLGLSACKISKFPVILKTQLQLEWLDLSENQIHGRVPGWMWDVGIHTLSYLDLSQNFLRSIKRLPWKNLKNlyldsnllrgrlldlpplMTIFSISNNYLTGEIPSSFCNLSSIQYLEMSNNSFSGQIPQCLVNSTVKFLDLRMNNFQGIIPQTYAKDCNLTFLKLNGNKLEGPLPPSLINCFSLHVIDVGNNNLSGEIPQCFGNSALKVFDMRMNRFNGSIPQMFAKSCDLRSLNLNGNQLEGPLSPSLINCRYLEVLDIGNNHINDTFPYWLEILPELRVLILRSNRFWGPIGNTKTRAPFSKLRILDLSHNQLTGVLPTRYLNNFRAMIHGENNSVTVEVKYLSLLNSSYYACYESIILTMKGIDLQLERVLTIFTTIDLSSNRFQGGIPAIVGKLNSLKGLNISHNNLTGGIPSSLANLTELESLDLSSNKLVGQIPMQMASLKSLSVLNLSHNQLEGPVPRGTQFNTFQNDSYAGNPGLCGFPLSESCDMDEAPDPSSPTSFHEGDDSPSWFDWKFAKMGYASGLVIGLSIAYMVFATGRPWWFVKMIEEKQATKVrrvsrrgrarr
**YLTQPYQLVICLQLSLLFFQCSAKLCSQEQSSALLQFKQLFSFAKTSSSQCDGYQQSYPKMKYWKEDADCCSSWDGVTCDMVTGQVIGLDLSCSWLHGSISSNSSLFFLPRLQKLNLGSNDFNYSKISSGFSQLRSLTLLNLSSSNFTGSIPPSLGNLTQLVYLDLSNNSFIGEIPNMFTNQSKLSYLNFGGNQLTGQIPSSVGELANLATVYLYFNSLKGTIPSRIFSLTSLKQVDFRHNQLSGSVPSSVYELVNLTRLDLSSNKLSGTVELYDFAKLKNLKWLVLSNNSLSLTTKLTVSSSFLNLSRLGLSACKISKFPVILKTQLQLEWLDLSENQIHGRVPGWMWDVGIHTLSYLDLSQNFLRSIKRLPWKNLKNLYLDSNLLRGRLLDLPPLMTIFSISNNYLTGEIPSSFCNLSSIQYLEMSNNSFSGQIPQCLVNSTVKFLDLRMNNFQGIIPQTYAKDCNLTFLKLNGNKLEGPLPPSLINCFSLHVIDVGNNNLSGEIPQCFGNSALKVFDMRMNRFNGSIPQMFAKSCDLRSLNLNGNQLEGPLSPSLINCRYLEVLDIGNNHINDTFPYWLEILPELRVLILRSNRFWGPIGNTKTRAPFSKLRILDLSHNQLTGVLPTRYLNNFRAMIHGENNSVTVEVKYLSLLNSSYYACYESIILTMKGIDLQLERVLTIFTTIDLSSNRFQGGIPAIVGKLNSLKGLNISHNNLTGGIPSSLANLTEL*********LVG*************VL*******************F****YAGNPGLCGF***************************SWFDWKFAKMGYASGLVIGLSIAYMVFATGRPWWFVKMIE******************
*GYLTQPYQLVICLQLSLLFFQCSAKLCSQEQSSALLQFKQLFSFAKTSSSQCDGYQQSYPKMKYWKEDADCCSSWDGVTCDMVTGQVIGLDLSCSWLHGSISSNSSLFFLPRLQKLNLGSNDFNYSKISSGFSQLRSLTLLNLSSSNFTGSIPPSLGNLTQLVYLDLSNNSFIGEIPNMFTNQSKLSYLNFGGNQLTGQIPSSVGELANLATVYLYFNSLKGTIPSRIFSLTSLKQVDFRHNQLSGSVPSSVYELVNLTRLDLSSNKLSGTVELYDFAKLKNLKWLVLSNNSLSLTTKLTVSSSFLNLSRLGLSACKISKFPVILKTQLQLEWLDLSENQIHGRVPGWMWDVGIHTLSYLDLSQNFLRSIKRLPWKNLKNLYLDSNLLRGRLLDLPPLMTIFSISNNYLTGEIPSSFCNLSSIQYLEMSNNSFSGQIPQCLVNSTVKFLDLRMNNFQGIIPQTYAKDCNLTFLKLNGNKLEGPLPPSLINCFSLHVIDVGNNNLSGEIPQCFGNSALKVFDMRMNRFNGSIPQMFAKSCDLRSLNLNGNQLEGPLSPSLINCRYLEVLDIGNNHINDTFPYWLEILPELRVLILRSNRFWGPIGNTKTRAPFSKLRILDLSHNQLTGVLPTRYLNNFRAMI************YLSLLNSSYYACYESIILTMKGIDLQLERVLTIFTTIDLSSNRFQGGIPAIVGKLNSLKGLNISHNNLTGGIPSSLANLTELESLDLSSNKLVGQIPMQMASLKSLSVLNLSHNQLEGPVPRGTQFNTFQNDSYAGNPGLCGFPLS**************************FDWKFAKMGYASGLVIGLSIAYMVFATGRPWWFVKMIEEKQATKVRRVSR******
MGYLTQPYQLVICLQLSLLFFQCSAKLCSQEQSSALLQFKQLFSFA*********YQQSYPKMKYWKEDADCCSSWDGVTCDMVTGQVIGLDLSCSWLHGSISSNSSLFFLPRLQKLNLGSNDFNYSKISSGFSQLRSLTLLNLSSSNFTGSIPPSLGNLTQLVYLDLSNNSFIGEIPNMFTNQSKLSYLNFGGNQLTGQIPSSVGELANLATVYLYFNSLKGTIPSRIFSLTSLKQVDFRHNQLSGSVPSSVYELVNLTRLDLSSNKLSGTVELYDFAKLKNLKWLVLSNNSLSLTTKLTVSSSFLNLSRLGLSACKISKFPVILKTQLQLEWLDLSENQIHGRVPGWMWDVGIHTLSYLDLSQNFLRSIKRLPWKNLKNLYLDSNLLRGRLLDLPPLMTIFSISNNYLTGEIPSSFCNLSSIQYLEMSNNSFSGQIPQCLVNSTVKFLDLRMNNFQGIIPQTYAKDCNLTFLKLNGNKLEGPLPPSLINCFSLHVIDVGNNNLSGEIPQCFGNSALKVFDMRMNRFNGSIPQMFAKSCDLRSLNLNGNQLEGPLSPSLINCRYLEVLDIGNNHINDTFPYWLEILPELRVLILRSNRFWGPIGNTKTRAPFSKLRILDLSHNQLTGVLPTRYLNNFRAMIHGENNSVTVEVKYLSLLNSSYYACYESIILTMKGIDLQLERVLTIFTTIDLSSNRFQGGIPAIVGKLNSLKGLNISHNNLTGGIPSSLANLTELESLDLSSNKLVGQIPMQMASLKSLSVLNLSHNQLEGPVPRGTQFNTFQNDSYAGNPGLCGFPLSESCD******************SPSWFDWKFAKMGYASGLVIGLSIAYMVFATGRPWWFVKMIEEKQAT*************
*GYLTQPYQLVICLQLSLLFFQCSAKLCSQEQSSALLQFKQLFSFAKTSSSQCDGYQQSYPKMKYWKEDADCCSSWDGVTCDMVTGQVIGLDLSCSWLHGSISSNSSLFFLPRLQKLNLGSNDFNYSKISSGFSQLRSLTLLNLSSSNFTGSIPPSLGNLTQLVYLDLSNNSFIGEIPNMFTNQSKLSYLNFGGNQLTGQIPSSVGELANLATVYLYFNSLKGTIPSRIFSLTSLKQVDFRHNQLSGSVPSSVYELVNLTRLDLSSNKLSGTVELYDFAKLKNLKWLVLSNNSLSLTTKLTVSSSFLNLSRLGLSACKISKFPVILKTQLQLEWLDLSENQIHGRVPGWMWDVGIHTLSYLDLSQNFLRSIKRLPWKNLKNLYLDSNLLRGRLLDLPPLMTIFSISNNYLTGEIPSSFCNLSSIQYLEMSNNSFSGQIPQCLVNSTVKFLDLRMNNFQGIIPQTYAKDCNLTFLKLNGNKLEGPLPPSLINCFSLHVIDVGNNNLSGEIPQCFGNSALKVFDMRMNRFNGSIPQMFAKSCDLRSLNLNGNQLEGPLSPSLINCRYLEVLDIGNNHINDTFPYWLEILPELRVLILRSNRFWGPIGNTKTRAPFSKLRILDLSHNQLTGVLPTRYLNNFRAMIHGENNSVTVEVKYLSLLNSSYYACYESIILTMKGIDLQLERVLTIFTTIDLSSNRFQGGIPAIVGKLNSLKGLNISHNNLTGGIPSSLANLTELESLDLSSNKLVGQIPMQMASLKSLSVLNLSHNQLEGPVPRGTQFNTFQNDSYAGNPGLCGFPLSESC*********************SWFDWKFAKMGYASGLVIGLSIAYMVFATGRPWWFVKMIEEKQATKVRRVSR******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGYLTQPYQLVICLQLSLLFFQCSAKLCSQEQSSALLQFKQLFSFAKTSSSQCDGYQQSYPKMKYWKEDADCCSSWDGVTCDMVTGQVIGLDLSCSWLHGSISSNSSLFFLPRLQKLNLGSNDFNYSKISSGFSQLRSLTLLNLSSSNFTGSIPPSLGNLTQLVYLDLSNNSFIGEIPNMFTNQSKLSYLNFGGNQLTGQIPSSVGELANLATVYLYFNSLKGTIPSRIFSLTSLKQVDFRHNQLSGSVPSSVYELVNLTRLDLSSNKLSGTVELYDFAKLKNLKWLVLSNNSLSLTTKLTVSSSFLNLSRLGLSACKISKFPVILKTQLQLEWLDLSENQIHGRVPGWMWDVGIHTLSYLDLSQNFLRSIKRLPWKNLKNLYLDSNLLRGRLLDLPPLMTIFSISNNYLTGEIPSSFCNLSSIQYLEMSNNSFSGQIPQCLVNSTVKFLDLRMNNFQGIIPQTYAKDCNLTFLKLNGNKLEGPLPPSLINCFSLHVIDVGNNNLSGEIPQCFGNSALKVFDMRMNRFNGSIPQMFAKSCDLRSLNLNGNQLEGPLSPSLINCRYLEVLDIGNNHINDTFPYWLEILPELRVLILRSNRFWGPIGNTKTRAPFSKLRILDLSHNQLTGVLPTRYLNNFRAMIHGENNSVTVEVKYLSLLNSSYYACYESIILTMKGIDLQLERVLTIFTTIDLSSNRFQGGIPAIVGKLNSLKGLNISHNNLTGGIPSSLANLTELESLDLSSNKLVGQIPMQMASLKSLSVLNLSHNQLEGPVPRGTQFNTFQNDSYAGNPGLCGFPLSESCDMDEAPDPSSPTSFHEGDDSPSWFDWKFAKMGYASGLVIGLSIAYMVFATGRPWWFVKMIEEKQATKVRRVSRRGRARR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query882 2.2.26 [Sep-21-2011]
Q9C9H7847 Receptor-like protein 12 no no 0.919 0.957 0.367 1e-131
Q9FIZ3 1252 LRR receptor-like serine/ no no 0.800 0.563 0.309 3e-82
C0LGQ5 1249 LRR receptor-like serine/ no no 0.804 0.568 0.313 1e-80
Q9FL28 1173 LRR receptor-like serine/ no no 0.777 0.584 0.318 1e-74
Q8VZG8 1045 Probable LRR receptor-lik no no 0.810 0.684 0.291 2e-73
Q9LP24 1120 Probable leucine-rich rep no no 0.786 0.619 0.31 3e-71
Q9LYN8 1192 Leucine-rich repeat recep no no 0.851 0.630 0.309 7e-71
Q9FZ59 1088 Leucine-rich repeat recep no no 0.721 0.584 0.299 3e-70
Q9SHI2 1101 Leucine-rich repeat recep no no 0.763 0.611 0.300 6e-63
C0LGS2 1136 Probable LRR receptor-lik no no 0.783 0.608 0.273 1e-62
>sp|Q9C9H7|RLP12_ARATH Receptor-like protein 12 OS=Arabidopsis thaliana GN=RLP12 PE=2 SV=2 Back     alignment and function desciption
 Score =  470 bits (1209), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 324/881 (36%), Positives = 474/881 (53%), Gaps = 70/881 (7%)

Query: 12  ICLQLSLLFFQ---CSAKLCSQEQSSALLQFKQLFSFAKTSSSQCDGYQQSYPKMKYWKE 68
           I + LSLL       S   C  +Q  ALL+F+  F     ++S     Q   P    W +
Sbjct: 15  IIIFLSLLVHSLASSSPHFCRDDQRDALLEFRGEF---PINASWHIMNQWRGP----WNK 67

Query: 69  DADCCSSWDGVTCDMVTGQVIGLDLSCSWLHGSISSNSSLFFLPRLQKLNLGSNDFNYSK 128
             DCC  W+GVTC+  +GQVI LD+  ++L+  + +NSSLF L  L+ L+L + +  Y +
Sbjct: 68  STDCCL-WNGVTCNDKSGQVISLDIPNTFLNNYLKTNSSLFKLQYLRHLDLTNCNL-YGE 125

Query: 129 ISSGFSQLRSLTLLNLSSSNFTGSIPPSLGNLTQLVYLDLSNNSFIGEIPNMFTNQSKLS 188
           I S    L  LTL+NL  + F G IP S+GNL QL +L L+NN   GEIP+   N S+L 
Sbjct: 126 IPSSLGNLSHLTLVNLYFNKFVGEIPASIGNLNQLRHLILANNVLTGEIPSSLGNLSRLV 185

Query: 189 YLNFGGNQLTGQIPSSVGELANLATVYLYFNSLKGTIPSRIFSLTSLKQVDFRHNQLSGS 248
            L    N+L G+IP S+G+L  L  + L  N+L G IPS + +L++L  +   HNQL G 
Sbjct: 186 NLELFSNRLVGKIPDSIGDLKQLRNLSLASNNLIGEIPSSLGNLSNLVHLVLTHNQLVGE 245

Query: 249 VPSSVYELVNLTRLDLSSNKLSGTVELYDFAKLKNLKWLVLSNNSLSLTTKLTVSSSFLN 308
           VP+S+  L+ L  +   +N LSG + +  FA L  L   VLS+N+ + T    +S  F N
Sbjct: 246 VPASIGNLIELRVMSFENNSLSGNIPI-SFANLTKLSIFVLSSNNFTSTFPFDMSI-FHN 303

Query: 309 LSRLGLSACKIS-KFPVILKTQLQLEWLDLSENQIHGRVPGWMWDVGIHTLSYLDLSQNF 367
           L    +S    S  FP  L     LE + L ENQ  G +             + + S + 
Sbjct: 304 LEYFDVSYNSFSGPFPKSLLLIPSLESIYLQENQFTGPI------------EFANTSSS- 350

Query: 368 LRSIKRLPWKNLKNLYLDSNLLRG-------RLLDLPPLMTIFSISNNYLTGEIPSSFCN 420
                      L++L L  N L G       RLL+L  L     IS+N  TG IP +   
Sbjct: 351 ---------TKLQDLILGRNRLHGPIPESISRLLNLEEL----DISHNNFTGAIPPTISK 397

Query: 421 LSSIQYLEMSNNSFSGQIPQCL--VNSTVKFLDLRMNNFQGIIPQTYAKDCNLTFLKLNG 478
           L ++ +L++S N+  G++P CL  +N+ V    L  N+F      T  ++  +  L LN 
Sbjct: 398 LVNLLHLDLSKNNLEGEVPACLWRLNTMV----LSHNSFSSF-ENTSQEEALIEELDLNS 452

Query: 479 NKLEGPLPPSLINCFSLHVIDVGNNNLSGEIPQCFGN--SALKVFDMRMNRFNGSIPQMF 536
           N  +GP+P  +    SL  +D+ NN  SG IP C  N   ++K  ++  N F+G++P +F
Sbjct: 453 NSFQGPIPYMICKLSSLGFLDLSNNLFSGSIPSCIRNFSGSIKELNLGDNNFSGTLPDIF 512

Query: 537 AKSCDLRSLNLNGNQLEGPLSPSLINCRYLEVLDIGNNHINDTFPYWLEILPELRVLILR 596
           +K+ +L SL+++ NQLEG    SLINC+ LE++++ +N I D FP WLE LP L VL LR
Sbjct: 513 SKATELVSLDVSHNQLEGKFPKSLINCKALELVNVESNKIKDIFPSWLESLPSLHVLNLR 572

Query: 597 SNRFWGPIGNTKTRAPFSKLRILDLSHNQLTGVLPTRYLNNFRAMIHGENNSVTVEV-KY 655
           SN+F+GP+ +      F  LRI+D+SHN  +G LP  Y +N++ M      ++T E+ +Y
Sbjct: 573 SNKFYGPLYHRHASIGFQSLRIIDISHNNFSGTLPPYYFSNWKDMT-----TLTEEMDQY 627

Query: 656 LSLLNSSYYACYESIILTMKGIDLQLERVLTIFTTIDLSSNRFQGGIPAIVGKLNSLKGL 715
           ++       + Y  + +  KG+D+  ER+   F  ID S N+  G IP  +G L  L+ L
Sbjct: 628 MTEFWRYADSYYHEMEMVNKGVDMSFERIRRDFRAIDFSGNKINGNIPESLGYLKELRVL 687

Query: 716 NISHNNLTGGIPSSLANLTELESLDLSSNKLVGQIPMQMASLKSLSVLNLSHNQLEGPVP 775
           N+S N  T  IP  LANLT+LE+LD+S NKL GQIP  +A+L  LS +N SHN L+GPVP
Sbjct: 688 NLSGNAFTSVIPRFLANLTKLETLDISRNKLSGQIPQDLAALSFLSYMNFSHNLLQGPVP 747

Query: 776 RGTQFNTFQNDSYAGNPGLCGFPLSESCDMDEAPDPSS--PTSFHEGDDSPSWFDWKFAK 833
           RGTQF   +  S+  NPGL G  L + C    A +P+S  P    E ++  + F+W  A 
Sbjct: 748 RGTQFQRQKCSSFLDNPGLYG--LEDICRDTGALNPTSQLPEDLSEAEE--NMFNWVAAA 803

Query: 834 MGYASGLVIGLSIAYMVFATGRPWWFVKMIEEKQATKVRRV 874
           + Y  G++ GL I +  + +    WF +    KQ   +  V
Sbjct: 804 IAYGPGVLCGLVIGHF-YTSHNHEWFTEKFGRKQHKALTSV 843
Involved in the perception of CLV3 and CLV3-like peptides, that act as extracellular signals regulating meristems maintenance.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9FIZ3|GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2 Back     alignment and function description
>sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 Back     alignment and function description
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function description
>sp|Q8VZG8|Y4885_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g08850 OS=Arabidopsis thaliana GN=At4g08850 PE=1 SV=3 Back     alignment and function description
>sp|Q9LP24|Y1571_ARATH Probable leucine-rich repeat receptor-like protein kinase At1g35710 OS=Arabidopsis thaliana GN=At1g35710 PE=2 SV=1 Back     alignment and function description
>sp|Q9LYN8|EXS_ARATH Leucine-rich repeat receptor protein kinase EXS OS=Arabidopsis thaliana GN=EXS PE=1 SV=1 Back     alignment and function description
>sp|Q9FZ59|PEPR2_ARATH Leucine-rich repeat receptor-like protein kinase PEPR2 OS=Arabidopsis thaliana GN=PEPR2 PE=1 SV=1 Back     alignment and function description
>sp|Q9SHI2|Y1723_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230 OS=Arabidopsis thaliana GN=At1g17230 PE=2 SV=2 Back     alignment and function description
>sp|C0LGS2|Y4361_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g36180 OS=Arabidopsis thaliana GN=At4g36180 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query882
225455498980 PREDICTED: receptor-like protein 12-like 0.947 0.853 0.406 1e-167
225459979979 PREDICTED: receptor-like protein 12-like 0.943 0.849 0.409 1e-167
359493544978 PREDICTED: receptor-like protein 12-like 0.924 0.833 0.398 1e-166
359493479814 PREDICTED: receptor-like protein 12-like 0.888 0.963 0.441 1e-165
224111510942 predicted protein [Populus trichocarpa] 0.951 0.890 0.402 1e-159
147793123951 hypothetical protein VITISV_032542 [Viti 0.912 0.846 0.404 1e-158
224116970921 predicted protein [Populus trichocarpa] 0.868 0.831 0.397 1e-158
224099671842 predicted protein [Populus trichocarpa] 0.894 0.937 0.430 1e-157
225462116 1001 PREDICTED: receptor-like protein 12-like 0.812 0.716 0.445 1e-153
224099469897 predicted protein [Populus trichocarpa] 0.947 0.931 0.416 1e-151
>gi|225455498|ref|XP_002264793.1| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  594 bits (1532), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 396/973 (40%), Positives = 540/973 (55%), Gaps = 137/973 (14%)

Query: 25  AKLCSQEQSSALLQFKQLFSFAKTSSSQCDGYQ-QSYPKMKYWKEDADCCSSWDGVTCDM 83
            KLC   Q+ ALL  KQ FS   +SS  C      SYPK + WK+ +DCCS WDGVTCD 
Sbjct: 29  TKLCPHHQTLALLHLKQSFSINNSSSLDCHAVGVTSYPKTESWKKGSDCCS-WDGVTCDW 87

Query: 84  VTGQVIGLDLSCSWLHGSISSNSSLFFLPRLQKLNLGSNDFNYSKISSGFSQLRSLTLLN 143
           VTG VI LDLSCSWL G+I SN++LF LP +Q+LNL  N+F+ S IS GF +  SLT LN
Sbjct: 88  VTGHVIELDLSCSWLFGTIHSNTTLFLLPHIQRLNLAFNNFSGSSISVGFGRFSSLTHLN 147

Query: 144 LSSSNFTGSIPPSLGNLTQLVYLDLSNNSFIGEIPNMFT----NQSKLSYLNFGGNQLTG 199
           LS S F+G I P + +L+ LV LDLS NS     P+ F     N +KL  L+ GG  ++ 
Sbjct: 148 LSDSGFSGLISPEISHLSNLVSLDLSWNSDTEFAPHGFNSLVQNLTKLQKLHLGGISISS 207

Query: 200 QIPSSV------------------------------------------------GELANL 211
             P+S+                                                 E  +L
Sbjct: 208 VFPNSLLNRSSLISLHLSSCGLHGRFPDHDIHLPKLEVLNLWRNDDLSGNFPRFNENNSL 267

Query: 212 ATVYLYFNSLKGTIPSRIFSLTSLKQVDFRHNQLSGSVPSSVYELVNLTRLDLSSNKLSG 271
             +YL   +  G +P+ I +L SL+ +D  + + SGS+P+S+  L  +T L+L+ N  SG
Sbjct: 268 TELYLSSKNFSGELPASIGNLKSLQTLDLSNCEFSGSIPASLENLTQITSLNLNGNHFSG 327

Query: 272 TVELYDFAKLKNLKWLVLSNNSLS---------LTTKLTVSSSFLNLSRLGLSACKISKF 322
            +    F  L+NL  + LSNN  S         LT    +  S+  L   G+    +++F
Sbjct: 328 KIPNI-FNNLRNLISIGLSNNHFSGQFPPSIGNLTNLYYLDFSYNQLE--GVIPSHVNEF 384

Query: 323 -------------------PVILKTQLQLEWLDLSENQIHGRVPGWMWDVGIHTLSYLDL 363
                              P  L T L L  L L  N++ G +  + +D    +L  +DL
Sbjct: 385 LFSSLSYVYLGYNLFNGIIPSWLYTLLSLVVLHLGHNKLTGHIGEFQFD----SLEMIDL 440

Query: 364 SQNFLR-----SIKRLPWKNLKNLYLDSNLLRGRLL-----DLPPLMTIFSISNNYLTGE 413
           S N L      SI +L   NL++LYL SN L G L       L  L+ ++ +SNN L+  
Sbjct: 441 SMNELHGPIPSSIFKL--VNLRSLYLSSNNLSGVLETSNFGKLRNLINLY-LSNNMLSLT 497

Query: 414 IPS-SFCNLSSIQYLEMSNNSFSGQIPQCLVNSTVKFLDLRMNNFQG--IIPQTYAKDCN 470
             S S C L  I+ +++SNN  SG     +   T+ +L+L  N+  G  ++P       +
Sbjct: 498 TSSNSNCILPKIESIDLSNNKISGVWSWNMGKDTLWYLNLSYNSISGFEMLPWKNVGILD 557

Query: 471 LT----------------FLKLNGNKLEGPLPPSLINCFSLHVIDVGNNNLSGEIPQCFG 514
           L                 F  +  NKL G + P +    S+ V+D+ +NNLSG +P C G
Sbjct: 558 LHSNLLQGALPTPPNSTFFFSVFHNKLSGGISPLICKVSSIRVLDLSSNNLSGMLPHCLG 617

Query: 515 N--SALKVFDMRMNRFNGSIPQMFAKSCDLRSLNLNGNQLEGPLSPSLINCRYLEVLDIG 572
           N    L V ++R NRF+G+IPQ F K   +R+L+ N N+LEG +  SLI CR LEVL++G
Sbjct: 618 NFSKDLSVLNLRRNRFHGTIPQSFLKGNVIRNLDFNDNRLEGLVPRSLIICRKLEVLNLG 677

Query: 573 NNHINDTFPYWLEILPELRVLILRSNRFWGPIGNTKTRAPFSKLRILDLSHNQLTGVLPT 632
           NN INDTFP+WL  LPEL+VL+LRSN F G IG +K ++PF  LRI+DL+HN   G LP 
Sbjct: 678 NNKINDTFPHWLGTLPELQVLVLRSNSFHGHIGCSKLKSPFMSLRIIDLAHNDFEGDLPE 737

Query: 633 RYLNNFRAMIHGENNSVTVEVKYLSLLNSSYYACYESIILTMKGIDLQLERVLTIFTTID 692
            YL + +  ++ + +++T   KY+     +YY   +S+++T+KG++++  ++L  F TID
Sbjct: 738 MYLRSLKVTMNVDEDNMT--RKYMG---GNYYE--DSVMVTIKGLEIEFVKILNAFATID 790

Query: 693 LSSNRFQGGIPAIVGKLNSLKGLNISHNNLTGGIPSSLANLTELESLDLSSNKLVGQIPM 752
           LSSN+FQG IP  +G LNSL+GLN+SHNNLTG IPSS  NL  LESLDLSSNKL+G IP 
Sbjct: 791 LSSNKFQGEIPQSIGNLNSLRGLNLSHNNLTGHIPSSFGNLKLLESLDLSSNKLIGSIPQ 850

Query: 753 QMASLKSLSVLNLSHNQLEGPVPRGTQFNTFQNDSYAGNPGLCGFPLSESCDMDEAPDPS 812
           Q+ SL  L VLNLS N L G +P+G QF+TF NDSY GN  LCGFPLS+ C  DE P+PS
Sbjct: 851 QLTSLIFLEVLNLSQNHLTGFIPKGNQFDTFGNDSYNGNSELCGFPLSKKCIADETPEPS 910

Query: 813 SPTSFHEGDDSPSWFDWKFAKMGYASGLVIGLSIAYMVFATGRPWWFVKMIEEKQATKVR 872
                 E  +  + FDWKF  +GY  GLV GLS+  ++F  G+P WFV +IEE    K+R
Sbjct: 911 K----EEDAEFENKFDWKFMLVGYGCGLVYGLSLGGIIFLIGKPKWFVSIIEENIHKKIR 966

Query: 873 RVSR---RGRARR 882
           R  R   R  ARR
Sbjct: 967 RCKRSTCRQGARR 979

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225459979|ref|XP_002267546.1| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359493544|ref|XP_002267509.2| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359493479|ref|XP_003634609.1| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224111510|ref|XP_002332925.1| predicted protein [Populus trichocarpa] gi|222834420|gb|EEE72897.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147793123|emb|CAN75335.1| hypothetical protein VITISV_032542 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224116970|ref|XP_002331797.1| predicted protein [Populus trichocarpa] gi|222874493|gb|EEF11624.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224099671|ref|XP_002334453.1| predicted protein [Populus trichocarpa] gi|222872411|gb|EEF09542.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225462116|ref|XP_002263233.1| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224099469|ref|XP_002334479.1| predicted protein [Populus trichocarpa] gi|222872406|gb|EEF09537.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query882
TAIR|locus:2078102875 RLP33 "receptor like protein 3 0.918 0.925 0.357 4.4e-123
TAIR|locus:2074633943 RLP35 "AT3G11080" [Arabidopsis 0.831 0.777 0.334 1.2e-99
TAIR|locus:2085537894 RLP34 "AT3G11010" [Arabidopsis 0.5 0.493 0.393 1.6e-115
TAIR|locus:2078112868 RLP32 "receptor like protein 3 0.870 0.884 0.358 5e-115
TAIR|locus:2086979890 RLP42 "receptor like protein 4 0.515 0.511 0.396 2.4e-110
TAIR|locus:2046515864 RLP24 "receptor like protein 2 0.938 0.958 0.338 3.1e-106
TAIR|locus:2096349860 RLP31 "receptor like protein 3 0.877 0.9 0.323 4e-106
TAIR|locus:2086974881 RLP41 "AT3G25010" [Arabidopsis 0.515 0.516 0.377 1.3e-105
TAIR|locus:2825384847 RLP12 "AT1G71400" [Arabidopsis 0.819 0.853 0.345 1.7e-105
TAIR|locus:2046600800 RLP26 "receptor like protein 2 0.514 0.567 0.394 2e-102
TAIR|locus:2078102 RLP33 "receptor like protein 33" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1210 (431.0 bits), Expect = 4.4e-123, P = 4.4e-123
 Identities = 307/858 (35%), Positives = 439/858 (51%)

Query:    27 LCSQEQSSALLQFKQLFSFAKTSSSQCDGYQQSYPKMKYWKEDADCCSSWDGVTCDMVTG 86
             LC  EQ  ALL+FK  F   K     C G      K K W+  +DCC  WDG+TCD  TG
Sbjct:    29 LCHFEQRDALLEFKNEFKIKKP----CFGCPSPL-KTKSWENGSDCCH-WDGITCDAKTG 82

Query:    87 QVIGLDLSCSWLHGSISSNSSLFFLPRLQKLNLGSNDFNY--SKISSGFXXXXXXXXXXX 144
             +VI +DL CS LHG   SNS+L  L     L      +N+   +ISS             
Sbjct:    83 EVIEIDLMCSCLHGWFHSNSNLSMLQNFHFLTTLDLSYNHLSGQISSSIGNLSHLTTLDL 142

Query:   145 XXXNFTGSIPPSLGNLTQLVYLDLSNNSFIGEIPNMFTNQSKLSYLNFGGNQLTGQIPSS 204
                NF+G IP SLGNL  L  L L +N+F GEIP+   N S L++L+   N   G+IPSS
Sbjct:   143 SGNNFSGWIPSSLGNLFHLTSLHLYDNNFGGEIPSSLGNLSYLTFLDLSTNNFVGEIPSS 202

Query:   205 VGELANLATVYLYFNSLKGTIPSRIFSLTSLKQVDFRHNQLSGSVPSSVYELVNLTRLDL 264
              G L  L+ + L  N L G +P  + +LT L ++   HNQ +G++P ++  L  L     
Sbjct:   203 FGSLNQLSILRLDNNKLSGNLPLEVINLTKLSEISLSHNQFTGTLPPNITSLSILESFSA 262

Query:   265 SSNKLSGTV--ELYDFAXXXXXXXXXXXXXXXXXXXXXXXXXXFLNLSRLGLSACKISKF 322
             S N   GT+   L+                              L L +LG +  +    
Sbjct:   263 SGNNFVGTIPSSLFTIPSITLIFLDNNQLSGTLEFGNISSPSNLLVL-QLGGNNLR-GPI 320

Query:   323 PVILKTQLQLEWLDLSENQIHGRVP----------GWMWDVGIHTLSYLDLSQNFLRSIK 372
             P  +   + L  LDLS   I G+V           G ++    +T + +DL+   L   K
Sbjct:   321 PTSISRLVNLRTLDLSHFNIQGQVDFNIFSHLKLLGNLYLSHSNTTTTIDLNA-VLSCFK 379

Query:   373 RLPWKNLKNXXXXXXXXXXXXXXXXXXMTIFSISNNYLTGEIPSSFCNLSSIQYLEMSNN 432
              L   +L                    +   ++S   +T E P        ++ L++SNN
Sbjct:   380 MLISLDLSGNHVLVTNKSSVSDPPLGLIGSLNLSGCGIT-EFPDILRTQRQMRTLDISNN 438

Query:   433 SFSGQIPQCLVNSTVKFLDLRMNNFQGI-----IPQTYAKDCNLTFLKLNGNKLEGPLPP 487
                GQ+P  L+   ++++ +  NNF G      + +T     ++     + N   G +P 
Sbjct:   439 KIKGQVPSWLLLQ-LEYMHISNNNFIGFERSTKLEKTVVPKPSMKHFFGSNNNFSGKIPS 497

Query:   488 SLINCFSLHVIDVGNNNLSGEIPQCFGN--SALKVFDMRMNRFNGSIPQMFAKSCDLRSL 545
              + +  SL ++D+ NNN SG IP C G   S L   ++R NR +GS+P+   KS  LRSL
Sbjct:   498 FICSLRSLIILDLSNNNFSGAIPPCVGKFKSTLSDLNLRRNRLSGSLPKTIIKS--LRSL 555

Query:   546 NLNGNQLEGPLSPSLINCRYLEVLDIGNNHINDTFPYWLEILPELRVLILRSNRFWGPIG 605
             +++ N+LEG L  SLI+   LEVL++ +N INDTFP+WL  L +L+VL+LRSN F G I 
Sbjct:   556 DVSHNELEGKLPRSLIHFSTLEVLNVESNRINDTFPFWLSSLKKLQVLVLRSNAFHGRIH 615

Query:   606 NTKTRAPFSKLRILDLSHNQLTGVLPTRYLNNFRAMIHGENNSVTVEVKYLSLLNSSYYA 665
               KTR P  KLRI+D+S N   G LP+     +  M   E N      KY+    S YY 
Sbjct:   616 --KTRFP--KLRIIDISRNHFNGTLPSDCFVEWTGMHSLEKNEDRFNEKYMG---SGYY- 667

Query:   666 CYESIILTMKGIDLQLERVLTIFTTIDLSSNRFQGGIPAIVGKLNSLKGLNISHNNLTGG 725
              ++S++L  KG++++L R+L I+T +D S N+F+G IP  +G L  L  LN+S N  TG 
Sbjct:   668 -HDSMVLMNKGLEMELVRILKIYTALDFSGNKFEGEIPRSIGLLKELHILNLSSNGFTGH 726

Query:   726 IPSSLANLTELESLDLSSNKLVGQIPMQMASLKSLSVLNLSHNQLEGPVPRGTQFNTFQN 785
             IPSS+ NL ELESLD+S NKL G+IP ++ +L  L+ +N SHNQL G VP GTQF T   
Sbjct:   727 IPSSMGNLRELESLDVSRNKLSGEIPQELGNLSYLAYMNFSHNQLVGQVPGGTQFRTQSA 786

Query:   786 DSYAGNPGLCGFPLSESCDMDEAPDPSSPTSFHEGDDSPSWFDWKFAKMGYASGLVIGLS 845
              S+  N GLCG PL E C +   P PS  +   E +   SW     A +G+  G+V+GL+
Sbjct:   787 SSFEENLGLCGRPLEE-CRVVHEPTPSGESETLESEQVLSWIA---AAIGFTPGIVLGLT 842

Query:   846 IAYMVFATGRPWWFVKMI 863
             I ++V ++ +P WF K++
Sbjct:   843 IGHIVLSS-KPRWFFKVL 859
GO:0005886 "plasma membrane" evidence=ISM
GO:0006952 "defense response" evidence=ISS
GO:0016301 "kinase activity" evidence=ISS
GO:0007165 "signal transduction" evidence=IC
GO:0009507 "chloroplast" evidence=IDA
GO:0000165 "MAPK cascade" evidence=RCA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=RCA
GO:0006457 "protein folding" evidence=RCA
GO:0006612 "protein targeting to membrane" evidence=RCA
GO:0009408 "response to heat" evidence=RCA
GO:0009617 "response to bacterium" evidence=RCA
GO:0009644 "response to high light intensity" evidence=RCA
GO:0009862 "systemic acquired resistance, salicylic acid mediated signaling pathway" evidence=RCA
GO:0009867 "jasmonic acid mediated signaling pathway" evidence=RCA
GO:0010310 "regulation of hydrogen peroxide metabolic process" evidence=RCA
GO:0010363 "regulation of plant-type hypersensitive response" evidence=RCA
GO:0031348 "negative regulation of defense response" evidence=RCA
GO:0034976 "response to endoplasmic reticulum stress" evidence=RCA
GO:0035304 "regulation of protein dephosphorylation" evidence=RCA
GO:0042542 "response to hydrogen peroxide" evidence=RCA
TAIR|locus:2074633 RLP35 "AT3G11080" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2085537 RLP34 "AT3G11010" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2078112 RLP32 "receptor like protein 32" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2086979 RLP42 "receptor like protein 42" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046515 RLP24 "receptor like protein 24" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2096349 RLP31 "receptor like protein 31" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2086974 RLP41 "AT3G25010" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2825384 RLP12 "AT1G71400" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046600 RLP26 "receptor like protein 26" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query882
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 7e-73
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-64
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 8e-43
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 7e-26
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-18
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 7e-14
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 7e-14
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-12
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 5e-12
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 7e-12
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 8e-12
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 7e-11
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-07
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 3e-07
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 4e-07
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 5e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 3e-06
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 1e-05
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 7e-05
PLN032101153 PLN03210, PLN03210, Resistant to P 1e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 3e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 4e-04
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 4e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 6e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.001
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.001
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
 Score =  258 bits (660), Expect = 7e-73
 Identities = 233/724 (32%), Positives = 322/724 (44%), Gaps = 145/724 (20%)

Query: 14  LQLSLLFFQCSAKLCSQEQSSALLQFKQLFSFAKTSSSQCDGYQQSYPKMKYWKEDADCC 73
           L   L F   +  +   E+   LL FK         SS  D  +     +  W   AD C
Sbjct: 12  LIFMLFFLFLNFSMLHAEELELLLSFK---------SSINDPLKY----LSNWNSSADVC 58

Query: 74  SSWDGVTCDMVTGQVIGLDLSCSWLHGSISSNSSLFFLPRLQKLNLGSNDFNYSKISSGF 133
             W G+TC+  + +V+ +DLS   + G ISS  ++F LP +Q +NL +N  +       F
Sbjct: 59  L-WQGITCNNSS-RVVSIDLSGKNISGKISS--AIFRLPYIQTINLSNNQLSGPIPDDIF 114

Query: 134 SQLRSLTLLNLSSSNFTGSIPPSLGNLTQLVYLDLSNNSFIGEIPNMFTNQSKLSYLNFG 193
           +   SL  LNLS++NFTGSIP   G++  L  LDLSNN   GEIPN   + S L  L+ G
Sbjct: 115 TTSSSLRYLNLSNNNFTGSIPR--GSIPNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLG 172

Query: 194 GNQLTGQIPSSVGELANLATVYLYFNSLKGTIPSRIFSLTSLKQVDFRHNQLSGSVPSSV 253
           GN L G+IP+S+  L +L  + L  N L G IP  +  + SLK +   +N LSG +P  +
Sbjct: 173 GNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEI 232

Query: 254 YELVNLTRLDLSSNKLSGTVELYDFAKLKNLKWLVLSNNSLSLTTKLTVSSSFLNLSRLG 313
             L +L  LDL  N L+G +       LKNL++L L  N LS      +  S  +L +L 
Sbjct: 233 GGLTSLNHLDLVYNNLTGPIPS-SLGNLKNLQYLFLYQNKLSGP----IPPSIFSLQKL- 286

Query: 314 LSACKISKFPVILKTQLQLEWLDLSENQIHGRVPGWMWDVGIHTLSYLDLSQNFLRSIKR 373
                IS              LDLS+N + G +P  +                       
Sbjct: 287 -----IS--------------LDLSDNSLSGEIPELV----------------------- 304

Query: 374 LPWKNLKNLYLDSNLLRGRLLDLPPLMTIFSISNNYLTGEIPSSFCNLSSIQYLEMSNNS 433
           +  +NL+ L+L SN                       TG+IP +  +L  +Q L++ +N 
Sbjct: 305 IQLQNLEILHLFSN---------------------NFTGKIPVALTSLPRLQVLQLWSNK 343

Query: 434 FSGQIPQCL---VNSTVKFLDLRMNNFQGIIPQTYAKDCNLTFLKLNGNKLEGPLPPSLI 490
           FSG+IP+ L    N TV  LDL  NN  G IP+      NL  L L  N LEG +P SL 
Sbjct: 344 FSGEIPKNLGKHNNLTV--LDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLG 401

Query: 491 NCFSLHVIDVGNNNLSGEIPQCFGNSALKVF-DMRMNRFNGSIPQMFAKSCDLRSLNLNG 549
            C SL  + + +N+ SGE+P  F    L  F D+  N   G I         L+ L+L  
Sbjct: 402 ACRSLRRVRLQDNSFSGELPSEFTKLPLVYFLDISNNNLQGRINSRKWDMPSLQMLSLAR 461

Query: 550 NQLEGPLSPSLINCRYLEVLDIGNNHINDTFPYWLEILPELRVLILRSNRFWGPIGNTKT 609
           N+  G L P     + LE LD+  N  +   P  L  L EL  L L  N+  G I +  +
Sbjct: 462 NKFFGGL-PDSFGSKRLENLDLSRNQFSGAVPRKLGSLSELMQLKLSENKLSGEIPDELS 520

Query: 610 RAPFSKLRILDLSHNQLTGVLPTRYLNNFRAMIHGENNSVTVEVKYLSLLNSSYYACYES 669
                KL  LDLSHNQL+G +P  +                 E+  LS L          
Sbjct: 521 SC--KKLVSLDLSHNQLSGQIPASF----------------SEMPVLSQL---------- 552

Query: 670 IILTMKGIDLQLERVLTIFTTIDLSSNRFQGGIPAIVGKLNSLKGLNISHNNLTGGIPSS 729
                                 DLS N+  G IP  +G + SL  +NISHN+L G +PS+
Sbjct: 553 ----------------------DLSQNQLSGEIPKNLGNVESLVQVNISHNHLHGSLPST 590

Query: 730 LANL 733
            A L
Sbjct: 591 GAFL 594

Length = 968
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 882
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG4194873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 100.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 100.0
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.97
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.96
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.89
PLN032101153 Resistant to P. syringae 6; Provisional 99.89
KOG4237498 consensus Extracellular matrix protein slit, conta 99.88
KOG4237498 consensus Extracellular matrix protein slit, conta 99.86
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.86
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.83
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.79
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.76
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.75
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.71
KOG0617264 consensus Ras suppressor protein (contains leucine 99.65
PLN03150623 hypothetical protein; Provisional 99.61
KOG0617264 consensus Ras suppressor protein (contains leucine 99.6
PLN03150623 hypothetical protein; Provisional 99.54
KOG0532722 consensus Leucine-rich repeat (LRR) protein, conta 99.12
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.09
KOG0532722 consensus Leucine-rich repeat (LRR) protein, conta 99.09
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.07
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.06
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.04
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.02
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.0
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.98
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.96
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.93
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.91
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.89
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.84
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.83
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.8
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.79
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.75
PF0826343 LRRNT_2: Leucine rich repeat N-terminal domain; In 98.62
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.35
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.33
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.31
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.27
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.25
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.22
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.05
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.96
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.85
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.78
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.75
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.73
PRK15386426 type III secretion protein GogB; Provisional 97.66
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.63
PRK15386426 type III secretion protein GogB; Provisional 97.56
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.39
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.36
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.22
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.11
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.07
KOG4341483 consensus F-box protein containing LRR [General fu 97.07
KOG4341483 consensus F-box protein containing LRR [General fu 97.05
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.59
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.37
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.18
KOG1947482 consensus Leucine rich repeat proteins, some prote 95.76
KOG2123388 consensus Uncharacterized conserved protein [Funct 95.49
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.36
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.3
KOG1947482 consensus Leucine rich repeat proteins, some prote 93.48
KOG4308478 consensus LRR-containing protein [Function unknown 92.43
KOG4308478 consensus LRR-containing protein [Function unknown 91.8
KOG0473326 consensus Leucine-rich repeat protein [Function un 89.53
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 89.39
KOG0473326 consensus Leucine-rich repeat protein [Function un 88.57
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 86.83
smart0037026 LRR Leucine-rich repeats, outliers. 86.83
smart0037026 LRR Leucine-rich repeats, outliers. 86.31
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 86.31
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 84.08
KOG3864221 consensus Uncharacterized conserved protein [Funct 82.31
KOG3864221 consensus Uncharacterized conserved protein [Funct 80.39
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=1.1e-72  Score=702.10  Aligned_cols=583  Identities=36%  Similarity=0.583  Sum_probs=467.5

Q ss_pred             CHHHHHHHHHhhhhcCCCCCCCCcCCCccccCCCCCCCCCCCCCCCCCCceeecCCCCcEEEEECCCCCCccccCCCCcc
Q 002771           29 SQEQSSALLQFKQLFSFAKTSSSQCDGYQQSYPKMKYWKEDADCCSSWDGVTCDMVTGQVIGLDLSCSWLHGSISSNSSL  108 (882)
Q Consensus        29 ~~~~~~~ll~~k~~~~~~~~~~~~~~~~~~~~~~l~~w~~~~~~c~~w~gv~c~~~~~~v~~l~L~~~~l~g~~~~~~~l  108 (882)
                      .++|++||++||+++.++..             .+.+|....+|| .|.||+|+. .++|+.|+|+++++.|.+++  .+
T Consensus        27 ~~~~~~~l~~~~~~~~~~~~-------------~~~~w~~~~~~c-~w~gv~c~~-~~~v~~L~L~~~~i~~~~~~--~~   89 (968)
T PLN00113         27 HAEELELLLSFKSSINDPLK-------------YLSNWNSSADVC-LWQGITCNN-SSRVVSIDLSGKNISGKISS--AI   89 (968)
T ss_pred             CHHHHHHHHHHHHhCCCCcc-------------cCCCCCCCCCCC-cCcceecCC-CCcEEEEEecCCCccccCCh--HH
Confidence            57899999999999965432             578998778899 999999986 47999999999999998876  78


Q ss_pred             cCCCCCCEEECCCCCCCCCCCcccc-cCCCCCCEEeCCCCCCCCCCCccccCCCCCCEEECcCCCCCCCccccccCCCCC
Q 002771          109 FFLPRLQKLNLGSNDFNYSKISSGF-SQLRSLTLLNLSSSNFTGSIPPSLGNLTQLVYLDLSNNSFIGEIPNMFTNQSKL  187 (882)
Q Consensus       109 ~~l~~L~~L~Ls~n~~~~~~~~~~l-~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~L~~L~Ls~n~~~~~~p~~~~~l~~L  187 (882)
                      ..+++|++|+|++|.+.+. +|..+ ..+++|++|+|++|.+++.+|.  +.+++|++|+|++|.+.+.+|..++++++|
T Consensus        90 ~~l~~L~~L~Ls~n~~~~~-ip~~~~~~l~~L~~L~Ls~n~l~~~~p~--~~l~~L~~L~Ls~n~~~~~~p~~~~~l~~L  166 (968)
T PLN00113         90 FRLPYIQTINLSNNQLSGP-IPDDIFTTSSSLRYLNLSNNNFTGSIPR--GSIPNLETLDLSNNMLSGEIPNDIGSFSSL  166 (968)
T ss_pred             hCCCCCCEEECCCCccCCc-CChHHhccCCCCCEEECcCCccccccCc--cccCCCCEEECcCCcccccCChHHhcCCCC
Confidence            8899999999999988765 66554 4888999999999988887775  467888888888888888888888888888


Q ss_pred             CEEEccCCcCCCCCcccccCCCCCcEEeccCCcccccCCccccCCCCCcEEEccCCCCCCCCchhhhcCCcCCeEecCCC
Q 002771          188 SYLNFGGNQLTGQIPSSVGELANLATVYLYFNSLKGTIPSRIFSLTSLKQVDFRHNQLSGSVPSSVYELVNLTRLDLSSN  267 (882)
Q Consensus       188 ~~L~Ls~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~L~~n  267 (882)
                      ++|++++|.+.+.+|..++++++|++|++++|.+.+.+|..++++++|++|++++|.+.+.+|..+.++++|++|++++|
T Consensus       167 ~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n  246 (968)
T PLN00113        167 KVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYN  246 (968)
T ss_pred             CEEECccCcccccCChhhhhCcCCCeeeccCCCCcCcCChHHcCcCCccEEECcCCccCCcCChhHhcCCCCCEEECcCc
Confidence            88888888888888888888888888888888888788888888888888888888888777777777777777777777


Q ss_pred             cccccccchhhcCCCCCCceeccccccCCCccccccccccccCccccccccCCCCChhhhcCCCccEEEccccccccCCC
Q 002771          268 KLSGTVELYDFAKLKNLKWLVLSNNSLSLTTKLTVSSSFLNLSRLGLSACKISKFPVILKTQLQLEWLDLSENQIHGRVP  347 (882)
Q Consensus       268 ~l~~~i~~~~l~~l~~L~~L~L~~n~~~~~~~~~~~~~~~~L~~L~L~~~~l~~ip~~l~~~~~L~~L~L~~n~i~~~~~  347 (882)
                      .+++.+|. .+.++++|++|++++|.+  .+                      .+|..+..+++|++|++++        
T Consensus       247 ~l~~~~p~-~l~~l~~L~~L~L~~n~l--~~----------------------~~p~~l~~l~~L~~L~Ls~--------  293 (968)
T PLN00113        247 NLTGPIPS-SLGNLKNLQYLFLYQNKL--SG----------------------PIPPSIFSLQKLISLDLSD--------  293 (968)
T ss_pred             eeccccCh-hHhCCCCCCEEECcCCee--ec----------------------cCchhHhhccCcCEEECcC--------
Confidence            77655543 444444444444444443  11                      2222222222233333222        


Q ss_pred             chhhcccCCCccEEeCCCCccCCCCCCCCCCCceEEccCcccCCcCCCCCCCCcEEEcccccccccCCCcccCCCCCcEE
Q 002771          348 GWMWDVGIHTLSYLDLSQNFLRSIKRLPWKNLKNLYLDSNLLRGRLLDLPPLMTIFSISNNYLTGEIPSSFCNLSSIQYL  427 (882)
Q Consensus       348 ~~~~~~~~~~L~~L~Ls~n~l~~i~~~~~~~L~~L~l~~n~l~~~~~~~~~~L~~L~ls~n~l~~~~~~~~~~l~~L~~L  427 (882)
                                                                                  |.+.+.+|..+.++++|++|
T Consensus       294 ------------------------------------------------------------n~l~~~~p~~~~~l~~L~~L  313 (968)
T PLN00113        294 ------------------------------------------------------------NSLSGEIPELVIQLQNLEIL  313 (968)
T ss_pred             ------------------------------------------------------------CeeccCCChhHcCCCCCcEE
Confidence                                                                        22223344444555556666


Q ss_pred             eccCceeeccCCccccCCCcceEEcccCccCCcCchhhhccCCcCeEeccCccccCcCChhhhcCCCCcEEEccCCcCcc
Q 002771          428 EMSNNSFSGQIPQCLVNSTVKFLDLRMNNFQGIIPQTYAKDCNLTFLKLNGNKLEGPLPPSLINCFSLHVIDVGNNNLSG  507 (882)
Q Consensus       428 ~Ls~n~l~~~~p~~~~~~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~Ls~n~l~~  507 (882)
                      ++++|.+++                       ..|..+..+++|+.|++++|.+.+.+|..+..+++|+.|++++|++++
T Consensus       314 ~l~~n~~~~-----------------------~~~~~~~~l~~L~~L~L~~n~l~~~~p~~l~~~~~L~~L~Ls~n~l~~  370 (968)
T PLN00113        314 HLFSNNFTG-----------------------KIPVALTSLPRLQVLQLWSNKFSGEIPKNLGKHNNLTVLDLSTNNLTG  370 (968)
T ss_pred             ECCCCccCC-----------------------cCChhHhcCCCCCEEECcCCCCcCcCChHHhCCCCCcEEECCCCeeEe
Confidence            655555544                       445556666777777777777777777777777777888888787777


Q ss_pred             ccCccccC-CCccEEEccCCcCccccchhhccCCCCCEEeCCCCccCCCCCccccCCCCCcEEECcCccCCCccchhhhC
Q 002771          508 EIPQCFGN-SALKVFDMRMNRFNGSIPQMFAKSCDLRSLNLNGNQLEGPLSPSLINCRYLEVLDIGNNHINDTFPYWLEI  586 (882)
Q Consensus       508 ~~p~~~~~-~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~Ls~N~l~~~~~~~l~~  586 (882)
                      .+|..+.. ++|+.|++++|++.+.+|..+..+++|+.|++++|++++.+|..|.++++|+.|++++|.+++.+|..+..
T Consensus       371 ~~p~~~~~~~~L~~L~l~~n~l~~~~p~~~~~~~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~~~~~~~  450 (968)
T PLN00113        371 EIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFSGELPSEFTKLPLVYFLDISNNNLQGRINSRKWD  450 (968)
T ss_pred             eCChhHhCcCCCCEEECcCCEecccCCHHHhCCCCCCEEECcCCEeeeECChhHhcCCCCCEEECcCCcccCccChhhcc
Confidence            77777766 77888888888888888888888888899999999888888888888899999999999998888888888


Q ss_pred             CCCCcEEEccCccccccCCCCCCCCCCCCCcEEECCCCcCccCCChHHHhhhhhcccCCCCceeEEEEeeeccCCcccee
Q 002771          587 LPELRVLILRSNRFWGPIGNTKTRAPFSKLRILDLSHNQLTGVLPTRYLNNFRAMIHGENNSVTVEVKYLSLLNSSYYAC  666 (882)
Q Consensus       587 l~~L~~L~L~~n~l~~~~~~~~~~~~l~~L~~L~Ls~N~l~g~~p~~~~~~~~~l~~~~~~~~~~~~~~l~~~~~~~~~~  666 (882)
                      +++|+.|++++|++.+.+|...   ..++|+.||+++|++++.+|..+ .+                             
T Consensus       451 l~~L~~L~L~~n~~~~~~p~~~---~~~~L~~L~ls~n~l~~~~~~~~-~~-----------------------------  497 (968)
T PLN00113        451 MPSLQMLSLARNKFFGGLPDSF---GSKRLENLDLSRNQFSGAVPRKL-GS-----------------------------  497 (968)
T ss_pred             CCCCcEEECcCceeeeecCccc---ccccceEEECcCCccCCccChhh-hh-----------------------------
Confidence            8999999999999888777654   35789999999999999888653 11                             


Q ss_pred             eeeEEEEeecchhHHHhhhccccEeeCCCCcccccchhhhcCCCCCCEEeCCCCccCccCChhhhccCCCCEEeCCCCcc
Q 002771          667 YESIILTMKGIDLQLERVLTIFTTIDLSSNRFQGGIPAIVGKLNSLKGLNISHNNLTGGIPSSLANLTELESLDLSSNKL  746 (882)
Q Consensus       667 ~~~~~~~~~~~~~~~~~~l~~L~~LdLs~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~ip~~l~~L~~L~~L~Ls~N~l  746 (882)
                                        ++.|+.|+|++|++++.+|..++++++|++|+|++|.++|.+|..++++++|+.|||++|++
T Consensus       498 ------------------l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l  559 (968)
T PLN00113        498 ------------------LSELMQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQL  559 (968)
T ss_pred             ------------------hhccCEEECcCCcceeeCChHHcCccCCCEEECCCCcccccCChhHhCcccCCEEECCCCcc
Confidence                              56789999999999999999999999999999999999999999999999999999999999


Q ss_pred             cccCCccccCCCCCCEEeCcCCcCccCCCCCCcCCccCcccccCCCCCCCCC
Q 002771          747 VGQIPMQMASLKSLSVLNLSHNQLEGPVPRGTQFNTFQNDSYAGNPGLCGFP  798 (882)
Q Consensus       747 ~~~ip~~l~~l~~L~~L~ls~N~l~g~iP~~~~~~~~~~~~~~gn~~lcg~~  798 (882)
                      +|.+|..+..+++|+.+++++|+++|.+|..++|.++...++.||+++||.+
T Consensus       560 ~~~~p~~l~~l~~L~~l~ls~N~l~~~~p~~~~~~~~~~~~~~~n~~lc~~~  611 (968)
T PLN00113        560 SGEIPKNLGNVESLVQVNISHNHLHGSLPSTGAFLAINASAVAGNIDLCGGD  611 (968)
T ss_pred             cccCChhHhcCcccCEEeccCCcceeeCCCcchhcccChhhhcCCccccCCc
Confidence            9999999999999999999999999999999999999999999999999864

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query882
3rgx_A768 Structural Insight Into Brassinosteroid Perception 3e-40
3rgx_A768 Structural Insight Into Brassinosteroid Perception 1e-29
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 5e-19
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 5e-40
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 1e-29
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 7e-19
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 5e-18
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 4e-13
2omx_A 462 Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX 6e-06
2omu_A462 Crystal Structure Of Inla G194s+s Y369s/hec1 Comple 9e-06
2omu_A 462 Crystal Structure Of Inla G194s+s Y369s/hec1 Comple 3e-05
3rfj_A279 Design Of A Binding Scaffold Based On Variable Lymp 1e-05
3m19_A251 Crystal Structure Of Variable Lymphocyte Receptor V 3e-05
3m18_A251 Crystal Structure Of Variable Lymphocyte Receptor V 3e-05
2omt_A 462 Crystal Structure Of Inla G194s+sHEC1 COMPLEX Lengt 3e-05
3rfs_A272 Design Of A Binding Scaffold Based On Variable Lymp 4e-05
3cig_A 697 Crystal Structure Of Mouse Tlr3 Ectodomain Length = 8e-05
2omv_A461 Crystal Structure Of Inla S192n Y369s/hec1 Complex 2e-04
2omv_A 461 Crystal Structure Of Inla S192n Y369s/hec1 Complex 5e-04
2z63_A570 Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 A 2e-04
2o6q_A270 Structural Diversity Of The Hagfish Variable Lympho 2e-04
2omy_A461 Crystal Structure Of Inla S192n/hec1 Complex Length 2e-04
2omy_A 461 Crystal Structure Of Inla S192n/hec1 Complex Length 5e-04
1xcd_A329 Dimeric Bovine Tissue-Extracted Decorin, Crystal Fo 3e-04
1xku_A330 Crystal Structure Of The Dimeric Protein Core Of De 3e-04
3j0a_A 844 Homology Model Of Human Toll-Like Receptor 5 Fitted 3e-04
1m0z_A290 Crystal Structure Of The Von Willebrand Factor Bind 4e-04
2omz_A466 Crystal Structure Of Inla Y369a/hec1 Complex Length 4e-04
2omz_A466 Crystal Structure Of Inla Y369a/hec1 Complex Length 4e-04
1m10_B290 Crystal Structure Of The Complex Of Glycoprotein Ib 4e-04
4g8a_A635 Crystal Structure Of Human Tlr4 Polymorphic Variant 4e-04
1o6s_A466 Internalin (Listeria Monocytogenes) E-Cadherin (Hum 4e-04
1o6s_A466 Internalin (Listeria Monocytogenes) E-Cadherin (Hum 6e-04
3e6j_A229 Crystal Structure Of Variable Lymphocyte Receptor ( 5e-04
3p72_A269 Structure Of Platelet Glycoprotein 1b Alpha With A 5e-04
1u0n_D265 The Ternary Von Willebrand Factor A1-Glycoprotein I 5e-04
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure 
Iteration: 1

 Score =  164 bits (414), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 198/771 (25%), Positives = 322/771 (41%), Gaps = 146/771 (18%)
Query: 75  SWDGVTCDMVTGQVIGLDLSCSWLHGSISSNSSLFFLPRLQKLNLGSNDFNY-SKISSGF 133
           S  G  C   +  +  LDLS + L G +++ +SL     L+ LN+ SN  ++  K+S G 
Sbjct: 92  SVSGFKC---SASLTSLDLSRNSLSGPVTTLTSLGSCSGLKFLNVSSNTLDFPGKVSGGL 148
Query: 134 XXXXXXXXXXXXXXNFTGSIPPSLGNLTQLVYLDLSNNSFIGE--IPNMFTNQ-SKLSYL 190
                                     L  L  LDLS NS  G   +  + ++   +L +L
Sbjct: 149 -------------------------KLNSLEVLDLSANSISGANVVGWVLSDGCGELKHL 183
Query: 191 NFGGNQLTGQIPSSVGELANLATVYLYFNSLKGTIPSRIFSLTSLKQVDFRHNQLSGSVP 250
              GN+++G +   V    NL  + +  N+    IP  +   ++L+ +D   N+LSG   
Sbjct: 184 AISGNKISGDV--DVSRCVNLEFLDVSSNNFSTGIP-FLGDCSALQHLDISGNKLSGDFS 240
Query: 251 SSVYELVNLTRLDLSSNKLSGTVELYDFAXXXXXXXXXXXXXXXXXXXXXXXXXXFLNLS 310
            ++     L  L++SSN+  G +                                     
Sbjct: 241 RAISTCTELKLLNISSNQFVGPIP------------------------------------ 264
Query: 311 RLGLSACKISKFPVILKTQLQLEWLDLSENQIHGRVPGWMWDVGIHTLSYLDLSQN-FLR 369
                       P+ LK+   L++L L+EN+  G +P ++      TL+ LDLS N F  
Sbjct: 265 ------------PLPLKS---LQYLSLAENKFTGEIPDFLSGA-CDTLTGLDLSGNHFYG 308
Query: 370 SIKRLPWKNLKNXXXXXXXXXXXXXXXXXXMTIFSISNNYLTGEIP-SSFCNLSSIQYLE 428
           ++                            +   ++S+N  +GE+P  +   +  ++ L+
Sbjct: 309 AVPPF-------------------FGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLD 349
Query: 429 MSNNSFSGQIPQCLVN--STVKFLDLRMNNFQG-IIPQTYAKDCN-LTFLKLNGNKLEGP 484
           +S N FSG++P+ L N  +++  LDL  NNF G I+P       N L  L L  N   G 
Sbjct: 350 LSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGK 409
Query: 485 LPPSLINCFSLHVIDVGNNNLSGEIPQCFGN-SALKVFDMRMNRFNGSIPQMFAKSCDLR 543
           +PP+L NC  L  + +  N LSG IP   G+ S L+   + +N   G IPQ       L 
Sbjct: 410 IPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLE 469
Query: 544 SLNLNGNQLEGPLSPSLINCRYLEVLDIGNNHINDTFPYWLEILPELRVLILRSNRFWGP 603
           +L L+ N L G +   L NC  L  + + NN +    P W+  L  L +L L +N F G 
Sbjct: 470 TLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGN 529
Query: 604 IGNTKTRAPFSKLRILDLSHNQLTGVLPTRYLNNFRAMIHGENNSVTVEVKYLSLLNSSY 663
           I           L  LDL+ N   G +P      F+       N +  + +Y+ + N   
Sbjct: 530 I--PAELGDCRSLIWLDLNTNLFNGTIPAAM---FKQSGKIAANFIAGK-RYVYIKNDGM 583
Query: 664 YA-CYESI-ILTMKGIDLQLERVLTIFTTIDLSSNRFQGGIPAIVGKLNSLKGLNISHNN 721
              C+ +  +L  +GI  +    L+     +++S  + G          S+  L++S+N 
Sbjct: 584 KKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNM 643
Query: 722 LTGGIPSSLANLTELESLDLSSNKLVGQIPMQMASLKSLSVLNLSHNQLE---------- 771
           L+G IP  + ++  L  L+L  N + G IP ++  L+ L++L+LS N+L+          
Sbjct: 644 LSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSAL 703
Query: 772 --------------GPVPRGTQFNTFQNDSYAGNPGLCGFPLSESCDMDEA 808
                         GP+P   QF TF    +  NPGLCG+PL   CD   A
Sbjct: 704 TMLTEIDLSNNNLSGPIPEMGQFETFPPAKFLNNPGLCGYPLPR-CDPSNA 753
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|2OMX|A Chain A, Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMU|A Chain A, Crystal Structure Of Inla G194s+s Y369s/hec1 Complex Length = 462 Back     alignment and structure
>pdb|2OMU|A Chain A, Crystal Structure Of Inla G194s+s Y369s/hec1 Complex Length = 462 Back     alignment and structure
>pdb|3RFJ|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 279 Back     alignment and structure
>pdb|3M19|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R5.1 Length = 251 Back     alignment and structure
>pdb|3M18|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R2.1 In Complex With Hen Egg Lysozyme Length = 251 Back     alignment and structure
>pdb|2OMT|A Chain A, Crystal Structure Of Inla G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|3RFS|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 272 Back     alignment and structure
>pdb|3CIG|A Chain A, Crystal Structure Of Mouse Tlr3 Ectodomain Length = 697 Back     alignment and structure
>pdb|2OMV|A Chain A, Crystal Structure Of Inla S192n Y369s/hec1 Complex Length = 461 Back     alignment and structure
>pdb|2OMV|A Chain A, Crystal Structure Of Inla S192n Y369s/hec1 Complex Length = 461 Back     alignment and structure
>pdb|2Z63|A Chain A, Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 570 Back     alignment and structure
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure
>pdb|2OMY|A Chain A, Crystal Structure Of Inla S192n/hec1 Complex Length = 461 Back     alignment and structure
>pdb|2OMY|A Chain A, Crystal Structure Of Inla S192n/hec1 Complex Length = 461 Back     alignment and structure
>pdb|1XCD|A Chain A, Dimeric Bovine Tissue-Extracted Decorin, Crystal Form 1 Length = 329 Back     alignment and structure
>pdb|1XKU|A Chain A, Crystal Structure Of The Dimeric Protein Core Of Decorin, The Archetypal Small Leucine-Rich Repeat Proteoglycan Length = 330 Back     alignment and structure
>pdb|3J0A|A Chain A, Homology Model Of Human Toll-Like Receptor 5 Fitted Into An Electron Microscopy Single Particle Reconstruction Length = 844 Back     alignment and structure
>pdb|1M0Z|A Chain A, Crystal Structure Of The Von Willebrand Factor Binding Domain Of Glycoprotein Ib Alpha Length = 290 Back     alignment and structure
>pdb|2OMZ|A Chain A, Crystal Structure Of Inla Y369a/hec1 Complex Length = 466 Back     alignment and structure
>pdb|2OMZ|A Chain A, Crystal Structure Of Inla Y369a/hec1 Complex Length = 466 Back     alignment and structure
>pdb|1M10|B Chain B, Crystal Structure Of The Complex Of Glycoprotein Ib Alpha And The Von Willebrand Factor A1 Domain Length = 290 Back     alignment and structure
>pdb|4G8A|A Chain A, Crystal Structure Of Human Tlr4 Polymorphic Variant D299g And T399i In Complex With Md-2 And Lps Length = 635 Back     alignment and structure
>pdb|1O6S|A Chain A, Internalin (Listeria Monocytogenes) E-Cadherin (Human) Recognition Complex Length = 466 Back     alignment and structure
>pdb|1O6S|A Chain A, Internalin (Listeria Monocytogenes) E-Cadherin (Human) Recognition Complex Length = 466 Back     alignment and structure
>pdb|3E6J|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor (Vlr) Rbc36 In Complex With H-Trisaccharide Length = 229 Back     alignment and structure
>pdb|3P72|A Chain A, Structure Of Platelet Glycoprotein 1b Alpha With A Bound Peptide Inhibitor Length = 269 Back     alignment and structure
>pdb|1U0N|D Chain D, The Ternary Von Willebrand Factor A1-Glycoprotein Ibalpha- Botrocetin Complex Length = 265 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query882
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-176
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-128
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-15
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-10
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-114
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-81
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 7e-67
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-33
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 7e-22
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-86
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-82
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-54
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-49
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-48
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-25
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-79
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-73
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-69
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-42
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-32
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-24
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-06
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-74
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-69
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-68
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-61
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-40
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-28
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-26
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-13
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-72
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-68
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-39
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-16
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 8e-64
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 6e-62
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-61
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 6e-59
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-27
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-63
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-60
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-53
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-49
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-48
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-28
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 7e-17
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-54
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-49
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-54
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-53
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-51
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-49
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-36
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-25
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 9e-11
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-09
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-51
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-39
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-34
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-32
1o6v_A466 Internalin A; bacterial infection, extracellular r 9e-47
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-40
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-40
1o6v_A466 Internalin A; bacterial infection, extracellular r 6e-32
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-46
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-46
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-45
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-40
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-39
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-14
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-07
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-44
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-41
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-40
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-33
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-31
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-26
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-26
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-22
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-16
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 6e-08
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-43
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-40
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-31
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-31
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-11
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-05
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-38
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 7e-30
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 9e-30
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 9e-27
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-22
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-17
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-07
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-38
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-37
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 8e-34
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-32
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-28
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 7e-25
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-14
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-13
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 8e-38
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-37
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-32
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-30
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 8e-25
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 8e-23
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 8e-16
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-11
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-04
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-35
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 9e-34
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-32
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 6e-16
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-35
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-30
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-25
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-22
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-21
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-21
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-34
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 8e-31
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-26
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-25
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 8e-20
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 8e-20
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 7e-17
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 8e-16
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-15
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-07
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-33
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-27
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-23
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-23
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-33
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 6e-24
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 6e-18
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-17
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-16
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-06
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-33
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-30
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-28
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-28
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-24
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-22
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 9e-20
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-19
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-18
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-32
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-32
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-27
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-20
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-19
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 9e-17
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 8e-16
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-15
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-13
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-13
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-31
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-30
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 5e-29
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 5e-23
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-31
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-27
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-26
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-24
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-20
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-15
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 9e-15
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 7e-31
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-30
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-28
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-27
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-20
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-19
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-17
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-29
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 9e-25
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-21
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-20
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-16
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-14
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-14
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-12
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-06
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 8e-29
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-27
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-25
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-22
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-17
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-17
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-17
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-16
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-28
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-19
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-15
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 6e-14
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-12
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-12
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 6e-10
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-09
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-07
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-05
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-27
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-26
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-25
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-21
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 6e-17
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-16
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-16
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-14
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 9e-10
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 4e-07
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-27
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-25
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-21
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 7e-17
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-16
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 5e-13
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 4e-08
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 3e-07
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 6e-27
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-24
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 7e-17
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-12
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 3e-25
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 9e-23
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-20
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-17
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 4e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-24
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 6e-22
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-21
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-10
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 6e-08
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 6e-06
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 4e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 9e-24
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-20
4ezg_A197 Putative uncharacterized protein; internalin-A, le 7e-20
4ezg_A197 Putative uncharacterized protein; internalin-A, le 7e-17
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-13
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-12
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-12
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-04
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 2e-23
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 4e-23
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 3e-22
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 4e-17
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 8e-15
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-14
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 2e-12
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-23
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 5e-21
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-17
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 6e-17
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 8e-17
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-15
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-12
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-23
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-17
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-12
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 7e-08
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 7e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 9e-05
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 8e-04
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 7e-23
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-21
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 5e-19
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 8e-08
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 5e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-06
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-05
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-05
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-22
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-21
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-13
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-13
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-12
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 8e-22
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-17
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-15
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-13
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 8e-11
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-08
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-07
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 8e-05
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 1e-04
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-04
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-21
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-18
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-16
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-10
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-06
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 5e-06
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-21
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-21
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-16
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-14
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-12
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-12
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 5e-11
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-08
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-19
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-14
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-13
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-11
3m19_A251 Variable lymphocyte receptor A diversity region; a 5e-10
3m19_A251 Variable lymphocyte receptor A diversity region; a 4e-04
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 6e-19
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 3e-14
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 3e-11
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-04
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 6e-18
3e6j_A229 Variable lymphocyte receptor diversity region; var 5e-08
3e6j_A229 Variable lymphocyte receptor diversity region; var 9e-08
3e6j_A229 Variable lymphocyte receptor diversity region; var 3e-05
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 8e-18
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 6e-13
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-11
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 7e-11
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-10
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 5e-08
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-05
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 7e-17
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-13
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-13
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-09
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-08
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 8e-08
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-07
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-07
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 8e-07
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-06
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-06
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 2e-16
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 2e-08
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 9e-05
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-15
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 8e-12
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-10
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-10
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-10
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 9e-08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-14
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-11
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-10
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 8e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 7e-04
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-13
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 7e-13
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-12
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-11
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 9e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-13
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-11
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 9e-11
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-05
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 9e-12
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 5e-10
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 1e-08
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 2e-05
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 2e-04
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 4e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 4e-11
1w8a_A192 SLIT protein; signaling protein, secreted protein, 3e-08
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-07
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 9e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 6e-11
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-07
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 6e-07
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 8e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-08
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-10
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 4e-10
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-07
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 4e-07
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-10
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-06
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 7e-10
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 4e-09
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 6e-09
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 7e-09
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 9e-07
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 1e-06
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 6e-06
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 6e-06
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 4e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-09
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 4e-09
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 7e-09
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-09
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-09
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-08
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 3e-07
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 2e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-04
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 6e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 6e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-09
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 7e-09
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 6e-05
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 9e-09
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 5e-07
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 5e-06
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 5e-06
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 2e-05
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 4e-08
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 4e-07
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 1e-04
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 6e-04
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 6e-04
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 6e-08
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 4e-06
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 1e-05
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 2e-04
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 9e-08
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 9e-06
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 5e-05
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 3e-04
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 1e-06
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 1e-05
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 2e-06
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 3e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 6e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 2e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 3e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 4e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  526 bits (1358), Expect = e-176
 Identities = 192/733 (26%), Positives = 283/733 (38%), Gaps = 127/733 (17%)

Query: 91  LDLSCSWLHGSISSNSSLF-FLPRLQKLNLGSNDFNYSKISSGFSQLRSLTLLNLSSSNF 149
           LDLS + + G+      L      L+ L +  N  +   +    S+  +L  L++SS+NF
Sbjct: 156 LDLSANSISGANVVGWVLSDGCGELKHLAISGNKIS-GDVD--VSRCVNLEFLDVSSNNF 212

Query: 150 TGSIPPSLGNLTQLVYLDLSNNSFIGEIPNMFTNQSKLSYLNFGGNQLTGQIPSSVGELA 209
           +  IP  LG+ + L +LD+S N   G+     +  ++L  LN   NQ  G IP     L 
Sbjct: 213 STGIP-FLGDCSALQHLDISGNKLSGDFSRAISTCTELKLLNISSNQFVGPIPPL--PLK 269

Query: 210 NLATVYLYFNSLKGTIPSRIF-SLTSLKQVDFRHNQLSGSVPSSVYELVNLTRLDLSSNK 268
           +L  + L  N   G IP  +  +  +L  +D   N   G+VP        L  L LSSN 
Sbjct: 270 SLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNN 329

Query: 269 LSGTVELYDFAKLKNLKWLVLSNNSLSLTTKLTVSSSFLNLSRLGLSACKISKFPVILKT 328
            SG + +    K++ LK L LS N  S      +  S  NLS                  
Sbjct: 330 FSGELPMDTLLKMRGLKVLDLSFNEFSGE----LPESLTNLS------------------ 367

Query: 329 QLQLEWLDLSENQIHGRVPGWMWDVGIHTLSYLDLSQNFLRSIKRLPWKNLKNLYLDSNL 388
              L  LDLS N   G +   +     +TL  L L                         
Sbjct: 368 -ASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQ------------------------ 402

Query: 389 LRGRLLDLPPLMTIFSISNNYLTGEIPSSFCNLSSIQYLEMSNNSFSGQIPQCLVN-STV 447
                             NN  TG+IP +  N S +  L +S N  SG IP  L + S +
Sbjct: 403 ------------------NNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKL 444

Query: 448 KFLDLRMNNFQGIIPQTYAKDCNLTFLKLNGNKLEGPLPPSLINCFSLHVIDVGNNNLSG 507
           + L L +N  +G IPQ       L  L L+ N L G +P  L NC +L+ I + NN L+G
Sbjct: 445 RDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTG 504

Query: 508 EIPQCFGN-SALKVFDMRMNRFNGSIPQMFAKSCDLRSLNLNGNQLEGPLSPSLINCRYL 566
           EIP+  G    L +  +  N F+G+IP        L  L+LN N   G +  ++      
Sbjct: 505 EIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQS-- 562

Query: 567 EVLDIGNNHINDTFPYWLEILPELRVLILRSNRFWGPIGNTKTRAPFSKLRILDLSHNQL 626
               I  N I      +++     +      N        ++     S     +++    
Sbjct: 563 --GKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVY 620

Query: 627 TGVLPTRYLNNFRAMIHGENNSVTVEVKYLSLLNSSYYACYESIILTMKGIDLQLERVLT 686
            G                              +                           
Sbjct: 621 GGHTSP-------------------TFDNNGSM--------------------------- 634

Query: 687 IFTTIDLSSNRFQGGIPAIVGKLNSLKGLNISHNNLTGGIPSSLANLTELESLDLSSNKL 746
               +D+S N   G IP  +G +  L  LN+ HN+++G IP  + +L  L  LDLSSNKL
Sbjct: 635 --MFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKL 692

Query: 747 VGQIPMQMASLKSLSVLNLSHNQLEGPVPRGTQFNTFQNDSYAGNPGLCGFPLSESCDMD 806
            G+IP  M++L  L+ ++LS+N L GP+P   QF TF    +  NPGLCG+PL      +
Sbjct: 693 DGRIPQAMSALTMLTEIDLSNNNLSGPIPEMGQFETFPPAKFLNNPGLCGYPLPRCDPSN 752

Query: 807 EAPDPSSPTSFHE 819
                    S H 
Sbjct: 753 ADGYAHHQRSHHH 765
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

No hit with probability above 80.00

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 882
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-21
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 8e-20
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-18
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 8e-18
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-17
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 8e-17
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-14
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-13
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-08
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 4e-19
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-16
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-14
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-12
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-11
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 9e-10
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 8e-17
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 9e-17
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 5e-16
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 6e-15
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-13
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 8e-12
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-11
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-07
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-06
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-14
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-12
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-12
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-11
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-11
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-10
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 4e-09
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 4e-09
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 9e-09
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 3e-07
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 4e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 8e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-08
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-08
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 8e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-08
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-07
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 8e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 4e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-08
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 8e-08
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 9e-08
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-07
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 6e-06
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 6e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 4e-07
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 3e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 8e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.002
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.003
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.003
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 4e-07
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 1e-06
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 1e-06
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 8e-06
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 2e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 6e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 7e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.003
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 2e-06
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 4e-06
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 3e-05
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.004
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 2e-06
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 7e-06
d2ca6a1 344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 1e-05
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 9e-05
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 4e-06
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 5e-06
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 2e-05
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 6e-05
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 7e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.001
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.004
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 5e-05
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 2e-04
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 4e-04
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 8e-04
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 0.004
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 6e-05
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 1e-04
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 0.003
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 2e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.001
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.001
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.001
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.004
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 2e-04
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 6e-04
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 0.003
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 5e-04
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 0.001
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

 Score = 94.7 bits (234), Expect = 3e-21
 Identities = 75/414 (18%), Positives = 129/414 (31%), Gaps = 73/414 (17%)

Query: 355 IHTLSYLDLSQNFLRSIKRLPWKNLKNLYLDSNLLRGRLLDLPPLMTIFSISNNYLTGEI 414
           +  ++ L   +  ++SI  +  + L NL                  T  + SNN LT   
Sbjct: 43  LDQVTTLQADRLGIKSIDGV--EYLNNL------------------TQINFSNNQLTDIT 82

Query: 415 PSSFCNLSSIQYLEMSNNSFSGQIPQCLVNSTVKFLDLRMNNFQGIIPQTYAKDCNLTFL 474
           P    NL+ +  + M+NN  +   P   + +                 +       L   
Sbjct: 83  P--LKNLTKLVDILMNNNQIADITPLANLTNLTGLTLFNNQITDIDPLKNLTNLNRLELS 140

Query: 475 KLNGNKLEGPLPPSLINCFSLHVIDVGNNNLSGEIPQCFGNSALKVFDMRMNRFNGSIPQ 534
               + +      + +   S          L+                + ++    S   
Sbjct: 141 SNTISDISALSGLTSLQQLSFGNQVTDLKPLANLTTLER---------LDISSNKVSDIS 191

Query: 535 MFAKSCDLRSLNLNGNQLEGPLSPSLINCRYLEVLDIGNNHINDTFPYWLEILPELRVLI 594
           + AK  +L SL    NQ+       L     L+ L +  N + D     L  L  L  L 
Sbjct: 192 VLAKLTNLESLIATNNQISDI--TPLGILTNLDELSLNGNQLKD--IGTLASLTNLTDLD 247

Query: 595 LRSNRFWGPIGNTKTRAPFSKLRILDLSHNQLTGVLPTRYLNNFRAMIHGENNSVTVEVK 654
           L +N+       +      +KL  L L  NQ++ + P   L     +   EN    +   
Sbjct: 248 LANNQISNLAPLSG----LTKLTELKLGANQISNISPLAGLTALTNLELNENQLEDISPI 303

Query: 655 YLSLLNSSYYACYESIILTMKGIDLQLERVLTIFTTIDLSSNRFQGGIPAIVGKLNSLKG 714
                                         L   T + L  N      P  V  L  L+ 
Sbjct: 304 S----------------------------NLKNLTYLTLYFNNISDISP--VSSLTKLQR 333

Query: 715 LNISHNNLTGGIPSSLANLTELESLDLSSNKLVGQIPMQMASLKSLSVLNLSHN 768
           L  ++N ++    SSLANLT +  L    N++    P  +A+L  ++ L L+  
Sbjct: 334 LFFANNKVSD--VSSLANLTNINWLSAGHNQISDLTP--LANLTRITQLGLNDQ 383
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query882
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 100.0
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 100.0
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 100.0
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 100.0
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 100.0
d1p9ag_266 von Willebrand factor binding domain of glycoprote 100.0
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.98
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.97
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.97
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.97
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.97
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.94
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.93
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.93
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.93
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.91
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.91
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.9
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.9
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.9
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.89
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.88
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.88
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.87
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.76
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.72
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.72
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.67
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.63
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.63
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 99.03
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.98
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.52
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 98.11
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

Probab=100.00  E-value=0  Score=291.01  Aligned_cols=227  Identities=34%  Similarity=0.566  Sum_probs=132.2

Q ss_pred             CCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCEEECCCC--CCEEEEECCCCCCCCCCC
Q ss_conf             897999999999544157778998757885566898899988999999-98960416999--939999879997852247
Q 002771           27 LCSQEQSSALLQFKQLFSFAKTSSSQCDGYQQSYPKMKYWKEDADCCS-SWDGVTCDMVT--GQVIGLDLSCSWLHGSIS  103 (882)
Q Consensus        27 ~~~~~~~~~ll~~k~~~~~~~~~~~~~~~~~~~~~~l~~w~~~~~~c~-~w~gv~c~~~~--~~v~~l~l~~~~l~g~~~  103 (882)
                      .|+++|++||++||+++.++.              .+++|..++|||. .|+||+|+...  +||+.|+|+++++.|...
T Consensus         2 ~c~~~e~~aLl~~k~~~~~~~--------------~l~sW~~~~d~C~~~w~gv~C~~~~~~~~v~~L~L~~~~l~g~~~   67 (313)
T d1ogqa_           2 LCNPQDKQALLQIKKDLGNPT--------------TLSSWLPTTDCCNRTWLGVLCDTDTQTYRVNNLDLSGLNLPKPYP   67 (313)
T ss_dssp             CSCHHHHHHHHHHHHHTTCCG--------------GGTTCCTTSCTTTTCSTTEEECCSSSCCCEEEEEEECCCCSSCEE
T ss_pred             CCCHHHHHHHHHHHHHCCCCC--------------CCCCCCCCCCCCCCCCCCEEEECCCCCEEEEEEECCCCCCCCCCC
T ss_conf             989899999999999779998--------------677889999998894889697489994798899898998888887


Q ss_pred             CCCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCCEEECCC-CCCCCCCCCCCCCCCCCCEEECCCCCCCCCCCCCCC
Q ss_conf             9876558999998878999999998761266999999985888-989877971365999898997758989877530036
Q 002771          104 SNSSLFFLPRLQKLNLGSNDFNYSKISSGFSQLRSLTLLNLSS-SNFTGSIPPSLGNLTQLVYLDLSNNSFIGEIPNMFT  182 (882)
Q Consensus       104 ~~~~l~~l~~L~~L~L~~n~l~~~~~~~~l~~l~~L~~L~Ls~-n~l~~~~p~~l~~l~~L~~L~Ls~n~~~~~~p~~~~  182 (882)
                                               +|..++++++|++|++++ |.+++.+|.+|+++++|++|++++|.+.+..+..+.
T Consensus        68 -------------------------lp~~l~~L~~L~~L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~  122 (313)
T d1ogqa_          68 -------------------------IPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLS  122 (313)
T ss_dssp             -------------------------CCGGGGGCTTCSEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGG
T ss_pred             -------------------------CCHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHCCCCCCCCCCCCCC
T ss_conf             -------------------------9847846753352020265433300243114542001102035643443322222


Q ss_pred             CCCCCCEEECCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCC-CEEECCCCCCCCCCCHHHHCCCCCCE
Q ss_conf             99999999813876888795000189988488664786644488334599997-68982388898878511104776794
Q 002771          183 NQSKLSYLNFGGNQLTGQIPSSVGELANLATVYLYFNSLKGTIPSRIFSLTSL-KQVDFRHNQLSGSVPSSVYELVNLTR  261 (882)
Q Consensus       183 ~l~~L~~L~Ls~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~l~~l~~L-~~L~L~~n~l~~~~~~~~~~l~~L~~  261 (882)
                      .+.+|+.++++.|.+.+.+|..+.+++.++.+++++|.+.+.+|..+..+..+ +.++++.|.+++..+..+..+..+ .
T Consensus       123 ~~~~L~~l~l~~N~~~~~~p~~l~~l~~L~~l~l~~n~l~~~ip~~~~~l~~l~~~l~~~~n~l~~~~~~~~~~l~~~-~  201 (313)
T d1ogqa_         123 QIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLNLA-F  201 (313)
T ss_dssp             GCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECCSSCCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGGCCCS-E
T ss_pred             CHHHHCCCCCCCCCCCCCCCHHHCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-C
T ss_conf             011100111122455556851220674000000235533562031214431123231022464353324332222222-3


Q ss_pred             EECCCCCCCCCCCCHHHCCCCCCCCEECCCCCC
Q ss_conf             865787363301601000787899054226656
Q 002771          262 LDLSSNKLSGTVELYDFAKLKNLKWLVLSNNSL  294 (882)
Q Consensus       262 L~L~~n~l~~~i~~~~~~~l~~L~~L~L~~n~~  294 (882)
                      +++..+...+.++. .+..+++++.+++.++.+
T Consensus       202 l~l~~~~~~~~~~~-~~~~~~~l~~l~~~~~~l  233 (313)
T d1ogqa_         202 VDLSRNMLEGDASV-LFGSDKNTQKIHLAKNSL  233 (313)
T ss_dssp             EECCSSEEEECCGG-GCCTTSCCSEEECCSSEE
T ss_pred             CCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCC
T ss_conf             33333433222222-222222211122222222
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure