Citrus Sinensis ID: 002801

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------88
MNPRLLRGERFGVRGDDSNDFELRKHSDGVELTHGDHLRNQGGLSGVCENEAAIDPFVHAIEWGDVSLRQWLDKPKRSVDVYECLHIFRQIVEIVYAAHSQGIVVHNVRPSCFVMSSFNHVSFIESASCSDSGSDSHEEGLNTQNMETKDLSSPLPLDMLQRRTRLRREDLQLVTAPTNDLSEASCMQSSSAYGTHVVLVEGMQEHKILDNRVNVEQVEEKKQPFPMKQILLMETNWYASPEELAGAPVSCASDIYRLGVLLFELFCPFSTGEEKTRTMSSLRHRVLPPQLLLKFPKEASFCLWLLHPEPSGRPKMGELLQSEFLNEPRDSMEEREAAIELREQIDEEELLLEFLLLVQQRKQESAKKLQDIVSFICSDIEEVSKQQAILRKKGGLGSFAELANDDLSGLNIPSLNIIDNDCSATMGSRKRFRPELQLHHLEECDDNLDDNQKHNLTGNEERSLFKSSRLMKNFKKLESAYFLTRCRPVKPSGRPLVRHSQLSSDGRTSKPLVNERSSINNLGSKEGYSEGRRSGWINPFLEGLCKYLSFSKLRVKADLNQGDLLNSSNLVCSLSFDRDGELFAAAGVNKKIKVFECDAIINENRDIHYPVVEMASRSKLSSICWNSYIKSQIASSNFEGVVQVWDVSRSQVLTEMREHERRVWSIDFSSADPTLLASGSDDGSVKLWSINQGVSIGTIKTKANVCCVQFPLDSGRSLAFGSADHRIYYYDLRNSKIPLCTLIGHNKTVSYVKFVDATTLVSASTDNTLKLWDLSMCTSRVIDTPLHSFTGHTNVKNFVGLSVWDGYVATGSETNEVFVYHKAFPMPALSFNFNHADPLSGPETDDAAQFISSVCWRGQSSNTLVAANSSGNIKILEMV
cccccccccEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccHHHHHHHHHHHHHHHHHHccccccccccccccEEEcccccEEEEEccccccccccccccccccccccccccccccccHHHHHHHHcccccccccccccccccccccccccccccccHHHHccccHHHHHcccccHHHHHcccccccHHHHHHHHHHccccHHHHcccccccccccHHHHHHHHHHccccccHHHHHHHHHHcccccccHHHHHHcccHHHHHHHHccccccccccHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEHHHHHHHHHcccccccEEEEEEEEccccccEEEcccccccccccccccccccccccccccccccccEEEEEEccccccEEEEEcccEEEEEEEccccEEEcccccEEEEEEcccccEEEEEcccccEEEEEccccccccccccccEEEEccccccEEEEEEcccccEEEEccccccEEEEEccccEEEEEcccccccEEEEEEccccccEEEEEEccccEEEEEcccccEEEEEcccccEEEEEEccccccEEEEEEccccEEEEEcccccccccccccccccEEEEEEcccccEEEEcccccEEEEEcccccccccccccEEcccccccEEEEEEcccccEEEEccccccEEEEEccccccEEEcccccccccccEEEcccccEEEEEEEccccccEEEEEEccccEEEEEcc
ccccccccccEEEEccccccccccccccccEccccccccccccccccccccccccccccccccccccHHHHHccccccccHHHHHHHHHHHHHHHHHHHcccEEEEcccccEEEEcccccEEEEEccccccccccccccccccccccccccccccccccccccEEcccccccccccccHHcccccccccccccccccEcccccccccccccccccHHHHHccccccHHHHHHHHHHHcccHHHHcccccccHHHHHHHHEEEEEHccccccHHHHHHHHHHHHHccccHHHHHcccHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEccHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccEEEEEEcccccEEEEEccccccEEEEEEcccccEEEEEcccccEEEEEEcccccEccccccEEEEEEcccccEEEEEccccEEEEEEEcccEEccccccEEEEEEccccEEEEEEEcccccEEEEEcccccEEEEEEcccccEEEEEEcccccEEEEEEccccccEEEEEccccEEEEEEcccccEEEEEEccccEEEEEEccccccEEEEEccccEEEEEEcccccEEEEEEccccccEEEEEEccccEEEEEccccEEEEEEcccccEEccccEEEEEccccccEEEEEEcccccEEEEEccccEEEEEEcccccEEEEEEccccccEEEEEEcccccEEEEEEEccccccEEEEEcccccEEEEEcc
mnprllrgerfgvrgddsndfelrkhsdgvelthgdhlrnqgglsgvceneaaidpfvhaieWGDVSlrqwldkpkrsvdVYECLHIFRQIVEIVYAAHSQGIvvhnvrpscfvmssfnhvsfiesascsdsgsdsheeglntqnmetkdlssplpldMLQRRTRLRRedlqlvtaptndlseascmqsssaygTHVVLVEGMqehkildnrvnveqveekkqpfpmkQILLMEtnwyaspeelagapvscasdiYRLGVLLFELfcpfstgeektrtmsslrhrvlppqlllkfpkeASFCLWllhpepsgrpkmgELLQSEFLNEPRDSMEEREAAIELREQIDEEELLLEFLLLVQQRKQESAKKLQDIVSFICSDIEEVSKQQAILRKkgglgsfaelanddlsglnipslniidndcsatmgsrkrfrpelqlHHLEecddnlddnqkhnltgneerslFKSSRLMKNFKKLESAYFltrcrpvkpsgrplvrhsqlssdgrtskplvnerssinnlgskegysegrrsgwinpFLEGLCKYLSFSKLRVkadlnqgdllnssnlvcslsfdrDGELFAAAGVNKKIKVFECDAiinenrdihypVVEMASRSKLSSICWNSYIKSQIASSNFEGVVQVWDVSRSQVLTEMREHErrvwsidfssadptllasgsddgsvkLWSINQGVSIGTIKTKANVccvqfpldsgrslafgsadhriyyydlrnskiplctlighnktvSYVKFVDattlvsastdntlkLWDLsmctsrvidtplhsftghtnvknfvgLSVWDGyvatgsetnevfvyhkafpmpalsfnfnhadplsgpetddAAQFISSVcwrgqssntLVAANSSGNIKILEMV
mnprllrgerfgvrgddsndfelRKHSdgvelthgdHLRNQGGLSGVCENEAAIDPFVHAIEWGDVSLRQWLDKPKRSVDVYECLHIFRQIVEIVYAAHSQGIVVHNVRPSCFVMSSFNHVSFIESASCSDSGSDSHEEGLNTqnmetkdlssplpLDMLQRRTRLRREDLQlvtaptndlseasCMQSSSAYGTHVVLVEGMQEHKILDNRVNVEQVEEKKQPFPMKQILLMETNWYASPEELAGAPVSCASDIYRLGVLLFELFCPFSTGEEKTRTMSSLRHRVLPPQLLLKFPKEASFCLWLLHPEPSGRPKMGELLQSEFLNEPRDSMEEREAAIELREQIDEEELLLEFLLLVQQRKQESAKKLQDIVSFICSDIEEVSKQQAILRKKGGLGSFAELANDDLSGLNIPSLNIIDNDCSATMGSRKRFRPELQLHHLEECDDNLDDNQKHNltgneerslfkssRLMKNFKKLESAYFltrcrpvkpsgrplvrhsqlssdgrtskplvnerssinnlgskegysegrrsGWINPFLEGLCKYLSFSKLRVKADlnqgdllnssNLVCSLSFDRDGELFAAAGVNKKIKVFECDAIINENRDIHYPVVEMASRSKLSSICWNSYIKSQIASSNFEGVVQVWDVSRSQVLTEMreherrvwsidfssaDPTLlasgsddgsvKLWSINQGVSIGTIKTKANVCCVQFPLDSGRSLAFGSADHRIYYYDLRNSKIPLCTLIGHNKTVSYVKFVDATTLVSASTDNTLKLWDLSMCTSRVIDTPLHSFTGHTNVKNFVGLSVWDGYVATGSETNEVFVYHKAFPMPALSFNFNHADPLSGPETDDAAQFISSVCWRGQSsntlvaanssgnikilemv
MNPRLLRGERFGVRGDDSNDFELRKHSDGVELTHGDHLRNQGGLSGVCENEAAIDPFVHAIEWGDVSLRQWLDKPKRSVDVYECLHIFRQIVEIVYAAHSQGIVVHNVRPSCFVMSSFNHVSFIEsascsdsgsdsHEEGLNTQNMETKDLSSPLPLDMLQRRTRLRREDLQLVTAPTNDLSEASCMQSSSAYGTHVVLVEGMQEHKILDNRVNVEQVEEKKQPFPMKQILLMETNWYASPEELAGAPVSCASDIYRLGVLLFELFCPFSTGEEKTRTMSSLRHRVLPPQLLLKFPKEASFCLWLLHPEPSGRPKMGELLQSEFLNEPRDSMEEREAAIelreqideeellleflllVQQRKQESAKKLQDIVSFICSDIEEVSKQQAILRKKGGLGSFAELANDDLSGLNIPSLNIIDNDCSATMGSRKRFRPELQLHHLEECDDNLDDNQKHNLTGNEERSLFKSSRLMKNFKKLESAYFLTRCRPVKPSGRPLVRHSQLSSDGRTSKPLVNERSSINNLGSKEGYSEGRRSGWINPFLEGLCKYLSFSKLRVKADLNQGDllnssnlvcslsFDRDGELFAAAGVNKKIKVFECDAIINENRDIHYPVVEMASRSKLSSICWNSYIKSQIASSNFEGVVQVWDVSRSQVLTEMREHERRVWSIDFSSADPTLLASGSDDGSVKLWSINQGVSIGTIKTKANVCCVQFPLDSGRSLAFGSADHRIYYYDLRNSKIPLCTLIGHNKTVSYVKFVDATTLVSASTDNTLKLWDLSMCTSRVIDTPLHSFTGHTNVKNFVGLSVWDGYVATGSETNEVFVYHKAFPMPALSFNFNHADPLSGPETDDAAQFISSVCWRGQSSNTLVAANSSGNIKILEMV
***************************************NQGGLSGVCENEAAIDPFVHAIEWGDVSLRQWLDKPKRSVDVYECLHIFRQIVEIVYAAHSQGIVVHNVRPSCFVMSSFNHVSFIE******************************************************************AYGTHVVLVEGMQEHKILDNRVNVE********FPMKQILLMETNWYASPEELAGAPVSCASDIYRLGVLLFELFCPFSTG*********LRHRVLPPQLLLKFPKEASFCLWLLH**************************************DEEELLLEFLLLVQQRK***AKKLQDIVSFICSDIEEVSKQQAILRKKGGLGSFAELANDDLSGLNIPSLNIIDNDCSA*************************************************FKKLESAYFLTRCR**********************************************SGWINPFLEGLCKYLSFSKLRVKADLNQGDLLNSSNLVCSLSFDRDGELFAAAGVNKKIKVFECDAIINENRDIHYPVVEMASRSKLSSICWNSYIKSQIASSNFEGVVQVWDVSRSQVLTEMREHERRVWSIDFSSADPTLLAS**DDGSVKLWSINQGVSIGTIKTKANVCCVQFPLDSGRSLAFGSADHRIYYYDLRNSKIPLCTLIGHNKTVSYVKFVDATTLVSASTDNTLKLWDLSMCTSRVIDTPLHSFTGHTNVKNFVGLSVWDGYVATGSETNEVFVYHKAFPMPALSFNFNHA**********AAQFISSVCWRGQ********************
*****************************************************************VSLRQWLDKPKRSVDVYECLHIFRQIVEIVYAAHSQGIVVHNVRPSCFVMSSFNHVSF************************************************************************************************************LMETNWYASPEELAGAPVSCASDIYRLGVLLFELFCPFSTGEEKTRTMSSLRHRVLPPQLLLKFPKEASFCLWLLHPE**********LQSEFLNEPRD****************EEELLLEFLLLVQQRKQESAKKLQDIVSFICSDIEEVSKQQAILRKK*****************************SATMGSRKRFRPE*************************ERSLFKSSRLMKNFKKLESAYFLTRCRPVKPSGR******Q*SSDGRTSKPLVNERSSINNLGSKEGYSEGRRSGWINPFLEGLCKYLSFSKLRVKADLNQGDLLNSSNLVCSLSFDRDGELFAAAGVNKKIKVFECDAIINENRDIHYPVVEMASRSKLSSICWNSYIKSQIASSNFEGVVQVWDVSRSQVLTEMREHERRVWSIDFSSADPTLLASGSDDGSVKLWSINQGVSIGTIKTKANVCCVQFPLDSGRSLAFGSADHRIYYYDLRNSKIPLCTLIGHNKTVSYVKFVDATTLVSASTDNTLKLWDLSMCTSRVIDTPLHSFTGHTNVKNFVGLSVWDGYVATGSETNEVFVYHKAFPMPALSFNFNHADPLSGPETDDAAQFISSVCWRGQSSNTLVAANSSGNIKILEMV
MNPRLLRGERFGVRGDDSNDFELRKHSDGVELTHGDHLRNQGGLSGVCENEAAIDPFVHAIEWGDVSLRQWLDKPKRSVDVYECLHIFRQIVEIVYAAHSQGIVVHNVRPSCFVMSSFNHVSFIES***************NTQNMETKDLSSPLPLDMLQRRTRLRREDLQLVTAPTNDLSEASCMQSSSAYGTHVVLVEGMQEHKILDNRVNVEQVEEKKQPFPMKQILLMETNWYASPEELAGAPVSCASDIYRLGVLLFELFCPFST**********LRHRVLPPQLLLKFPKEASFCLWLLHPEPSGRPKMGELLQSEFLNEPRDSMEEREAAIELREQIDEEELLLEFLLLVQQRKQESAKKLQDIVSFICSDIEEVSKQQAILRKKGGLGSFAELANDDLSGLNIPSLNIIDNDCSATMGSRKRFRPELQLHHLEECDDNLDDNQKHNLTGNEERSLFKSSRLMKNFKKLESAYFLTRCRPVKPS******************PLVNERSSINNLGSKEGYSEGRRSGWINPFLEGLCKYLSFSKLRVKADLNQGDLLNSSNLVCSLSFDRDGELFAAAGVNKKIKVFECDAIINENRDIHYPVVEMASRSKLSSICWNSYIKSQIASSNFEGVVQVWDVSRSQVLTEMREHERRVWSIDFSSADPTLLASGSDDGSVKLWSINQGVSIGTIKTKANVCCVQFPLDSGRSLAFGSADHRIYYYDLRNSKIPLCTLIGHNKTVSYVKFVDATTLVSASTDNTLKLWDLSMCTSRVIDTPLHSFTGHTNVKNFVGLSVWDGYVATGSETNEVFVYHKAFPMPALSFNFNHADPLSGPETDDAAQFISSVCWRGQSSNTLVAANSSGNIKILEMV
*******************************************************P*VHAI*WGDVSLRQWLDKPKRSVDVYECLHIFRQIVEIVYAAHSQGIVVHNVRPSCFVMSSFNHVSFIESA***********************************************************************************************QPFPMKQILLMETNWYASPEELAGAPVSCASDIYRLGVLLFELFCPFSTGEEKTRTMSSLRHRVLPPQLLLKFPKEASFCLWLLHPEPSGRPKMGELLQSEFLNEPRDSMEEREAAIELREQIDEEELLLEFLLLVQQRKQESAKKLQDIVSFICSDIEEVSKQQAILRKK*******************************************************************ERSLFKSSRLMKNFKKLESAYFLTRCR****************SDGRTSKPLVNERSSINNLGSKEGYSEGRRSGWINPFLEGLCKYLSFSKLRVKADLNQGDLLNSSNLVCSLSFDRDGELFAAAGVNKKIKVFECDAIINENRDIHYPVVEMASRSKLSSICWNSYIKSQIASSNFEGVVQVWDVSRSQVLTEMREHERRVWSIDFSSADPTLLASGSDDGSVKLWSINQGVSIGTIKTKANVCCVQFPLDSGRSLAFGSADHRIYYYDLRNSKIPLCTLIGHNKTVSYVKFVDATTLVSASTDNTLKLWDLSMCTSRVIDTPLHSFTGHTNVKNFVGLSVWDGYVATGSETNEVFVYHKAFPMPALSFNFNHADPLSGPETDDAAQFISSVCWRGQSSNTLVAANSSGNIKILEMV
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNPRLLRGERFGVRGDDSNDFELRKHSDGVELTHGDHLRNQGGLSGVCENEAAIDPFVHAIEWGDVSLRQWLDKPKRSVDVYECLHIFRQIVEIVYAAHSQGIVVHNVRPSCFVMSSFNHVSFIESASCSDSGSDSHEEGLNTQNMETKDLSSPLPLDMLQRRTRLRREDLQLVTAPTNDLSEASCMQSSSAYGTHVVLVEGMQEHKILDNRVNVEQVEEKKQPFPMKQILLMETNWYASPEELAGAPVSCASDIYRLGVLLFELFCPFSTGEEKTRTMSSLRHRVLPPQLLLKFPKEASFCLWLLHPEPSGRPKMGELLQSEFLNEPRDSMEEREAAIELREQIDEEELLLEFLLLVQQRKQESAKKLQDIVSFICSDIEEVSKQQAILRKKGGLGSFAELANDDLSGLNIPSLNIIDNDCSATMGSRKRFRPELQLHHLEECDDNLDDNQKHNLTGNEERSLFKSSRLMKNFKKLESAYFLTRCRPVKPSGRPLVRHSQLSSDGRTSKPLVNERSSINNLGSKEGYSEGRRSGWINPFLEGLCKYLSFSKLRVKADLNQGDLLNSSNLVCSLSFDRDGELFAAAGVNKKIKVFECDAIINENRDIHYPVVEMASRSKLSSICWNSYIKSQIASSNFEGVVQVWDVSRSQVLTEMREHERRVWSIDFSSADPTLLASGSDDGSVKLWSINQGVSIGTIKTKANVCCVQFPLDSGRSLAFGSADHRIYYYDLRNSKIPLCTLIGHNKTVSYVKFVDATTLVSASTDNTLKLWDLSMCTSRVIDTPLHSFTGHTNVKNFVGLSVWDGYVATGSETNEVFVYHKAFPMPALSFNFNHADPLSGPETDDAAQFISSVCWRGQSSNTLVAANSSGNIKILEMV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query879 2.2.26 [Sep-21-2011]
Q9LJR3845 Protein SPA1-RELATED 3 OS yes no 0.885 0.920 0.662 0.0
Q94BM7794 Protein SPA1-RELATED 4 OS no no 0.862 0.954 0.623 0.0
Q9SYX21029 Protein SUPPRESSOR OF PHY no no 0.838 0.716 0.412 1e-162
Q9T0141036 Protein SPA1-RELATED 2 OS no no 0.453 0.385 0.512 1e-117
P93471672 E3 ubiquitin-protein liga N/A no 0.569 0.745 0.390 1e-100
P43254675 E3 ubiquitin-protein liga no no 0.579 0.754 0.380 7e-97
Q8NHY2731 E3 ubiquitin-protein liga yes no 0.550 0.662 0.367 2e-87
Q9R1A8733 E3 ubiquitin-protein liga yes no 0.550 0.660 0.366 5e-87
Q9LTJ6385 WD repeat-containing prot no no 0.341 0.779 0.371 1e-47
Q9FFA7368 WD repeat-containing prot no no 0.337 0.807 0.359 1e-43
>sp|Q9LJR3|SPA3_ARATH Protein SPA1-RELATED 3 OS=Arabidopsis thaliana GN=SPA3 PE=1 SV=1 Back     alignment and function desciption
 Score = 1105 bits (2858), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 556/839 (66%), Positives = 671/839 (79%), Gaps = 61/839 (7%)

Query: 49  ENEAAIDPFVHAIEWGDVSLRQWLDKPKRSVDVYECLHIFRQIVEIVYAAHSQGIVVHNV 108
           ++   IDPFV ++EWGDVSLRQWLDKP+RSVDV+ECLH+FRQIVEIV AAHSQGIVVHNV
Sbjct: 59  DDSLGIDPFVRSLEWGDVSLRQWLDKPERSVDVFECLHVFRQIVEIVNAAHSQGIVVHNV 118

Query: 109 RPSCFVMSSFNHVSFIESASCSDSGSDSHEEGLNTQNMETKDLSSPLPLDMLQRRTRLRR 168
           RPSCFVMSSFNHVSFIESASCSDSGSDS E+G  +Q    K++ S             RR
Sbjct: 119 RPSCFVMSSFNHVSFIESASCSDSGSDSLEDGPISQ----KEIGSS------------RR 162

Query: 169 EDLQLVTAPTNDLSEASCMQSSSAYGTHVVLVEGMQEHKILDNRVNVEQVEEKKQPFPMK 228
           E+          +S+A  ++    Y            +K+L+ ++   + EEK QPFPMK
Sbjct: 163 EEA---------VSKAIAIEEKGVY------------NKLLERKIEKLE-EEKTQPFPMK 200

Query: 229 QILLMETNWYASPEELAGAPVSCASDIYRLGVLLFELFCPFSTGEEKTRTMSSLRHRVLP 288
            IL MET+WY SPEE  G+  +CASD+YRLGVLLFELFCP  + EEK+RTMSSLRHRVLP
Sbjct: 201 HILAMETSWYTSPEEDFGSSSTCASDVYRLGVLLFELFCPVPSREEKSRTMSSLRHRVLP 260

Query: 289 PQLLLKFPKEASFCLWLLHPEPSGRPKMGELLQSEFLNEPRDSMEEREAAIELREQIDEE 348
           PQ+LLK PKEASFCLWLLHPEP+ RP M +LLQSEF+ EPRD++EEREAAIELR++I+E+
Sbjct: 261 PQILLKCPKEASFCLWLLHPEPTCRPSMSDLLQSEFITEPRDNLEEREAAIELRDRIEEQ 320

Query: 349 ELLLEFLLLVQQRKQESAKKLQDIVSFICSDIEEVSKQQAILRKKGGLGSFAELANDD-- 406
           E LLEFLLL+QQRKQESA +LQD VS + SDIE+V K+Q IL+K+G   S ++ + DD  
Sbjct: 321 ESLLEFLLLIQQRKQESAYRLQDTVSLLSSDIEQVVKRQLILKKRGS--SLSDFSKDDHQ 378

Query: 407 -LSGLNIPSLNIIDNDCSATMGSRKRFRPE-LQLHHLEECDDNLDDNQKHNLTGNEERSL 464
             SG  + S    + + SA + SRKR R   L L +  E D+            ++  +L
Sbjct: 379 YTSGQPLMSFQA-NEEPSAFLASRKRVRQGILALENGVEVDEE-----------SQGSTL 426

Query: 465 FKSSRLMKNFKKLESAYFLTRCRPVKP--SGRPLVRHSQLSSDGRTSKPLVNERSSINNL 522
            +SSRLM+NFKKLES YFLTR R +K   SG+ L RHS LSS+      +V+E+SS++N 
Sbjct: 427 LESSRLMRNFKKLESVYFLTRRRQMKAAASGKSLTRHSPLSSENGRGSMIVSEKSSVSNP 486

Query: 523 GSKEGY--SEGRRSGWINPFLEGLCKYLSFSKLRVKADLNQGDLLNSSNLVCSLSFDRDG 580
            + + +  ++ R+ GWI+PFLEGLC+YLSFS+LRVKADL QGDLLNSSNLVC+L+FDR+G
Sbjct: 487 VAPKAFFNNDSRQGGWIDPFLEGLCRYLSFSQLRVKADLKQGDLLNSSNLVCALAFDREG 546

Query: 581 ELFAAAGVNKKIKVFECDAIINENRDIHYPVVEMASRSKLSSICWNSYIKSQIASSNFEG 640
           ELFA AGVNKKIK+FEC++I+N+NRDIHYPVVE+A RSKLSS+CWNSYIKSQIASSNF+G
Sbjct: 547 ELFATAGVNKKIKIFECNSIVNDNRDIHYPVVELAGRSKLSSLCWNSYIKSQIASSNFDG 606

Query: 641 VVQVWDVSRSQVLTEMREHERRVWSIDFSSADPTLLASGSDDGSVKLWSINQGVSIGTIK 700
           VVQ+WDV+RSQ++TEM+EH++RVWSID SSADPTLLASGSDDG+VKLWSINQGVSIGTIK
Sbjct: 607 VVQIWDVARSQLVTEMKEHKKRVWSIDISSADPTLLASGSDDGTVKLWSINQGVSIGTIK 666

Query: 701 TKANVCCVQFPLDSGRSLAFGSADHRIYYYDLRNSKIPLCTLIGHNKTVSYVKFVDATTL 760
           TKANVCCVQFP DSGRSLAFGSADH++YYYDLRN KIPLCT+IGH+KTVSYVKFVD++TL
Sbjct: 667 TKANVCCVQFPSDSGRSLAFGSADHKVYYYDLRNPKIPLCTMIGHSKTVSYVKFVDSSTL 726

Query: 761 VSASTDNTLKLWDLSMCTSRVIDTPLHSFTGHTNVKNFVGLSVWDGYVATGSETNEVFVY 820
           VS+STDNTLKLWDLSM  S + ++PLHSFTGHTN+KNFVGLSV DGY+ATGSETNEVFVY
Sbjct: 727 VSSSTDNTLKLWDLSMSASGINESPLHSFTGHTNLKNFVGLSVSDGYIATGSETNEVFVY 786

Query: 821 HKAFPMPALSFNFNHADPLSGPETDDAAQFISSVCWRGQSSNTLVAANSSGNIKILEMV 879
           HKAFPMP +S+ FN+ D +SG E DDA+QFISS+CWRGQSS TLVAANS+GNIKILEM+
Sbjct: 787 HKAFPMPVMSYMFNNTDSMSGLEVDDASQFISSICWRGQSS-TLVAANSNGNIKILEMM 844
Repressor of photomorphogenesis in the light. Probably part of the COP1/SPA E3 ubiquitin-protein ligase complex.
Arabidopsis thaliana (taxid: 3702)
>sp|Q94BM7|SPA4_ARATH Protein SPA1-RELATED 4 OS=Arabidopsis thaliana GN=SPA4 PE=1 SV=1 Back     alignment and function description
>sp|Q9SYX2|SPA1_ARATH Protein SUPPRESSOR OF PHYA-105 1 OS=Arabidopsis thaliana GN=SPA1 PE=1 SV=1 Back     alignment and function description
>sp|Q9T014|SPA2_ARATH Protein SPA1-RELATED 2 OS=Arabidopsis thaliana GN=SPA2 PE=1 SV=2 Back     alignment and function description
>sp|P93471|COP1_PEA E3 ubiquitin-protein ligase COP1 OS=Pisum sativum GN=COP1 PE=2 SV=1 Back     alignment and function description
>sp|P43254|COP1_ARATH E3 ubiquitin-protein ligase COP1 OS=Arabidopsis thaliana GN=COP1 PE=1 SV=2 Back     alignment and function description
>sp|Q8NHY2|RFWD2_HUMAN E3 ubiquitin-protein ligase RFWD2 OS=Homo sapiens GN=RFWD2 PE=1 SV=1 Back     alignment and function description
>sp|Q9R1A8|RFWD2_MOUSE E3 ubiquitin-protein ligase RFWD2 OS=Mus musculus GN=Rfwd2 PE=1 SV=2 Back     alignment and function description
>sp|Q9LTJ6|RUP1_ARATH WD repeat-containing protein RUP1 OS=Arabidopsis thaliana GN=RUP1 PE=1 SV=1 Back     alignment and function description
>sp|Q9FFA7|RUP2_ARATH WD repeat-containing protein RUP2 OS=Arabidopsis thaliana GN=RUP2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query879
255585740889 ubiquitin ligase protein cop1, putative 0.978 0.967 0.750 0.0
359493656903 PREDICTED: protein SPA1-RELATED 3-like [ 0.987 0.961 0.721 0.0
356542282892 PREDICTED: protein SPA1-RELATED 3-like [ 0.982 0.968 0.709 0.0
356546870892 PREDICTED: protein SPA1-RELATED 3-like [ 0.981 0.967 0.710 0.0
357452949875 SPA1-like protein [Medicago truncatula] 0.959 0.963 0.696 0.0
224128308857 predicted protein [Populus trichocarpa] 0.930 0.954 0.730 0.0
224114936851 predicted protein [Populus trichocarpa] 0.921 0.951 0.717 0.0
449446929850 PREDICTED: protein SPA1-RELATED 3-like [ 0.944 0.976 0.714 0.0
75335085845 RecName: Full=Protein SPA1-RELATED 3 gi| 0.885 0.920 0.662 0.0
356545455788 PREDICTED: protein SPA1-RELATED 3-like [ 0.894 0.997 0.665 0.0
>gi|255585740|ref|XP_002533551.1| ubiquitin ligase protein cop1, putative [Ricinus communis] gi|223526576|gb|EEF28831.1| ubiquitin ligase protein cop1, putative [Ricinus communis] Back     alignment and taxonomy information
 Score = 1318 bits (3412), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 650/866 (75%), Positives = 744/866 (85%), Gaps = 6/866 (0%)

Query: 15  GDDSNDFELRKHSDGVELTHGDHLRNQGGLSGVCENEAAIDPFVHAIEWGDVSLRQWLDK 74
           G  S D   RK +D V L H + L+NQ GLSG  ++E A+DPF  AIEWGDVSLRQWLDK
Sbjct: 29  GPLSRDSVFRKKTDRVVLAHHN-LKNQVGLSGGYKDEVAVDPFARAIEWGDVSLRQWLDK 87

Query: 75  PKRSVDVYECLHIFRQIVEIVYAAHSQGIVVHNVRPSCFVMSSFNHVSFIESASCSDSGS 134
           P+RSVD +ECLHIFRQIV IV  AHSQGIVVHNVRPSCFVM+SFNHVSFIESASCSDSGS
Sbjct: 88  PERSVDEFECLHIFRQIVGIVNLAHSQGIVVHNVRPSCFVMTSFNHVSFIESASCSDSGS 147

Query: 135 DSHEEGLNTQNMETKDLSSPLPLDMLQRRTRLRREDLQLVTAPTNDLSEASCMQSSSAYG 194
           DS E+GLN++ +E K+ SS LP D+ Q RTRLR ED Q  + P N LSEASC+QSSS + 
Sbjct: 148 DSLEDGLNSRTLEVKNPSSLLPNDIFQLRTRLRSEDFQPASTPINALSEASCIQSSSVHA 207

Query: 195 THVVLVEGMQEHKILDNRVNVEQVEEKKQPFPMKQILLMETNWYASPEELAGAPVSCASD 254
           THV + E  +E K  D  +  ++ EE+KQPFPMKQILLMET+WY SPEE  G+P SCASD
Sbjct: 208 THVPVGENTEEDKANDRTIIEQEEEERKQPFPMKQILLMETSWYTSPEEATGSPSSCASD 267

Query: 255 IYRLGVLLFELFCPFSTGEEKTRTMSSLRHRVLPPQLLLKFPKEASFCLWLLHPEPSGRP 314
           IYRLGVLLFELFCPFS+ E+K+RTMSSLRHRVLPPQLLLK+PKEASFCLWLLHPEPS RP
Sbjct: 268 IYRLGVLLFELFCPFSSREDKSRTMSSLRHRVLPPQLLLKWPKEASFCLWLLHPEPSSRP 327

Query: 315 KMGELLQSEFLNEPRDSMEEREAAIELREQIDEEELLLEFLLLVQQRKQESAKKLQDIVS 374
           KM ELLQSEFLNEPR+++EEREAAI+L E+I+E++LLL+FLLL+QQRKQE+A KLQD VS
Sbjct: 328 KMCELLQSEFLNEPRENLEEREAAIQLSERIEEQDLLLDFLLLIQQRKQEAADKLQDTVS 387

Query: 375 FICSDIEEVSKQQAILRKKGGLGSFAELANDDLSGLNIPSLNIIDNDCSATMGSRKRFRP 434
            +CSDIEEV K +  L+KKGG  S  E   DD    N+P  +I+DND S+++GSRKRFRP
Sbjct: 388 LLCSDIEEVLKHRTFLKKKGG--SCLERMKDDNLVSNLPPFSIVDNDDSSSLGSRKRFRP 445

Query: 435 ELQLHHLEECDDNLDDNQKHNL-TGNEERSLFKSSRLMKNFKKLESAYFLTRCRPVKPSG 493
            +Q+ ++EE DDN DD Q  ++ T +++  L KSSRLMKNFKKLESAYFLTRCRP++ SG
Sbjct: 446 GIQIFNMEEFDDNRDDAQHSDMVTESQDSLLLKSSRLMKNFKKLESAYFLTRCRPIRSSG 505

Query: 494 RPLVRHSQLSSDGRTSKPLVNERSSINNLGSKEGYSEGRRSGWINPFLEGLCKYLSFSKL 553
           +P +R+S +SSDGR S  +V+ERSSINNL  KE + E R+SGWI+PFLEGLCKYLSF+KL
Sbjct: 506 KPFIRYSPISSDGRGST-VVSERSSINNLAPKEQHVESRQSGWISPFLEGLCKYLSFNKL 564

Query: 554 RVKADLNQGDLLNSSNLVCSLSFDRDGELFAAAGVNKKIKVFECDAIINENRDIHYPVVE 613
           ++KADL QGDLLNSSNLVCSLSFDRDGE FA AGVNKKIK+FECDAIINENRDIHYPVVE
Sbjct: 565 KIKADLKQGDLLNSSNLVCSLSFDRDGEFFATAGVNKKIKIFECDAIINENRDIHYPVVE 624

Query: 614 MASRSKLSSICWNSYIKSQIASSNFEGVVQVWDVSRSQVLTEMREHERRVWSIDFSSADP 673
           +A+RSKLSS+CWNSYIKSQIASSNFEGVVQVWD++RSQVLTEMREHERRVWSIDFSSADP
Sbjct: 625 IATRSKLSSVCWNSYIKSQIASSNFEGVVQVWDITRSQVLTEMREHERRVWSIDFSSADP 684

Query: 674 TLLASGSDDGSVKLWSINQGVSIGTIKTKANVCCVQFPLDSGRSLAFGSADHRIYYYDLR 733
           T LASGSDD SVKLW+INQGVSIGTI+TKANVC VQFPLDS RSLAFGSADH++YYYDLR
Sbjct: 685 TTLASGSDDCSVKLWNINQGVSIGTIRTKANVCSVQFPLDSSRSLAFGSADHKVYYYDLR 744

Query: 734 NSKIPLCTLIGHNKTVSYVKFVDATTLVSASTDNTLKLWDLSMCTSRVIDTPLHSFTGHT 793
           N+K+PLCTL+GHNKTVSYV+F+D+T LVSASTDNTLKLWDLSMC SR+IDTPL SFTGH 
Sbjct: 745 NAKVPLCTLVGHNKTVSYVRFIDSTNLVSASTDNTLKLWDLSMCASRIIDTPLQSFTGHM 804

Query: 794 NVKNFVGLSVWDGYVATGSETNEVFVYHKAFPMPALSFNFNHADPLSGPETDDAAQFISS 853
           NVKNFVGLSV DGY+ATGSETNEVF+YHKAFPMPALSF FN+ DPLSG E DD AQFISS
Sbjct: 805 NVKNFVGLSVSDGYIATGSETNEVFIYHKAFPMPALSFKFNNTDPLSGHEMDDPAQFISS 864

Query: 854 VCWRGQSSNTLVAANSSGNIKILEMV 879
           VCWR QSS TLVAANS+GNIKILEMV
Sbjct: 865 VCWRSQSS-TLVAANSTGNIKILEMV 889

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359493656|ref|XP_002282441.2| PREDICTED: protein SPA1-RELATED 3-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|356542282|ref|XP_003539598.1| PREDICTED: protein SPA1-RELATED 3-like [Glycine max] Back     alignment and taxonomy information
>gi|356546870|ref|XP_003541845.1| PREDICTED: protein SPA1-RELATED 3-like [Glycine max] Back     alignment and taxonomy information
>gi|357452949|ref|XP_003596751.1| SPA1-like protein [Medicago truncatula] gi|355485799|gb|AES67002.1| SPA1-like protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|224128308|ref|XP_002329131.1| predicted protein [Populus trichocarpa] gi|222869800|gb|EEF06931.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224114936|ref|XP_002316897.1| predicted protein [Populus trichocarpa] gi|222859962|gb|EEE97509.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449446929|ref|XP_004141223.1| PREDICTED: protein SPA1-RELATED 3-like [Cucumis sativus] gi|449498653|ref|XP_004160596.1| PREDICTED: protein SPA1-RELATED 3-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|75335085|sp|Q9LJR3.1|SPA3_ARATH RecName: Full=Protein SPA1-RELATED 3 gi|9294263|dbj|BAB02165.1| photomorphogenesis repressor protein-like [Arabidopsis thaliana] gi|330688323|gb|AEC32932.1| SPA3 isoform 1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356545455|ref|XP_003541158.1| PREDICTED: protein SPA1-RELATED 3-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query879
TAIR|locus:2037005794 SPA4 "SPA1-related 4" [Arabido 0.514 0.569 0.693 8.5e-232
TAIR|locus:21361331036 SPA2 "SPA1-related 2" [Arabido 0.453 0.385 0.495 1e-143
TAIR|locus:20391391029 SPA1 "SUPPRESSOR OF PHYA-105 1 0.458 0.391 0.501 2.1e-143
DICTYBASE|DDB_G0288453970 DDB_G0288453 "E3 ubiquitin-pro 0.402 0.364 0.486 2.1e-90
TAIR|locus:2059359675 COP1 "CONSTITUTIVE PHOTOMORPHO 0.411 0.536 0.461 1.3e-86
UNIPROTKB|Q8NHY2731 RFWD2 "E3 ubiquitin-protein li 0.391 0.470 0.457 6.6e-83
ZFIN|ZDB-GENE-070410-134694 rfwd2 "ring finger and WD repe 0.391 0.495 0.463 8.3e-83
UNIPROTKB|F1MHX1735 RFWD2 "Uncharacterized protein 0.391 0.468 0.455 1.1e-82
MGI|MGI:1347046733 Rfwd2 "ring finger and WD repe 0.391 0.469 0.457 1.4e-82
UNIPROTKB|E2RRJ5733 RFWD2 "Uncharacterized protein 0.391 0.469 0.455 3.6e-82
TAIR|locus:2037005 SPA4 "SPA1-related 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1642 (583.1 bits), Expect = 8.5e-232, Sum P(2) = 8.5e-232
 Identities = 321/463 (69%), Positives = 378/463 (81%)

Query:   421 DCSATMGSRKRFRPELQLHHLEECDDNLDDNQKHNLTGNEERSLFKSSRLMKNFKKLESA 480
             D  + + SRKR R   +    EE +D+   +++  L    E +L +SSRLM+N KKLES 
Sbjct:   339 DVRSFLASRKRIRQGAETTAAEEENDDNSIDEESKLDDTLESTLLESSRLMRNLKKLESV 398

Query:   481 YFLTRCRPVKPSG---RPLVRH-SQLSSDGRTSKPLVNERSSINNLGSKEGYSEGRRSGW 536
             YF TR R +K +    +PL R+ S LS +GR+S     E+SS++   SK+  ++ R+ GW
Sbjct:   399 YFATRYRQIKAATAAEKPLARYYSALSCNGRSS-----EKSSMSQ-PSKDPINDSRQGGW 452

Query:   537 INPFLEGLCKYLSFSKLRVKADLNQGDXXXXXXXXXXXXFDRDGELFAAAGVNKKIKVFE 596
             I+PFLEGLCKYLSFSKLRVKADL QGD            FDRDGE FA AGVNKKIK+FE
Sbjct:   453 IDPFLEGLCKYLSFSKLRVKADLKQGDLLNSSNLVCAIGFDRDGEFFATAGVNKKIKIFE 512

Query:   597 CDAIINENRDIHYPVVEMASRSKLSSICWNSYIKSQIASSNFEGVVQVWDVSRSQVLTEM 656
             C++II + RDIHYPVVE+ASRSKLS ICWNSYIKSQ+ASSNFEGVVQVWDV+R+Q++TEM
Sbjct:   513 CESIIKDGRDIHYPVVELASRSKLSGICWNSYIKSQVASSNFEGVVQVWDVARNQLVTEM 572

Query:   657 REHERRVWSIDFSSADPTLLASGSDDGSVKLWSINQGVSIGTIKTKANVCCVQFPLDSGR 716
             +EHE+RVWSID+SSADPTLLASGSDDGSVKLWSINQGVSIGTIKTKAN+CCVQFP ++GR
Sbjct:   573 KEHEKRVWSIDYSSADPTLLASGSDDGSVKLWSINQGVSIGTIKTKANICCVQFPSETGR 632

Query:   717 SLAFGSADHRIYYYDLRNSKIPLCTLIGHNKTVSYVKFVDATTLVSASTDNTLKLWDLSM 776
             SLAFGSADH++YYYDLRN K+PLCT+IGH+KTVSYV+FVD++TLVS+STDNTLKLWDLSM
Sbjct:   633 SLAFGSADHKVYYYDLRNPKLPLCTMIGHHKTVSYVRFVDSSTLVSSSTDNTLKLWDLSM 692

Query:   777 CTSRVIDTPLHSFTGHTNVKNFVGLSVWDGYVATGSETNEVFVYHKAFPMPALSFNFNHA 836
               S + +TPLHSF GHTNVKNFVGLSV DGY+ATGSETNEVFVYHKAFPMP LS+ F   
Sbjct:   693 SISGINETPLHSFMGHTNVKNFVGLSVSDGYIATGSETNEVFVYHKAFPMPVLSYKFKTI 752

Query:   837 DPLSGPETDDAAQFISSVCWRGQSSNTLVAANSSGNIKILEMV 879
             DP+S  E DDA+QFISSVCWRGQSS TLVAANS+GNIKILEMV
Sbjct:   753 DPVSELEVDDASQFISSVCWRGQSS-TLVAANSTGNIKILEMV 794
GO:0004672 "protein kinase activity" evidence=IEA
GO:0004871 "signal transducer activity" evidence=ISS
GO:0005524 "ATP binding" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0005834 "heterotrimeric G-protein complex" evidence=ISS
GO:0006468 "protein phosphorylation" evidence=IEA
GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA
GO:0005515 "protein binding" evidence=IPI
GO:0080008 "Cul4-RING ubiquitin ligase complex" evidence=ISS
GO:0042802 "identical protein binding" evidence=IPI
GO:0006281 "DNA repair" evidence=RCA
GO:0010100 "negative regulation of photomorphogenesis" evidence=RCA
GO:0048608 "reproductive structure development" evidence=RCA
TAIR|locus:2136133 SPA2 "SPA1-related 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2039139 SPA1 "SUPPRESSOR OF PHYA-105 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0288453 DDB_G0288453 "E3 ubiquitin-protein ligase RFWD2" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
TAIR|locus:2059359 COP1 "CONSTITUTIVE PHOTOMORPHOGENIC 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q8NHY2 RFWD2 "E3 ubiquitin-protein ligase RFWD2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-070410-134 rfwd2 "ring finger and WD repeat domain 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1MHX1 RFWD2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:1347046 Rfwd2 "ring finger and WD repeat domain 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E2RRJ5 RFWD2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9LJR3SPA3_ARATHNo assigned EC number0.66260.88500.9207yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
estExt_Genewise1_v1.C_LG_XI3877
hypothetical protein (851 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query879
PLN00181793 PLN00181, PLN00181, protein SPA1-RELATED; Provisio 0.0
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 7e-35
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 2e-28
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 1e-22
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 1e-21
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 4e-19
COG2319 466 COG2319, COG2319, FOG: WD40 repeat [General functi 1e-11
smart00220254 smart00220, S_TKc, Serine/Threonine protein kinase 6e-11
cd08530256 cd08530, STKc_CNK2-like, Catalytic domain of the P 2e-09
pfam00069260 pfam00069, Pkinase, Protein kinase domain 3e-09
cd08215258 cd08215, STKc_Nek, Catalytic domain of the Protein 4e-07
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 1e-06
cd05114256 cd05114, PTKc_Tec_Rlk, Catalytic domain of the Pro 1e-06
cd06623264 cd06623, PKc_MAPKK_plant_like, Catalytic domain of 3e-06
smart0032040 smart00320, WD40, WD40 repeats 3e-06
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 4e-05
PRK13184932 PRK13184, pknD, serine/threonine-protein kinase; R 1e-04
smart0032040 smart00320, WD40, WD40 repeats 2e-04
cd05581280 cd05581, STKc_PDK1, Catalytic domain of the Protei 4e-04
cd05041251 cd05041, PTKc_Fes_like, Catalytic domain of Fes-li 0.002
PTZ00283496 PTZ00283, PTZ00283, serine/threonine protein kinas 0.002
COG0515384 COG0515, SPS1, Serine/threonine protein kinase [Ge 0.002
cd06605265 cd06605, PKc_MAPKK, Catalytic domain of the dual-s 0.003
>gnl|CDD|177776 PLN00181, PLN00181, protein SPA1-RELATED; Provisional Back     alignment and domain information 
 Score = 1097 bits (2837), Expect = 0.0
 Identities = 542/856 (63%), Positives = 635/856 (74%), Gaps = 99/856 (11%)

Query: 32  LTHGDHLRNQGGLSGVCENEA-AIDPFVHAIEWGDVSLRQWLDKPKRSVDVYECLHIFRQ 90
           L+H D++R+  G       +    D  V A+E  DVSLRQWLD P RSVD +EC H+FRQ
Sbjct: 29  LSHIDYVRSLLGSHKEGNLDGLDDDSIVRALECEDVSLRQWLDNPDRSVDAFECFHVFRQ 88

Query: 91  IVEIVYAAHSQGIVVHNVRPSCFVMSSFNHVSFIESASCSDSGSDSHEEGLNTQNMETKD 150
           IVEIV AAHSQGIVVHNVRPSCFVMSSFNHVSFIESASCSDSGSD  E+         ++
Sbjct: 89  IVEIVNAAHSQGIVVHNVRPSCFVMSSFNHVSFIESASCSDSGSD--EDATTKS----RE 142

Query: 151 LSSPLPLDMLQRRTRLRREDLQLVTAPTNDLSEASCMQSSSAYGTHVVLVEGMQEHKILD 210
           + S             RRE+                                     IL 
Sbjct: 143 IGSS------------RREE-------------------------------------ILS 153

Query: 211 NRVNVEQVEEKKQPFPMKQILLMETNWYASPEELAGAPVSCASDIYRLGVLLFELFCPFS 270
            R   +  E KKQPFPMKQIL ME +WY SPEE  G+  +CASD+YRLGVLLFELFCP S
Sbjct: 154 ERRIEKLEEVKKQPFPMKQILAMEMSWYTSPEEDNGSSSNCASDVYRLGVLLFELFCPVS 213

Query: 271 TGEEKTRTMSSLRHRVLPPQLLLKFPKEASFCLWLLHPEPSGRPKMGELLQSEFLNEPRD 330
           + EEK+RTMSSLRHRVLPPQ+LL +PKEASFCLWLLHPEPS RP M ELLQSEF+NEPR+
Sbjct: 214 SREEKSRTMSSLRHRVLPPQILLNWPKEASFCLWLLHPEPSCRPSMSELLQSEFINEPRE 273

Query: 331 SMEEREAAIELREQIDEEELLLEFLLLVQQRKQESAKKLQDIVSFICSDIEEVSKQQAIL 390
           ++EEREAA+ELR++I+E+ELLLEFL L+QQRKQE+A KLQD +S + SDI++V K+Q +L
Sbjct: 274 NLEEREAAMELRDRIEEQELLLEFLFLIQQRKQEAADKLQDTISLLSSDIDQVVKRQLVL 333

Query: 391 RKKGGLGSFAELANDDLSGLNIPSLNIIDNDCSATMGSRKRFRP-ELQLHHLEECDDNLD 449
           ++KG                         +D  + + SRKR R     L   EE DDN  
Sbjct: 334 QQKG-------------------------SDVRSFLASRKRIRQGAETLAAEEENDDN-- 366

Query: 450 DNQKHNLTGNEERSLFKSSRLMKNFKKLESAYFLTRCRPVKPSG---RPLVRHSQLSS-D 505
                 L    E +L +SSRLM+N KKLES YF TR R +K +    +PL R+    S +
Sbjct: 367 ---SSKLDDTLESTLLESSRLMRNLKKLESVYFATRYRQIKAAAAAEKPLARYYSALSEN 423

Query: 506 GRTSKPLVNERSSINNLGSKEGY--SEGRRSGWINPFLEGLCKYLSFSKLRVKADLNQGD 563
           GR+S     E+SS++N      +  ++ R+ GWI+PFLEGLCKYLSFSKLRVKADL QGD
Sbjct: 424 GRSS-----EKSSMSNPAKPPDFYINDSRQGGWIDPFLEGLCKYLSFSKLRVKADLKQGD 478

Query: 564 LLNSSNLVCSLSFDRDGELFAAAGVNKKIKVFECDAIINENRDIHYPVVEMASRSKLSSI 623
           LLNSSNLVC++ FDRDGE FA AGVNKKIK+FEC++II + RDIHYPVVE+ASRSKLS I
Sbjct: 479 LLNSSNLVCAIGFDRDGEFFATAGVNKKIKIFECESIIKDGRDIHYPVVELASRSKLSGI 538

Query: 624 CWNSYIKSQIASSNFEGVVQVWDVSRSQVLTEMREHERRVWSIDFSSADPTLLASGSDDG 683
           CWNSYIKSQ+ASSNFEGVVQVWDV+RSQ++TEM+EHE+RVWSID+SSADPTLLASGSDDG
Sbjct: 539 CWNSYIKSQVASSNFEGVVQVWDVARSQLVTEMKEHEKRVWSIDYSSADPTLLASGSDDG 598

Query: 684 SVKLWSINQGVSIGTIKTKANVCCVQFPLDSGRSLAFGSADHRIYYYDLRNSKIPLCTLI 743
           SVKLWSINQGVSIGTIKTKAN+CCVQFP +SGRSLAFGSADH++YYYDLRN K+PLCT+I
Sbjct: 599 SVKLWSINQGVSIGTIKTKANICCVQFPSESGRSLAFGSADHKVYYYDLRNPKLPLCTMI 658

Query: 744 GHNKTVSYVKFVDATTLVSASTDNTLKLWDLSMCTSRVIDTPLHSFTGHTNVKNFVGLSV 803
           GH+KTVSYV+FVD++TLVS+STDNTLKLWDLSM  S + +TPLHSF GHTNVKNFVGLSV
Sbjct: 659 GHSKTVSYVRFVDSSTLVSSSTDNTLKLWDLSMSISGINETPLHSFMGHTNVKNFVGLSV 718

Query: 804 WDGYVATGSETNEVFVYHKAFPMPALSFNFNHADPLSGPETDDAAQFISSVCWRGQSSNT 863
            DGY+ATGSETNEVFVYHKAFPMP LS+ F   DP+SG E DDA+QFISSVCWRGQSS T
Sbjct: 719 SDGYIATGSETNEVFVYHKAFPMPVLSYKFKTIDPVSGLEVDDASQFISSVCWRGQSS-T 777

Query: 864 LVAANSSGNIKILEMV 879
           LVAANS+GNIKILEMV
Sbjct: 778 LVAANSTGNIKILEMV 793

Length = 793
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>gnl|CDD|173772 cd08530, STKc_CNK2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain Back     alignment and domain information
>gnl|CDD|173755 cd08215, STKc_Nek, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|173658 cd05114, PTKc_Tec_Rlk, Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>gnl|CDD|132954 cd06623, PKc_MAPKK_plant_like, Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|183880 PRK13184, pknD, serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
>gnl|CDD|173672 cd05581, STKc_PDK1, Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>gnl|CDD|173629 cd05041, PTKc_Fes_like, Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|240344 PTZ00283, PTZ00283, serine/threonine protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|223589 COG0515, SPS1, Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|173723 cd06605, PKc_MAPKK, Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 879
PLN00181793 protein SPA1-RELATED; Provisional 100.0
KOG0271480 consensus Notchless-like WD40 repeat-containing pr 100.0
KOG0271480 consensus Notchless-like WD40 repeat-containing pr 100.0
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 100.0
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 100.0
KOG0615475 consensus Serine/threonine protein kinase Chk2 and 100.0
KOG0581364 consensus Mitogen-activated protein kinase kinase 100.0
KOG0279315 consensus G protein beta subunit-like protein [Sig 100.0
KOG0284464 consensus Polyadenylation factor I complex, subuni 100.0
KOG0591375 consensus NIMA (never in mitosis)-related G2-speci 100.0
KOG0265338 consensus U5 snRNP-specific protein-like factor an 100.0
KOG0286343 consensus G-protein beta subunit [General function 100.0
KOG0575592 consensus Polo-like serine/threonine protein kinas 100.0
KOG0661538 consensus MAPK related serine/threonine protein ki 100.0
KOG0286343 consensus G-protein beta subunit [General function 100.0
KOG0588786 consensus Serine/threonine protein kinase [Cell cy 100.0
KOG0592604 consensus 3-phosphoinositide-dependent protein kin 100.0
KOG0315311 consensus G-protein beta subunit-like protein (con 100.0
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 100.0
KOG0598357 consensus Ribosomal protein S6 kinase and related 100.0
KOG0315311 consensus G-protein beta subunit-like protein (con 100.0
KOG0660359 consensus Mitogen-activated protein kinase [Signal 100.0
KOG0295406 consensus WD40 repeat-containing protein [Function 100.0
KOG0583370 consensus Serine/threonine protein kinase [Signal 100.0
KOG0198313 consensus MEKK and related serine/threonine protei 100.0
KOG0285460 consensus Pleiotropic regulator 1 [RNA processing 100.0
KOG0645312 consensus WD40 repeat protein [General function pr 100.0
KOG0578550 consensus p21-activated serine/threonine protein k 100.0
KOG0263707 consensus Transcription initiation factor TFIID, s 100.0
KOG0593396 consensus Predicted protein kinase KKIAMRE [Genera 100.0
KOG0595429 consensus Serine/threonine-protein kinase involved 100.0
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 100.0
KOG0616355 consensus cAMP-dependent protein kinase catalytic 100.0
KOG0605550 consensus NDR and related serine/threonine kinases 100.0
KOG0318603 consensus WD40 repeat stress protein/actin interac 100.0
KOG0600560 consensus Cdc2-related protein kinase [Cell cycle 100.0
KOG0033355 consensus Ca2+/calmodulin-dependent protein kinase 100.0
KOG0192362 consensus Tyrosine kinase specific for activated ( 100.0
KOG0610459 consensus Putative serine/threonine protein kinase 100.0
KOG0291 893 consensus WD40-repeat-containing subunit of the 18 100.0
KOG0277311 consensus Peroxisomal targeting signal type 2 rece 100.0
KOG0663419 consensus Protein kinase PITSLRE and related kinas 100.0
KOG0659318 consensus Cdk activating kinase (CAK)/RNA polymera 100.0
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 100.0
KOG0276 794 consensus Vesicle coat complex COPI, beta' subunit 100.0
KOG0284464 consensus Polyadenylation factor I complex, subuni 100.0
KOG0295406 consensus WD40 repeat-containing protein [Function 100.0
KOG4721904 consensus Serine/threonine protein kinase, contain 100.0
KOG0585576 consensus Ca2+/calmodulin-dependent protein kinase 100.0
KOG0263707 consensus Transcription initiation factor TFIID, s 100.0
KOG0282503 consensus mRNA splicing factor [Function unknown] 100.0
KOG0604400 consensus MAP kinase-activated protein kinase 2 [S 100.0
KOG0266456 consensus WD40 repeat-containing protein [General 100.0
KOG0599411 consensus Phosphorylase kinase gamma subunit [Carb 100.0
KOG0594323 consensus Protein kinase PCTAIRE and related kinas 100.0
KOG0319 775 consensus WD40-repeat-containing subunit of the 18 100.0
KOG0279315 consensus G protein beta subunit-like protein [Sig 100.0
KOG0694694 consensus Serine/threonine protein kinase [Signal 100.0
KOG10351351 consensus eIF-2alpha kinase GCN2 [Translation, rib 100.0
KOG0611668 consensus Predicted serine/threonine protein kinas 100.0
KOG0293519 consensus WD40 repeat-containing protein [Function 100.0
KOG0316307 consensus Conserved WD40 repeat-containing protein 100.0
KOG0296399 consensus Angio-associated migratory cell protein 100.0
KOG0281499 consensus Beta-TrCP (transducin repeats containing 100.0
KOG0597808 consensus Serine-threonine protein kinase FUSED [G 99.98
KOG0318603 consensus WD40 repeat stress protein/actin interac 99.98
KOG0291 893 consensus WD40-repeat-containing subunit of the 18 99.98
KOG0579 1187 consensus Ste20-like serine/threonine protein kina 99.98
KOG0589426 consensus Serine/threonine protein kinase [General 99.98
KOG0032382 consensus Ca2+/calmodulin-dependent protein kinase 99.98
KOG0582516 consensus Ste20-like serine/threonine protein kina 99.97
KOG0313423 consensus Microtubule binding protein YTM1 (contai 99.97
KOG0201467 consensus Serine/threonine protein kinase [Signal 99.97
cd05571323 STKc_PKB Catalytic domain of the Protein Serine/Th 99.97
KOG0580281 consensus Serine/threonine protein kinase [Cell cy 99.97
KOG0277311 consensus Peroxisomal targeting signal type 2 rece 99.97
cd05612291 STKc_PRKX_like Catalytic domain of PRKX-like Prote 99.97
cd05585312 STKc_YPK1_like Catalytic domain of Yeast Protein K 99.97
KOG0275508 consensus Conserved WD40 repeat-containing protein 99.97
KOG0658364 consensus Glycogen synthase kinase-3 [Carbohydrate 99.97
PTZ00426340 cAMP-dependent protein kinase catalytic subunit; P 99.97
KOG4717864 consensus Serine/threonine protein kinase [Signal 99.97
PTZ00263329 protein kinase A catalytic subunit; Provisional 99.97
KOG1407313 consensus WD40 repeat protein [Function unknown] 99.97
KOG0772 641 consensus Uncharacterized conserved protein, conta 99.97
cd07862290 STKc_CDK6 Catalytic domain of the Serine/Threonine 99.97
KOG0266456 consensus WD40 repeat-containing protein [General 99.97
KOG0276 794 consensus Vesicle coat complex COPI, beta' subunit 99.97
cd05590320 STKc_nPKC_eta Catalytic domain of the Protein Seri 99.97
cd05595323 STKc_PKB_beta Catalytic domain of the Protein Seri 99.97
cd05593328 STKc_PKB_gamma Catalytic domain of the Protein Ser 99.97
KOG0281499 consensus Beta-TrCP (transducin repeats containing 99.97
cd07869303 STKc_PFTAIRE1 Catalytic domain of the Serine/Threo 99.97
cd07871288 STKc_PCTAIRE3 Catalytic domain of the Serine/Threo 99.97
KOG0319775 consensus WD40-repeat-containing subunit of the 18 99.97
cd05631285 STKc_GRK4 Catalytic domain of the Protein Serine/T 99.97
PTZ00283496 serine/threonine protein kinase; Provisional 99.97
KOG0197468 consensus Tyrosine kinases [Signal transduction me 99.97
KOG0288459 consensus WD40 repeat protein TipD [General functi 99.97
KOG0282503 consensus mRNA splicing factor [Function unknown] 99.97
cd05600333 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- 99.97
cd05620316 STKc_nPKC_delta Catalytic domain of the Protein Se 99.97
cd05591321 STKc_nPKC_epsilon Catalytic domain of the Protein 99.97
cd07859338 STKc_TDY_MAPK_plant Catalytic domain of the Serine 99.97
PTZ00267478 NIMA-related protein kinase; Provisional 99.97
KOG0596677 consensus Dual specificity; serine/threonine and t 99.97
cd05628363 STKc_NDR1 Catalytic domain of the Protein Serine/T 99.97
cd05594325 STKc_PKB_alpha Catalytic domain of the Protein Ser 99.97
KOG0275508 consensus Conserved WD40 repeat-containing protein 99.97
cd05592316 STKc_nPKC_theta_delta Catalytic domain of the Prot 99.97
cd05573350 STKc_ROCK_NDR_like Catalytic domain of ROCK- and N 99.97
cd05614332 STKc_MSK2_N N-terminal catalytic domain of the Pro 99.97
cd07848287 STKc_CDKL5 Catalytic domain of the Serine/Threonin 99.97
KOG0612 1317 consensus Rho-associated, coiled-coil containing p 99.97
cd05588329 STKc_aPKC Catalytic domain of the Protein Serine/T 99.97
cd05575323 STKc_SGK Catalytic domain of the Protein Serine/Th 99.97
cd05584323 STKc_p70S6K Catalytic domain of the Protein Serine 99.97
cd05589324 STKc_PKN Catalytic domain of the Protein Serine/Th 99.97
KOG0306 888 consensus WD40-repeat-containing subunit of the 18 99.97
cd05596370 STKc_ROCK Catalytic domain of the Protein Serine/T 99.97
cd07863288 STKc_CDK4 Catalytic domain of the Serine/Threonine 99.97
cd05587324 STKc_cPKC Catalytic domain of the Protein Serine/T 99.97
cd05619316 STKc_nPKC_theta Catalytic domain of the Protein Se 99.97
KOG0313423 consensus Microtubule binding protein YTM1 (contai 99.97
cd07868317 STKc_CDK8 Catalytic domain of the Serine/Threonine 99.97
cd05618329 STKc_aPKC_iota Catalytic domain of the Protein Ser 99.97
KOG0643327 consensus Translation initiation factor 3, subunit 99.97
KOG0292 1202 consensus Vesicle coat complex COPI, alpha subunit 99.97
cd05601330 STKc_CRIK Catalytic domain of the Protein Serine/T 99.97
PHA03212391 serine/threonine kinase US3; Provisional 99.97
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 99.97
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.97
PHA02988283 hypothetical protein; Provisional 99.97
cd05621370 STKc_ROCK2 Catalytic domain of the Protein Serine/ 99.97
cd05626381 STKc_LATS2 Catalytic domain of the Protein Serine/ 99.97
cd05625382 STKc_LATS1 Catalytic domain of the Protein Serine/ 99.97
KOG0603612 consensus Ribosomal protein S6 kinase [Signal tran 99.97
PTZ00036440 glycogen synthase kinase; Provisional 99.97
cd05599364 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Rel 99.97
cd05586330 STKc_Sck1_like Catalytic domain of Suppressor of l 99.97
cd05604325 STKc_SGK3 Catalytic domain of the Protein Serine/T 99.97
KOG0293519 consensus WD40 repeat-containing protein [Function 99.96
KOG0584632 consensus Serine/threonine protein kinase [General 99.96
KOG0285460 consensus Pleiotropic regulator 1 [RNA processing 99.96
cd05102338 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosi 99.96
KOG42791226 consensus Serine/threonine protein kinase [Signal 99.96
cd05616323 STKc_cPKC_beta Catalytic domain of the Protein Ser 99.96
KOG46451509 consensus MAPKKK (MAP kinase kinase kinase) SSK2 a 99.96
cd05570318 STKc_PKC Catalytic domain of the Protein Serine/Th 99.96
KOG0640430 consensus mRNA cleavage stimulating factor complex 99.96
cd05617327 STKc_aPKC_zeta Catalytic domain of the Protein Ser 99.96
cd05608280 STKc_GRK1 Catalytic domain of the Protein Serine/T 99.96
KOG0640430 consensus mRNA cleavage stimulating factor complex 99.96
PHA03209357 serine/threonine kinase US3; Provisional 99.96
KOG0268433 consensus Sof1-like rRNA processing protein (conta 99.96
cd05603321 STKc_SGK2 Catalytic domain of the Protein Serine/T 99.96
cd06649331 PKc_MEK2 Catalytic domain of the dual-specificity 99.96
cd05602325 STKc_SGK1 Catalytic domain of the Protein Serine/T 99.96
cd05629377 STKc_NDR_like_fungal Catalytic domain of Fungal Nu 99.96
cd05582318 STKc_RSK_N N-terminal catalytic domain of the Prot 99.96
cd05598376 STKc_LATS Catalytic domain of the Protein Serine/T 99.96
KOG0577 948 consensus Serine/threonine protein kinase [Signal 99.96
KOG0310 487 consensus Conserved WD40 repeat-containing protein 99.96
cd05627360 STKc_NDR2 Catalytic domain of the Protein Serine/T 99.96
cd06625263 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase 99.96
cd05623332 STKc_MRCK_alpha Catalytic domain of the Protein Se 99.96
cd07875364 STKc_JNK1 Catalytic domain of the Serine/Threonine 99.96
KOG0645312 consensus WD40 repeat protein [General function pr 99.96
KOG0607463 consensus MAP kinase-interacting kinase and relate 99.96
cd05615323 STKc_cPKC_alpha Catalytic domain of the Protein Se 99.96
KOG0690516 consensus Serine/threonine protein kinase [Signal 99.96
PHA03211461 serine/threonine kinase US3; Provisional 99.96
PTZ00284467 protein kinase; Provisional 99.96
cd07876359 STKc_JNK2 Catalytic domain of the Serine/Threonine 99.96
KOG0292 1202 consensus Vesicle coat complex COPI, alpha subunit 99.96
PLN00034353 mitogen-activated protein kinase kinase; Provision 99.96
cd05597331 STKc_DMPK_like Catalytic domain of Myotonic Dystro 99.96
KOG0667586 consensus Dual-specificity tyrosine-phosphorylatio 99.96
cd05622371 STKc_ROCK1 Catalytic domain of the Protein Serine/ 99.96
PTZ00266 1021 NIMA-related protein kinase; Provisional 99.96
KOG0665369 consensus Jun-N-terminal kinase (JNK) [Signal tran 99.96
cd05607277 STKc_GRK7 Catalytic domain of the Protein Serine/T 99.96
cd07867317 STKc_CDC2L6 Catalytic domain of Serine/Threonine K 99.96
cd06637272 STKc_TNIK Catalytic domain of the Protein Serine/T 99.96
cd07872309 STKc_PCTAIRE2 Catalytic domain of the Serine/Threo 99.96
cd07874355 STKc_JNK3 Catalytic domain of the Serine/Threonine 99.96
PLN00181793 protein SPA1-RELATED; Provisional 99.96
cd07853372 STKc_NLK Catalytic domain of the Serine/Threonine 99.96
cd05605285 STKc_GRK4_like Catalytic domain of G protein-coupl 99.96
KOG1989738 consensus ARK protein kinase family [Signal transd 99.96
PHA03207392 serine/threonine kinase US3; Provisional 99.96
KOG0283712 consensus WD40 repeat-containing protein [Function 99.96
KOG0264422 consensus Nucleosome remodeling factor, subunit CA 99.96
cd05624331 STKc_MRCK_beta Catalytic domain of the Protein Ser 99.96
KOG0265338 consensus U5 snRNP-specific protein-like factor an 99.96
cd08223257 STKc_Nek4 Catalytic domain of the Protein Serine/T 99.96
cd06650333 PKc_MEK1 Catalytic domain of the dual-specificity 99.96
cd07878343 STKc_p38beta_MAPK11 Catalytic domain of the Serine 99.96
KOG0264422 consensus Nucleosome remodeling factor, subunit CA 99.96
cd08529256 STKc_FA2-like Catalytic domain of the Protein Seri 99.96
KOG0316307 consensus Conserved WD40 repeat-containing protein 99.96
KOG0586596 consensus Serine/threonine protein kinase [General 99.96
cd06651266 STKc_MEKK3 Catalytic domain of the Protein Serine/ 99.96
cd06644292 STKc_STK10_LOK Catalytic domain of the Protein Ser 99.96
KOG0696683 consensus Serine/threonine protein kinase [Signal 99.96
cd07839284 STKc_CDK5 Catalytic domain of the Serine/Threonine 99.96
cd06643282 STKc_SLK Catalytic domain of the Protein Serine/Th 99.96
KOG0983391 consensus Mitogen-activated protein kinase (MAPK) 99.96
cd05633279 STKc_GRK3 Catalytic domain of the Protein Serine/T 99.96
cd05630285 STKc_GRK6 Catalytic domain of the Protein Serine/T 99.96
KOG12401431 consensus Protein kinase containing WD40 repeats [ 99.96
KOG0666438 consensus Cyclin C-dependent kinase CDK8 [Transcri 99.96
cd06645267 STKc_MAP4K3 Catalytic domain of the Protein Serine 99.96
cd08227327 PK_STRAD_alpha Pseudokinase domain of STE20-relate 99.96
KOG0986591 consensus G protein-coupled receptor kinase [Signa 99.96
cd06631265 STKc_YSK4 Catalytic domain of the Protein Serine/T 99.96
PHA03390267 pk1 serine/threonine-protein kinase 1; Provisional 99.96
KOG0269 839 consensus WD40 repeat-containing protein [Function 99.96
KOG0296399 consensus Angio-associated migratory cell protein 99.96
KOG0268433 consensus Sof1-like rRNA processing protein (conta 99.96
KOG1187361 consensus Serine/threonine protein kinase [Signal 99.96
cd06636282 STKc_MAP4K4_6 Catalytic domain of the Protein Seri 99.95
KOG0574502 consensus STE20-like serine/threonine kinase MST [ 99.95
cd06652265 STKc_MEKK2 Catalytic domain of the Protein Serine/ 99.95
cd05574316 STKc_phototropin_like Catalytic domain of Phototro 99.95
cd06628267 STKc_MAPKKK_Byr2_like Catalytic domain of fungal B 99.95
PTZ00421 493 coronin; Provisional 99.95
cd06655296 STKc_PAK2 Catalytic domain of the Protein Serine/T 99.95
cd06658292 STKc_PAK5 Catalytic domain of the Protein Serine/T 99.95
cd07832286 STKc_CCRK Catalytic domain of the Serine/Threonine 99.95
cd05064266 PTKc_EphR_A10 Catalytic domain of the Protein Tyro 99.95
cd08217265 STKc_Nek2 Catalytic domain of the Protein Serine/T 99.95
cd07831282 STKc_MOK Catalytic domain of the Serine/Threonine 99.95
cd06609274 STKc_MST3_like Catalytic domain of Mammalian Ste20 99.95
KOG0310 487 consensus Conserved WD40 repeat-containing protein 99.95
cd06654296 STKc_PAK1 Catalytic domain of the Protein Serine/T 99.95
KOG0301 745 consensus Phospholipase A2-activating protein (con 99.95
cd06605265 PKc_MAPKK Catalytic domain of the dual-specificity 99.95
cd08221256 STKc_Nek9 Catalytic domain of the Protein Serine/T 99.95
cd06621287 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek 99.95
cd05104375 PTKc_Kit Catalytic domain of the Protein Tyrosine 99.95
cd07873301 STKc_PCTAIRE1 Catalytic domain of the Serine/Threo 99.95
KOG0671415 consensus LAMMER dual specificity kinases [Signal 99.95
cd05106374 PTKc_CSF-1R Catalytic domain of the Protein Tyrosi 99.95
cd06611280 STKc_SLK_like Catalytic domain of Ste20-like kinas 99.95
cd05632285 STKc_GRK5 Catalytic domain of the Protein Serine/T 99.95
cd06612256 STKc_MST1_2 Catalytic domain of the Protein Serine 99.95
cd06656297 STKc_PAK3 Catalytic domain of the Protein Serine/T 99.95
KOG0647347 consensus mRNA export protein (contains WD40 repea 99.95
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 99.95
KOG0193678 consensus Serine/threonine protein kinase RAF [Sig 99.95
cd06648285 STKc_PAK_II Catalytic domain of the Protein Serine 99.95
cd07841298 STKc_CDK7 Catalytic domain of the Serine/Threonine 99.95
cd05111279 PTK_HER3 Pseudokinase domain of the Protein Tyrosi 99.95
cd05054337 PTKc_VEGFR Catalytic domain of the Protein Tyrosin 99.95
cd05048283 PTKc_Ror Catalytic Domain of the Protein Tyrosine 99.95
cd06619279 PKc_MKK5 Catalytic domain of the dual-specificity 99.95
cd05572262 STKc_cGK_PKG Catalytic domain of the Protein Serin 99.95
cd05108316 PTKc_EGFR Catalytic domain of the Protein Tyrosine 99.95
cd07861285 STKc_CDK1_euk Catalytic domain of the Serine/Threo 99.95
cd05576237 STKc_RPK118_like Catalytic domain of the Protein S 99.95
cd05606278 STKc_beta_ARK Catalytic domain of the Protein Seri 99.95
cd06639291 STKc_myosinIIIB Catalytic domain of the Protein Se 99.95
KOG0973 942 consensus Histone transcription regulator HIRA, WD 99.95
cd06638286 STKc_myosinIIIA Catalytic domain of the Protein Se 99.95
cd06659297 STKc_PAK6 Catalytic domain of the Protein Serine/T 99.95
PF00069260 Pkinase: Protein kinase domain Protein kinase; unc 99.95
cd07845309 STKc_CDK10 Catalytic domain of the Serine/Threonin 99.95
cd05611260 STKc_Rim15_like Catalytic domain of fungal Rim15-l 99.95
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 99.95
cd06615308 PKc_MEK Catalytic domain of the dual-specificity P 99.95
KOG4236888 consensus Serine/threonine protein kinase PKC mu/P 99.95
cd06613262 STKc_MAP4K3_like Catalytic domain of Mitogen-activ 99.95
cd05580290 STKc_PKA Catalytic domain of the Protein Serine/Th 99.95
PHA03210501 serine/threonine kinase US3; Provisional 99.95
cd05052263 PTKc_Abl Catalytic domain of the Protein Tyrosine 99.95
cd05082256 PTKc_Csk Catalytic domain of the Protein Tyrosine 99.95
KOG0299479 consensus U3 snoRNP-associated protein (contains W 99.95
cd06622286 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS 99.95
cd06608275 STKc_myosinIII_like Catalytic domain of Class III 99.95
cd06624268 STKc_ASK Catalytic domain of the Protein Serine/Th 99.95
cd07858337 STKc_TEY_MAPK_plant Catalytic domain of the Serine 99.95
cd06646267 STKc_MAP4K5 Catalytic domain of the Protein Serine 99.95
cd05115257 PTKc_Zap-70 Catalytic domain of the Protein Tyrosi 99.95
cd06632258 STKc_MEKK1_plant Catalytic domain of the Protein S 99.95
cd05084252 PTKc_Fes Catalytic domain of the Protein Tyrosine 99.95
KOG0300481 consensus WD40 repeat-containing protein [Function 99.95
PLN03225566 Serine/threonine-protein kinase SNT7; Provisional 99.95
cd05079284 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the 99.95
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 99.95
cd05096304 PTKc_DDR1 Catalytic domain of the Protein Tyrosine 99.95
cd07855334 STKc_ERK5 Catalytic domain of the Serine/Threonine 99.95
cd05058262 PTKc_Met_Ron Catalytic domain of the Protein Tyros 99.95
PTZ00421 493 coronin; Provisional 99.95
cd07850353 STKc_JNK Catalytic domain of the Serine/Threonine 99.95
KOG0278334 consensus Serine/threonine kinase receptor-associa 99.95
cd06629272 STKc_MAPKKK_Bck1_like Catalytic domain of fungal B 99.95
cd06607307 STKc_TAO Catalytic domain of the Protein Serine/Th 99.95
cd08220256 STKc_Nek8 Catalytic domain of the Protein Serine/T 99.95
cd06642277 STKc_STK25-YSK1 Catalytic domain of the Protein Se 99.95
cd05114256 PTKc_Tec_Rlk Catalytic domain of the Protein Tyros 99.95
cd05116257 PTKc_Syk Catalytic domain of the Protein Tyrosine 99.95
cd05113256 PTKc_Btk_Bmx Catalytic domain of the Protein Tyros 99.95
KOG0289506 consensus mRNA splicing factor [General function p 99.95
cd05609305 STKc_MAST Catalytic domain of the Protein Serine/T 99.95
KOG2345302 consensus Serine/threonine protein kinase/TGF-beta 99.95
cd06633313 STKc_TAO3 Catalytic domain of the Protein Serine/T 99.95
PTZ00420 568 coronin; Provisional 99.95
cd07860284 STKc_CDK2_3 Catalytic domain of the Serine/Threoni 99.95
cd05109279 PTKc_HER2 Catalytic domain of the Protein Tyrosine 99.95
cd06630268 STKc_MEKK1 Catalytic domain of the Protein Serine/ 99.95
KOG2096420 consensus WD40 repeat protein [General function pr 99.95
cd08218256 STKc_Nek1 Catalytic domain of the Protein Serine/T 99.95
cd06623264 PKc_MAPKK_plant_like Catalytic domain of Plant dua 99.95
cd05077262 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of th 99.95
cd08216314 PK_STRAD Pseudokinase domain of STE20-related kina 99.95
cd07865310 STKc_CDK9 Catalytic domain of the Serine/Threonine 99.95
cd07847286 STKc_CDKL1_4 Catalytic domain of the Serine/Threon 99.95
KOG0662292 consensus Cyclin-dependent kinase CDK5 [Intracellu 99.95
cd06640277 STKc_MST4 Catalytic domain of the Protein Serine/T 99.95
cd05094291 PTKc_TrkC Catalytic domain of the Protein Tyrosine 99.95
cd05059256 PTKc_Tec_like Catalytic domain of Tec-like Protein 99.95
cd00192262 PTKc Catalytic domain of Protein Tyrosine Kinases. 99.95
cd05078258 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain 99.95
cd05093288 PTKc_TrkB Catalytic domain of the Protein Tyrosine 99.95
cd06634308 STKc_TAO2 Catalytic domain of the Protein Serine/T 99.95
cd07843293 STKc_CDC2L1 Catalytic domain of the Serine/Threoni 99.95
cd05091283 PTKc_Ror2 Catalytic domain of the Protein Tyrosine 99.95
cd05105400 PTKc_PDGFR_alpha Catalytic domain of the Protein T 99.95
cd05062277 PTKc_IGF-1R Catalytic domain of the Protein Tyrosi 99.95
KOG0695593 consensus Serine/threonine protein kinase [Signal 99.95
cd05578258 STKc_Yank1 Catalytic domain of the Protein Serine/ 99.95
cd05061288 PTKc_InsR Catalytic domain of the Protein Tyrosine 99.94
cd05049280 PTKc_Trk Catalytic domain of the Protein Tyrosine 99.94
cd05053293 PTKc_FGFR Catalytic domain of the Protein Tyrosine 99.94
cd07849336 STKc_ERK1_2_like Catalytic domain of Extracellular 99.94
cd06917277 STKc_NAK1_like Catalytic domain of Fungal Nak1-lik 99.94
cd07837295 STKc_CdkB_plant Catalytic domain of the Serine/Thr 99.94
cd05579265 STKc_MAST_like Catalytic domain of Microtubule-ass 99.94
KOG0278334 consensus Serine/threonine kinase receptor-associa 99.94
cd06626264 STKc_MEKK4 Catalytic domain of the Protein Serine/ 99.94
cd06653264 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kina 99.94
cd05076274 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of th 99.94
cd05036277 PTKc_ALK_LTK Catalytic domain of the Protein Tyros 99.94
cd07842316 STKc_CDK8_like Catalytic domain of Cyclin-Dependen 99.94
cd05090283 PTKc_Ror1 Catalytic domain of the Protein Tyrosine 99.94
cd05577277 STKc_GRK Catalytic domain of the Protein Serine/Th 99.94
KOG06081034 consensus Warts/lats-like serine threonine kinases 99.94
PTZ00420 568 coronin; Provisional 99.94
cd07844291 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like 99.94
cd05040257 PTKc_Ack_like Catalytic domain of the Protein Tyro 99.94
cd06635317 STKc_TAO1 Catalytic domain of the Protein Serine/T 99.94
cd05037259 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the 99.94
cd05080283 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the 99.94
cd05075272 PTKc_Axl Catalytic domain of the Protein Tyrosine 99.94
cd05089297 PTKc_Tie1 Catalytic domain of the Protein Tyrosine 99.94
cd08226328 PK_STRAD_beta Pseudokinase domain of STE20-related 99.94
KOG10951025 consensus Protein tyrosine kinase [Signal transduc 99.94
cd06617283 PKc_MKK3_6 Catalytic domain of the dual-specificit 99.94
cd05035273 PTKc_Axl_like Catalytic Domain of Axl-like Protein 99.94
cd05072261 PTKc_Lyn Catalytic domain of the Protein Tyrosine 99.94
cd06647293 STKc_PAK_I Catalytic domain of the Protein Serine/ 99.94
cd05033266 PTKc_EphR Catalytic domain of Ephrin Receptor Prot 99.94
cd07870291 STKc_PFTAIRE2 Catalytic domain of the Serine/Threo 99.94
cd05070260 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyros 99.94
cd05068261 PTKc_Frk_like Catalytic domain of Fyn-related kina 99.94
cd07852337 STKc_MAPK15 Catalytic domain of the Serine/Threoni 99.94
cd05071262 PTKc_Src Catalytic domain of the Protein Tyrosine 99.94
cd06614286 STKc_PAK Catalytic domain of the Protein Serine/Th 99.94
cd06620284 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr 99.94
cd05088303 PTKc_Tie2 Catalytic domain of the Protein Tyrosine 99.94
cd05055302 PTKc_PDGFR Catalytic domain of the Protein Tyrosin 99.94
cd05101304 PTKc_FGFR2 Catalytic domain of the Protein Tyrosin 99.94
cd05081284 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of 99.94
cd05032277 PTKc_InsR_like Catalytic domain of Insulin Recepto 99.94
cd05083254 PTKc_Chk Catalytic domain of the Protein Tyrosine 99.94
cd05098307 PTKc_FGFR1 Catalytic domain of the Protein Tyrosin 99.94
cd07880343 STKc_p38gamma_MAPK12 Catalytic domain of the Serin 99.94
cd06610267 STKc_OSR1_SPAK Catalytic domain of the Protein Ser 99.94
cd08225257 STKc_Nek5 Catalytic domain of the Protein Serine/T 99.94
cd05085250 PTKc_Fer Catalytic domain of the Protein Tyrosine 99.94
cd05122253 PKc_STE Catalytic domain of STE family Protein Kin 99.94
cd05103343 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosi 99.94
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 99.94
cd07857332 STKc_MPK1 Catalytic domain of the Serine/Threonine 99.94
cd05056270 PTKc_FAK Catalytic domain of the Protein Tyrosine 99.94
KOG1036323 consensus Mitotic spindle checkpoint protein BUB3, 99.94
cd05060257 PTKc_Syk_like Catalytic domain of Spleen Tyrosine 99.94
cd06657292 STKc_PAK4 Catalytic domain of the Protein Serine/T 99.94
KOG0194474 consensus Protein tyrosine kinase [Signal transduc 99.94
cd07836284 STKc_Pho85 Catalytic domain of the Serine/Threonin 99.94
cd07854342 STKc_MAPK4_6 Catalytic domain of the Serine/Threon 99.94
cd06606260 STKc_MAPKKK Catalytic domain of the Protein Serine 99.94
cd08219255 STKc_Nek3 Catalytic domain of the Protein Serine/T 99.94
cd07834330 STKc_MAPK Catalytic domain of the Serine/Threonine 99.94
cd07851343 STKc_p38 Catalytic domain of the Serine/Threonine 99.94
cd07846286 STKc_CDKL2_3 Catalytic domain of the Serine/Threon 99.94
cd05069260 PTKc_Yes Catalytic domain of the Protein Tyrosine 99.94
cd05099314 PTKc_FGFR4 Catalytic domain of the Protein Tyrosin 99.94
KOG0772641 consensus Uncharacterized conserved protein, conta 99.94
cd05092280 PTKc_TrkA Catalytic domain of the Protein Tyrosine 99.94
cd08228267 STKc_Nek6 Catalytic domain of the Protein Serine/T 99.94
cd05066267 PTKc_EphR_A Catalytic domain of the Protein Tyrosi 99.94
cd05047270 PTKc_Tie Catalytic domain of Tie Protein Tyrosine 99.94
cd08215258 STKc_Nek Catalytic domain of the Protein Serine/Th 99.94
cd07866311 STKc_BUR1 Catalytic domain of the Serine/Threonine 99.94
cd06641277 STKc_MST3 Catalytic domain of the Protein Serine/T 99.94
cd05051296 PTKc_DDR Catalytic domain of the Protein Tyrosine 99.94
cd05148261 PTKc_Srm_Brk Catalytic domain of the Protein Tyros 99.94
cd07879342 STKc_p38delta_MAPK13 Catalytic domain of the Serin 99.94
cd06616288 PKc_MKK4 Catalytic domain of the dual-specificity 99.94
cd07835283 STKc_CDK1_like Catalytic domain of Cyclin-Dependen 99.94
cd05039256 PTKc_Csk_like Catalytic domain of C-terminal Src k 99.94
cd05110303 PTKc_HER4 Catalytic domain of the Protein Tyrosine 99.94
cd05041251 PTKc_Fes_like Catalytic domain of Fes-like Protein 99.94
KOG1026774 consensus Nerve growth factor receptor TRKA and re 99.94
cd07833288 STKc_CDKL Catalytic domain of Cyclin-Dependent pro 99.94
cd05086268 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosi 99.94
cd05118283 STKc_CMGC Catalytic domain of CMGC family Serine/T 99.94
PF07714259 Pkinase_Tyr: Protein tyrosine kinase Protein kinas 99.94
cd07838287 STKc_CDK4_6_like Catalytic domain of Cyclin-Depend 99.94
cd05063268 PTKc_EphR_A2 Catalytic domain of the Protein Tyros 99.94
KOG1027903 consensus Serine/threonine protein kinase and endo 99.94
cd06618296 PKc_MKK7 Catalytic domain of the dual-specificity 99.94
cd05100334 PTKc_FGFR3 Catalytic domain of the Protein Tyrosin 99.94
cd05112256 PTKc_Itk Catalytic domain of the Protein Tyrosine 99.94
KOG0294362 consensus WD40 repeat-containing protein [Function 99.94
KOG0669376 consensus Cyclin T-dependent kinase CDK9 [Cell cyc 99.94
cd08222260 STKc_Nek11 Catalytic domain of the Protein Serine/ 99.94
cd06627254 STKc_Cdc7_like Catalytic domain of Cell division c 99.94
cd05065269 PTKc_EphR_B Catalytic domain of the Protein Tyrosi 99.94
cd05097295 PTKc_DDR_like Catalytic domain of Discoidin Domain 99.94
cd07830283 STKc_MAK_like Catalytic domain of Male germ cell-A 99.94
cd05067260 PTKc_Lck_Blk Catalytic domain of the Protein Tyros 99.94
cd05045290 PTKc_RET Catalytic domain of the Protein Tyrosine 99.94
cd07877345 STKc_p38alpha_MAPK14 Catalytic domain of the Serin 99.94
cd05107401 PTKc_PDGFR_beta Catalytic domain of the Protein Ty 99.94
cd05050288 PTKc_Musk Catalytic domain of the Protein Tyrosine 99.94
KOG0641350 consensus WD40 repeat protein [General function pr 99.94
cd05042269 PTKc_Aatyk Catalytic domain of the Protein Tyrosin 99.94
KOG0306 888 consensus WD40-repeat-containing subunit of the 18 99.94
smart00219258 TyrKc Tyrosine kinase, catalytic domain. Phosphotr 99.93
cd07840287 STKc_CDK9_like Catalytic domain of Cyclin-Dependen 99.93
cd08224267 STKc_Nek6_Nek7 Catalytic domain of the Protein Ser 99.93
cd05057279 PTKc_EGFR_like Catalytic domain of Epidermal Growt 99.93
cd05073260 PTKc_Hck Catalytic domain of the Protein Tyrosine 99.93
cd07864302 STKc_CDK12 Catalytic domain of the Serine/Threonin 99.93
cd08530256 STKc_CNK2-like Catalytic domain of the Protein Ser 99.93
cd08229267 STKc_Nek7 Catalytic domain of the Protein Serine/T 99.93
cd05046275 PTK_CCK4 Pseudokinase domain of the Protein Tyrosi 99.93
KOG0614732 consensus cGMP-dependent protein kinase [Signal tr 99.93
cd05044269 PTKc_c-ros Catalytic domain of the Protein Tyrosin 99.93
cd05613290 STKc_MSK1_N N-terminal catalytic domain of the Pro 99.93
PRK13184932 pknD serine/threonine-protein kinase; Reviewed 99.93
KOG0270463 consensus WD40 repeat-containing protein [Function 99.93
cd05095296 PTKc_DDR2 Catalytic domain of the Protein Tyrosine 99.93
cd05610669 STKc_MASTL Catalytic domain of the Protein Serine/ 99.93
PLN00009294 cyclin-dependent kinase A; Provisional 99.93
cd05034261 PTKc_Src_like Catalytic domain of Src kinase-like 99.93
KOG0641350 consensus WD40 repeat protein [General function pr 99.93
cd05043280 PTK_Ryk Pseudokinase domain of Ryk (Receptor relat 99.93
KOG0300481 consensus WD40 repeat-containing protein [Function 99.93
cd07829282 STKc_CDK_like Catalytic domain of Cyclin-Dependent 99.93
cd05038284 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the P 99.93
KOG1407313 consensus WD40 repeat protein [Function unknown] 99.93
PTZ00024335 cyclin-dependent protein kinase; Provisional 99.93
cd05123250 STKc_AGC Catalytic domain of AGC family Protein Se 99.93
cd05581280 STKc_PDK1 Catalytic domain of the Protein Serine/T 99.93
cd05087269 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein 99.93
KOG0647347 consensus mRNA export protein (contains WD40 repea 99.93
cd05583288 STKc_MSK_N N-terminal catalytic domain of the Prot 99.93
KOG2055514 consensus WD40 repeat protein [General function pr 99.93
KOG0639705 consensus Transducin-like enhancer of split protei 99.93
KOG0643327 consensus Translation initiation factor 3, subunit 99.93
KOG1539 910 consensus WD repeat protein [General function pred 99.93
cd07856328 STKc_Sty1_Hog1 Catalytic domain of the Serine/Thre 99.93
KOG4283397 consensus Transcription-coupled repair protein CSA 99.93
KOG0308 735 consensus Conserved WD40 repeat-containing protein 99.93
cd08528269 STKc_Nek10 Catalytic domain of the Protein Serine/ 99.93
KOG4257974 consensus Focal adhesion tyrosine kinase FAK, cont 99.93
KOG1408 1080 consensus WD40 repeat protein [Function unknown] 99.92
PHA02882294 putative serine/threonine kinase; Provisional 99.92
KOG0973 942 consensus Histone transcription regulator HIRA, WD 99.92
KOG1006361 consensus Mitogen-activated protein kinase (MAPK) 99.92
KOG0668338 consensus Casein kinase II, alpha subunit [Signal 99.92
KOG1332299 consensus Vesicle coat complex COPII, subunit SEC1 99.92
smart00750176 KIND kinase non-catalytic C-lobe domain. It is an 99.92
KOG0587 953 consensus Traf2- and Nck-interacting kinase and re 99.92
KOG1151775 consensus Tousled-like protein kinase [Signal tran 99.92
KOG0288459 consensus WD40 repeat protein TipD [General functi 99.92
cd05074273 PTKc_Tyro3 Catalytic domain of the Protein Tyrosin 99.92
KOG0289506 consensus mRNA splicing factor [General function p 99.92
smart00220244 S_TKc Serine/Threonine protein kinases, catalytic 99.92
KOG4250732 consensus TANK binding protein kinase TBK1 [Signal 99.92
KOG0321 720 consensus WD40 repeat-containing protein L2DTL [Fu 99.92
KOG0308 735 consensus Conserved WD40 repeat-containing protein 99.92
KOG1332299 consensus Vesicle coat complex COPII, subunit SEC1 99.92
KOG0283 712 consensus WD40 repeat-containing protein [Function 99.92
KOG0664449 consensus Nemo-like MAPK-related serine/threonine 99.92
KOG0294362 consensus WD40 repeat-containing protein [Function 99.91
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information 
Probab=100.00  E-value=1.1e-90  Score=847.67  Aligned_cols=735  Identities=72%  Similarity=1.145  Sum_probs=572.3

Q ss_pred             CceEEEEeeCCcchhhhhcCCCCCCChhHHHHHHHHHHHHHHhhhhcCcccccCCCcceeeccCCCeeeeecccccCCCC
Q 002801           55 DPFVHAIEWGDVSLRQWLDKPKRSVDVYECLHIFRQIVEIVYAAHSQGIVVHNVRPSCFVMSSFNHVSFIESASCSDSGS  134 (879)
Q Consensus        55 ~~~lv~e~~~g~sL~~~l~~~~~~l~~~~~~~i~~qi~~~l~~lHs~givHrDlKP~NIll~~~~~vkl~dfg~~~~~~~  134 (879)
                      ..++.|.++.+++|++||+...+.+++.+++.|++||++||+|||++|||||||||+||||+..|.+|++|||++...+.
T Consensus        53 ~~~~~~~e~~~~~L~~~l~~~~~~~~~~~~~~i~~qi~~al~~lH~~gIvHrDlKP~NiLl~~~~~~k~~d~~~~~~~~~  132 (793)
T PLN00181         53 DSIVRALECEDVSLRQWLDNPDRSVDAFECFHVFRQIVEIVNAAHSQGIVVHNVRPSCFVMSSFNHVSFIESASCSDSGS  132 (793)
T ss_pred             chhhhhhccCCccHHHHHhcccccccHHHHHHHHHHHHHHHHHHHhCCeeeccCCchhEEEcccCcEEEeeccccCcccc
Confidence            34444444558899999977667799999999999999999999999999999999999999999999999999976432


Q ss_pred             CCcccccccccccccCCCCCCcchhhhhhhhccccccccccCCCcccccccccccccccCcceeeccccccccccccccc
Q 002801          135 DSHEEGLNTQNMETKDLSSPLPLDMLQRRTRLRREDLQLVTAPTNDLSEASCMQSSSAYGTHVVLVEGMQEHKILDNRVN  214 (879)
Q Consensus       135 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~  214 (879)
                      +.                          ....+..|||+++.... .....                            .
T Consensus       133 ~~--------------------------~~~~ki~DfG~a~~~~~-~~~~~----------------------------~  157 (793)
T PLN00181        133 DE--------------------------DATTKSREIGSSRREEI-LSERR----------------------------I  157 (793)
T ss_pred             cc--------------------------cCccccccccccccccc-ccccc----------------------------h
Confidence            20                          11244556665544100 00000                            0


Q ss_pred             hhhcccccCCCCccccccccccceeccccccCCCCCccCcchhHHHHHHHhhcCCCCChhhHhHHhhhcccCCCchhhcc
Q 002801          215 VEQVEEKKQPFPMKQILLMETNWYASPEELAGAPVSCASDIYRLGVLLFELFCPFSTGEEKTRTMSSLRHRVLPPQLLLK  294 (879)
Q Consensus       215 ~~~~~~~~~~~~~~~~~~~gt~~Y~aPE~~~~~~~~~~sDIwSlGvil~ell~pf~~~~~~~~~~~~~~~~~~~~~~~~~  294 (879)
                      .........+++......+||++|||||++.+..|+.++|||||||+||||++|+.+.......+..+.....++.....
T Consensus       158 ~~~~~~~~~~~~~~~~~~~gt~~Y~APE~~~~~~~~~~sDVwSlGviL~ELl~~~~~~~~~~~~~~~~~~~~~~~~~~~~  237 (793)
T PLN00181        158 EKLEEVKKQPFPMKQILAMEMSWYTSPEEDNGSSSNCASDVYRLGVLLFELFCPVSSREEKSRTMSSLRHRVLPPQILLN  237 (793)
T ss_pred             hhhhccccCCCcccccccCCCcceEChhhhccCCCCchhhhhhHHHHHHHHhhCCCchhhHHHHHHHHHHhhcChhhhhc
Confidence            00001112233444456789999999999999999999999999999999999665554444455555555556555555


Q ss_pred             ChhhHHHHHHhcCCCCCCCCCHHHHhhcccccCCcCchHHHHHHHHHHhhhhHHHHHHHHHHHHHHHhHHHHHHHHHHHH
Q 002801          295 FPKEASFCLWLLHPEPSGRPKMGELLQSEFLNEPRDSMEEREAAIELREQIDEEELLLEFLLLVQQRKQESAKKLQDIVS  374 (879)
Q Consensus       295 ~~~~~~li~~~L~~dP~~Rpt~~evl~hp~~~~~~~~~~e~~~~~~~~~~~~~~e~l~~~l~~~~q~kqe~~~~l~~~l~  374 (879)
                      .+....++.+||+++|.+||++.|+++||||........+++......+...+.+.+.+++...++++++++.+++.+++
T Consensus       238 ~~~~~~~~~~~L~~~P~~Rps~~eil~h~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~  317 (793)
T PLN00181        238 WPKEASFCLWLLHPEPSCRPSMSELLQSEFINEPRENLEEREAAMELRDRIEEQELLLEFLFLIQQRKQEAADKLQDTIS  317 (793)
T ss_pred             CHHHHHHHHHhCCCChhhCcChHHHhhchhhhhhhHHhhhhhhhhhhhhhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            67788999999999999999999999999998866555555555555666666677788888888889999999999999


Q ss_pred             hhcccHHHHHHHHHHHHhcCCCCcccccccccCCCCCCCCcccccCCCCccccccccccCcccccccccccccccccccC
Q 002801          375 FICSDIEEVSKQQAILRKKGGLGSFAELANDDLSGLNIPSLNIIDNDCSATMGSRKRFRPELQLHHLEECDDNLDDNQKH  454 (879)
Q Consensus       375 ~l~~Di~eVe~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  454 (879)
                      .++.||++|++++.+.......                         .......+++++.+..+...+....    ....
T Consensus       318 ~l~~~i~~~~~r~~~~~~~~~~-------------------------~~~~~~~~~~~~~~~~~~~~~~~~~----~~~~  368 (793)
T PLN00181        318 LLSSDIDQVVKRQLVLQQKGSD-------------------------VRSFLASRKRIRQGAETLAAEEEND----DNSS  368 (793)
T ss_pred             HHHHHHHHHHhhhhhhcccccc-------------------------cccccccchhhhccccchhhccccc----cccc
Confidence            9999999999866543222111                         0122223444443333222221100    0000


Q ss_pred             cCCCCcccchhhhhHHHHhHhHHHHHHHhhccccCC---CCCCCcccccccC-CCCCCCCCccccccccccCCCccc-cc
Q 002801          455 NLTGNEERSLFKSSRLMKNFKKLESAYFLTRCRPVK---PSGRPLVRHSQLS-SDGRTSKPLVNERSSINNLGSKEG-YS  529 (879)
Q Consensus       455 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~---~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~-~~  529 (879)
                      .....+.+.+++++|||++|++|+++||.+|++...   ...+++.|..+.- .+++..     +..+.+++..... |.
T Consensus       369 ~~~~~~~s~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-----~~~~~~~~~~~~~~~~  443 (793)
T PLN00181        369 KLDDTLESTLLESSRLMRNLKKLESVYFATRYRQIKAAAAAEKPLARYYSALSENGRSS-----EKSSMSNPAKPPDFYI  443 (793)
T ss_pred             cccccccccchhhhHHHHHHHHHHHHHhhhhhccccccccccccccccccccccccccc-----cccccccccccccccc
Confidence            012235677888999999999999999999986532   2344555544322 344432     3344444443332 32


Q ss_pred             cC-CCCceecccccCceEEEeecCcEEEEEeccccccCCCCCEEEEEEcCCCCEEEEEeCCCcEEEEecCcccCcCcccc
Q 002801          530 EG-RRSGWINPFLEGLCKYLSFSKLRVKADLNQGDLLNSSNLVCSLSFDRDGELFAAAGVNKKIKVFECDAIINENRDIH  608 (879)
Q Consensus       530 ~~-~~~~~~~~~~d~~i~~w~~~~~~~~~~l~~~~l~~h~~~V~~l~fspdg~~lat~~~dg~I~iwd~~~~~~~~~~~~  608 (879)
                      .. ...+++.+|.+|++++|++.+.++...++.+++.+|.+.|++++|+|+|++|||||.|++|+||++..........+
T Consensus       444 ~~~~~~~~~~~~~~gl~~~~~~~~~~~~~~~~~~~~~~~~~~V~~i~fs~dg~~latgg~D~~I~iwd~~~~~~~~~~~~  523 (793)
T PLN00181        444 NDSRQGGWIDPFLEGLCKYLSFSKLRVKADLKQGDLLNSSNLVCAIGFDRDGEFFATAGVNKKIKIFECESIIKDGRDIH  523 (793)
T ss_pred             cccccccchhhhhhhhhhhhcccceEEEEeeccccccCCCCcEEEEEECCCCCEEEEEeCCCEEEEEECCcccccccccc
Confidence            22 23455778999999999999999999999899999999999999999999999999999999999876433344455


Q ss_pred             cceEEeccCCCeeEEEEeCCCCCeEEEeeCCCcEEEEEcCCCeEEEEeccCCCcEEEEEEecCCCCEEEEEeCCCcEEEE
Q 002801          609 YPVVEMASRSKLSSICWNSYIKSQIASSNFEGVVQVWDVSRSQVLTEMREHERRVWSIDFSSADPTLLASGSDDGSVKLW  688 (879)
Q Consensus       609 ~~~~~~~~~~~i~~l~~~~~~~~~l~s~~~dg~V~vwd~~~~~~~~~~~~h~~~v~sv~~sp~~~~~lasgs~Dg~V~iw  688 (879)
                      .++..+.+...|.+++|++..+.+|++++.||+|++||+.+++.+..+.+|.+.|++++|+|.++.+|++|+.|++|++|
T Consensus       524 ~~~~~~~~~~~v~~l~~~~~~~~~las~~~Dg~v~lWd~~~~~~~~~~~~H~~~V~~l~~~p~~~~~L~Sgs~Dg~v~iW  603 (793)
T PLN00181        524 YPVVELASRSKLSGICWNSYIKSQVASSNFEGVVQVWDVARSQLVTEMKEHEKRVWSIDYSSADPTLLASGSDDGSVKLW  603 (793)
T ss_pred             cceEEecccCceeeEEeccCCCCEEEEEeCCCeEEEEECCCCeEEEEecCCCCCEEEEEEcCCCCCEEEEEcCCCEEEEE
Confidence            66777777889999999988789999999999999999999999999999999999999997678999999999999999


Q ss_pred             eCCCCceEEEEecCCceEEEEeeCCCCCEEEEEeCCCeEEEEEcCCCceeeEEEccCCCCEEEEEEcCCCEEEEEEcCCc
Q 002801          689 SINQGVSIGTIKTKANVCCVQFPLDSGRSLAFGSADHRIYYYDLRNSKIPLCTLIGHNKTVSYVKFVDATTLVSASTDNT  768 (879)
Q Consensus       689 d~~~~~~i~~~~~~~~v~~v~~~p~~~~~l~tgs~d~~I~iwDl~~~~~~~~~~~~h~~~V~~v~fs~~~~l~s~s~D~~  768 (879)
                      |++++..+.++..+..|+++.|++.++.+|++|+.|+.|++||+++.+.++..+.+|...|+++.|.++.+|+|++.|++
T Consensus       604 d~~~~~~~~~~~~~~~v~~v~~~~~~g~~latgs~dg~I~iwD~~~~~~~~~~~~~h~~~V~~v~f~~~~~lvs~s~D~~  683 (793)
T PLN00181        604 SINQGVSIGTIKTKANICCVQFPSESGRSLAFGSADHKVYYYDLRNPKLPLCTMIGHSKTVSYVRFVDSSTLVSSSTDNT  683 (793)
T ss_pred             ECCCCcEEEEEecCCCeEEEEEeCCCCCEEEEEeCCCeEEEEECCCCCccceEecCCCCCEEEEEEeCCCEEEEEECCCE
Confidence            99999999999888899999998766899999999999999999987766788889999999999998999999999999


Q ss_pred             EEEEecCCCcccccCCceEEEeCCCCcEEEEEEecCCCEEEEEeCCCcEEEEecCCCCCceecccCCCCCCCCCCCCCCC
Q 002801          769 LKLWDLSMCTSRVIDTPLHSFTGHTNVKNFVGLSVWDGYVATGSETNEVFVYHKAFPMPALSFNFNHADPLSGPETDDAA  848 (879)
Q Consensus       769 i~lwd~~~~~~~~~~~~~~~~~~h~~~v~~v~~sp~~~~lasgs~Dg~v~vw~~~~~~~~~~~~~~~~~~~~~~~~~~h~  848 (879)
                      |++||++.........++.++.+|.+.+++++|+|++.+||+|+.|+.|++|+...+.++.++.+...+.+.+....+|.
T Consensus       684 ikiWd~~~~~~~~~~~~l~~~~gh~~~i~~v~~s~~~~~lasgs~D~~v~iw~~~~~~~~~s~~~~~~~~~~~~~~~~~~  763 (793)
T PLN00181        684 LKLWDLSMSISGINETPLHSFMGHTNVKNFVGLSVSDGYIATGSETNEVFVYHKAFPMPVLSYKFKTIDPVSGLEVDDAS  763 (793)
T ss_pred             EEEEeCCCCccccCCcceEEEcCCCCCeeEEEEcCCCCEEEEEeCCCEEEEEECCCCCceEEEecccCCcccccccCCCC
Confidence            99999986432222367889999999999999999999999999999999999998888888888777666665556778


Q ss_pred             CCEEEEEEeCCCCcEEEEEeCCCcEEEEEeC
Q 002801          849 QFISSVCWRGQSSNTLVAANSSGNIKILEMV  879 (879)
Q Consensus       849 ~~V~~v~~~p~~~~~l~s~~~Dg~I~vw~lv  879 (879)
                      .+|++++|+|++. +|++|+.||.|+||+||
T Consensus       764 ~~V~~v~ws~~~~-~lva~~~dG~I~i~~~~  793 (793)
T PLN00181        764 QFISSVCWRGQSS-TLVAANSTGNIKILEMV  793 (793)
T ss_pred             cEEEEEEEcCCCC-eEEEecCCCcEEEEecC
Confidence            8999999999999 99999999999999997

>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0615 consensus Serine/threonine protein kinase Chk2 and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0581 consensus Mitogen-activated protein kinase kinase (MAP2K) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] Back     alignment and domain information
>KOG0591 consensus NIMA (never in mitosis)-related G2-specific serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>KOG0575 consensus Polo-like serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0661 consensus MAPK related serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>KOG0588 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0592 consensus 3-phosphoinositide-dependent protein kinase (PDK1) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0598 consensus Ribosomal protein S6 kinase and related proteins [General function prediction only; Signal transduction mechanisms] Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>KOG0660 consensus Mitogen-activated protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0583 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0198 consensus MEKK and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] Back     alignment and domain information
>KOG0645 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0578 consensus p21-activated serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>KOG0593 consensus Predicted protein kinase KKIAMRE [General function prediction only] Back     alignment and domain information
>KOG0595 consensus Serine/threonine-protein kinase involved in autophagy [Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0616 consensus cAMP-dependent protein kinase catalytic subunit (PKA) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0605 consensus NDR and related serine/threonine kinases [General function prediction only] Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>KOG0600 consensus Cdc2-related protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0033 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>KOG0192 consensus Tyrosine kinase specific for activated (GTP-bound) p21cdc42Hs [Signal transduction mechanisms] Back     alignment and domain information
>KOG0610 consensus Putative serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0663 consensus Protein kinase PITSLRE and related kinases [General function prediction only] Back     alignment and domain information
>KOG0659 consensus Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH/TFIIK, kinase subunit CDK7 [Cell cycle control, cell division, chromosome partitioning; Transcription; Replication, recombination and repair] Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG4721 consensus Serine/threonine protein kinase, contains leucine zipper domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0585 consensus Ca2+/calmodulin-dependent protein kinase kinase beta and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>KOG0604 consensus MAP kinase-activated protein kinase 2 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0599 consensus Phosphorylase kinase gamma subunit [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0594 consensus Protein kinase PCTAIRE and related kinases [General function prediction only] Back     alignment and domain information
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0694 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1035 consensus eIF-2alpha kinase GCN2 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0611 consensus Predicted serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>KOG0597 consensus Serine-threonine protein kinase FUSED [General function prediction only] Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0579 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0589 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>KOG0032 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>KOG0582 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0201 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>KOG0580 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0658 consensus Glycogen synthase kinase-3 [Carbohydrate transport and metabolism] Back     alignment and domain information
>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>KOG4717 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PTZ00263 protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>PTZ00283 serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG0197 consensus Tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>PTZ00267 NIMA-related protein kinase; Provisional Back     alignment and domain information
>KOG0596 consensus Dual specificity; serine/threonine and tyrosine kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 Back     alignment and domain information
>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] Back     alignment and domain information
>cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 Back     alignment and domain information
>cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] Back     alignment and domain information
>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>PHA03212 serine/threonine kinase US3; Provisional Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>PHA02988 hypothetical protein; Provisional Back     alignment and domain information
>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 Back     alignment and domain information
>cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 Back     alignment and domain information
>KOG0603 consensus Ribosomal protein S6 kinase [Signal transduction mechanisms] Back     alignment and domain information
>PTZ00036 glycogen synthase kinase; Provisional Back     alignment and domain information
>cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0584 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] Back     alignment and domain information
>cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 Back     alignment and domain information
>KOG4279 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>KOG4645 consensus MAPKKK (MAP kinase kinase kinase) SSK2 and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] Back     alignment and domain information
>cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] Back     alignment and domain information
>PHA03209 serine/threonine kinase US3; Provisional Back     alignment and domain information
>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 Back     alignment and domain information
>cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>KOG0577 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha Back     alignment and domain information
>cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 Back     alignment and domain information
>KOG0645 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0607 consensus MAP kinase-interacting kinase and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>KOG0690 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PHA03211 serine/threonine kinase US3; Provisional Back     alignment and domain information
>PTZ00284 protein kinase; Provisional Back     alignment and domain information
>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 Back     alignment and domain information
>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN00034 mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0667 consensus Dual-specificity tyrosine-phosphorylation regulated kinase [General function prediction only] Back     alignment and domain information
>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>PTZ00266 NIMA-related protein kinase; Provisional Back     alignment and domain information
>KOG0665 consensus Jun-N-terminal kinase (JNK) [Signal transduction mechanisms] Back     alignment and domain information
>cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 Back     alignment and domain information
>cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6 Back     alignment and domain information
>cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information
>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase Back     alignment and domain information
>cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG1989 consensus ARK protein kinase family [Signal transduction mechanisms] Back     alignment and domain information
>PHA03207 serine/threonine kinase US3; Provisional Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] Back     alignment and domain information
>cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta Back     alignment and domain information
>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] Back     alignment and domain information
>cd08223 STKc_Nek4 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 Back     alignment and domain information
>cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 Back     alignment and domain information
>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase Back     alignment and domain information
>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] Back     alignment and domain information
>cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0586 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 Back     alignment and domain information
>cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>KOG0696 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd07839 STKc_CDK5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>KOG0983 consensus Mitogen-activated protein kinase (MAPK) kinase MKK7/JNKK2 [Signal transduction mechanisms] Back     alignment and domain information
>cd05633 STKc_GRK3 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 Back     alignment and domain information
>cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>KOG0666 consensus Cyclin C-dependent kinase CDK8 [Transcription] Back     alignment and domain information
>cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 Back     alignment and domain information
>cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha Back     alignment and domain information
>KOG0986 consensus G protein-coupled receptor kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd06631 STKc_YSK4 Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>PHA03390 pk1 serine/threonine-protein kinase 1; Provisional Back     alignment and domain information
>KOG0269 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG1187 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>KOG0574 consensus STE20-like serine/threonine kinase MST [Signal transduction mechanisms] Back     alignment and domain information
>cd06652 STKc_MEKK2 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 Back     alignment and domain information
>cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06628 STKc_MAPKKK_Byr2_like Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>cd07832 STKc_CCRK Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 Back     alignment and domain information
>cd08217 STKc_Nek2 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>cd07831 STKc_MOK Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information
>cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] Back     alignment and domain information
>cd06605 PKc_MAPKK Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>cd08221 STKc_Nek9 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 Back     alignment and domain information
>cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit Back     alignment and domain information
>cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase Back     alignment and domain information
>KOG0671 consensus LAMMER dual specificity kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor Back     alignment and domain information
>cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 Back     alignment and domain information
>cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>KOG0193 consensus Serine/threonine protein kinase RAF [Signal transduction mechanisms] Back     alignment and domain information
>cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3 Back     alignment and domain information
>cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors Back     alignment and domain information
>cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 Back     alignment and domain information
>cd05572 STKc_cGK_PKG Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor Back     alignment and domain information
>cd07861 STKc_CDK1_euk Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>cd05576 STKc_RPK118_like Catalytic domain of the Protein Serine/Threonine Kinases, RPK118 and similar proteins Back     alignment and domain information
>cd05606 STKc_beta_ARK Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase Back     alignment and domain information
>cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin Back     alignment and domain information
>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>PF00069 Pkinase: Protein kinase domain Protein kinase; unclassified specificity Back     alignment and domain information
>cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>cd05611 STKc_Rim15_like Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase Back     alignment and domain information
>KOG4236 consensus Serine/threonine protein kinase PKC mu/PKD and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>PHA03210 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase Back     alignment and domain information
>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information
>cd05115 PTKc_Zap-70 Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa Back     alignment and domain information
>cd06632 STKc_MEKK1_plant Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd05084 PTKc_Fes Catalytic domain of the Protein Tyrosine Kinase, Fes Back     alignment and domain information
>KOG0300 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PLN03225 Serine/threonine-protein kinase SNT7; Provisional Back     alignment and domain information
>cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 Back     alignment and domain information
>cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 Back     alignment and domain information
>cd05058 PTKc_Met_Ron Catalytic domain of the Protein Tyrosine Kinases, Met and Ron Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>cd08220 STKc_Nek8 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>cd05116 PTKc_Syk Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase Back     alignment and domain information
>cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase Back     alignment and domain information
>KOG2345 consensus Serine/threonine protein kinase/TGF-beta stimulated factor [Transcription; Lipid transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>cd07860 STKc_CDK2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2 Back     alignment and domain information
>cd06630 STKc_MEKK1 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>KOG2096 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>cd08218 STKc_Nek1 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 Back     alignment and domain information
>cd06623 PKc_MAPKK_plant_like Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>cd05077 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd08216 PK_STRAD Pseudokinase domain of STE20-related kinase adapter protein Back     alignment and domain information
>cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 Back     alignment and domain information
>cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 Back     alignment and domain information
>KOG0662 consensus Cyclin-dependent kinase CDK5 [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C Back     alignment and domain information
>cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>cd00192 PTKc Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>cd05078 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B Back     alignment and domain information
>cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 Back     alignment and domain information
>cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 Back     alignment and domain information
>cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha Back     alignment and domain information
>cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor Back     alignment and domain information
>KOG0695 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05578 STKc_Yank1 Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor Back     alignment and domain information
>cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors Back     alignment and domain information
>cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases Back     alignment and domain information
>cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase Back     alignment and domain information
>cd05579 STKc_MAST_like Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>cd06626 STKc_MEKK4 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>cd06653 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05076 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase Back     alignment and domain information
>cd07842 STKc_CDK8_like Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases Back     alignment and domain information
>cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 Back     alignment and domain information
>cd05577 STKc_GRK Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase Back     alignment and domain information
>KOG0608 consensus Warts/lats-like serine threonine kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases Back     alignment and domain information
>cd05040 PTKc_Ack_like Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase Back     alignment and domain information
>cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 Back     alignment and domain information
>cd05037 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd05075 PTKc_Axl Catalytic domain of the Protein Tyrosine Kinase, Axl Back     alignment and domain information
>cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1 Back     alignment and domain information
>cd08226 PK_STRAD_beta Pseudokinase domain of STE20-related kinase adapter protein beta Back     alignment and domain information
>KOG1095 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 Back     alignment and domain information
>cd05035 PTKc_Axl_like Catalytic Domain of Axl-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase Back     alignment and domain information
>cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 Back     alignment and domain information
>cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src Back     alignment and domain information
>cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2 Back     alignment and domain information
>cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 Back     alignment and domain information
>cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 Back     alignment and domain information
>cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>cd08225 STKc_Nek5 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 Back     alignment and domain information
>cd05085 PTKc_Fer Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information
>cd05122 PKc_STE Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd07857 STKc_MPK1 Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 Back     alignment and domain information
>cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05060 PTKc_Syk_like Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>KOG0194 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd07836 STKc_Pho85 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 Back     alignment and domain information
>cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 Back     alignment and domain information
>cd06606 STKc_MAPKKK Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>cd08219 STKc_Nek3 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 Back     alignment and domain information
>cd07834 STKc_MAPK Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes Back     alignment and domain information
>cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A Back     alignment and domain information
>cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 Back     alignment and domain information
>cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors Back     alignment and domain information
>cd05047 PTKc_Tie Catalytic domain of Tie Protein Tyrosine Kinases Back     alignment and domain information
>cd08215 STKc_Nek Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information
>cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors Back     alignment and domain information
>cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 Back     alignment and domain information
>cd07835 STKc_CDK1_like Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4 Back     alignment and domain information
>cd05041 PTKc_Fes_like Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>KOG1026 consensus Nerve growth factor receptor TRKA and related tyrosine kinases [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>cd05086 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2 Back     alignment and domain information
>cd05118 STKc_CMGC Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>PF07714 Pkinase_Tyr: Protein tyrosine kinase Protein kinase; unclassified specificity Back     alignment and domain information
>cd07838 STKc_CDK4_6_like Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 Back     alignment and domain information
>KOG1027 consensus Serine/threonine protein kinase and endoribonuclease ERN1/IRE1, sensor of the unfolded protein response pathway [Signal transduction mechanisms] Back     alignment and domain information
>cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 Back     alignment and domain information
>cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 Back     alignment and domain information
>cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>KOG0294 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0669 consensus Cyclin T-dependent kinase CDK9 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd08222 STKc_Nek11 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 Back     alignment and domain information
>cd06627 STKc_Cdc7_like Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors Back     alignment and domain information
>cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd07830 STKc_MAK_like Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>cd05045 PTKc_RET Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta Back     alignment and domain information
>cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase Back     alignment and domain information
>KOG0641 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>cd05042 PTKc_Aatyk Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases Back     alignment and domain information
>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>smart00219 TyrKc Tyrosine kinase, catalytic domain Back     alignment and domain information
>cd07840 STKc_CDK9_like Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase Back     alignment and domain information
>cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>cd08530 STKc_CNK2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 Back     alignment and domain information
>cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 Back     alignment and domain information
>KOG0614 consensus cGMP-dependent protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05044 PTKc_c-ros Catalytic domain of the Protein Tyrosine Kinase, C-ros Back     alignment and domain information
>cd05613 STKc_MSK1_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>KOG0270 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 Back     alignment and domain information
>cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>PLN00009 cyclin-dependent kinase A; Provisional Back     alignment and domain information
>cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>KOG0641 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) Back     alignment and domain information
>KOG0300 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>cd07829 STKc_CDK_like Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>PTZ00024 cyclin-dependent protein kinase; Provisional Back     alignment and domain information
>cd05123 STKc_AGC Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05581 STKc_PDK1 Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>cd05087 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3 Back     alignment and domain information
>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>cd05583 STKc_MSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 Back     alignment and domain information
>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>cd08528 STKc_Nek10 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 Back     alignment and domain information
>KOG4257 consensus Focal adhesion tyrosine kinase FAK, contains FERM domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG1408 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>PHA02882 putative serine/threonine kinase; Provisional Back     alignment and domain information
>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG1006 consensus Mitogen-activated protein kinase (MAPK) kinase MKK4 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0668 consensus Casein kinase II, alpha subunit [Signal transduction mechanisms; Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>smart00750 KIND kinase non-catalytic C-lobe domain Back     alignment and domain information
>KOG0587 consensus Traf2- and Nck-interacting kinase and related germinal center kinase (GCK) family protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG1151 consensus Tousled-like protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>cd05074 PTKc_Tyro3 Catalytic domain of the Protein Tyrosine Kinase, Tyro3 Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>smart00220 S_TKc Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>KOG4250 consensus TANK binding protein kinase TBK1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown] Back     alignment and domain information
>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0664 consensus Nemo-like MAPK-related serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0294 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query879
3mxx_A315 Crystal Structure Of Wdr5 Mutant (S62a) Length = 31 7e-16
2cnx_A315 Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2. 7e-16
2xl2_A334 Wdr5 In Complex With An Rbbp5 Peptide Recruited To 1e-15
2gnq_A336 Structure Of Wdr5 Length = 336 1e-15
3emh_A318 Structural Basis Of Wdr5-Mll Interaction Length = 3 1e-15
3n0d_A315 Crystal Structure Of Wdr5 Mutant (W330f) Length = 3 1e-15
2h9l_A329 Wdr5delta23 Length = 329 2e-15
4a7j_A318 Symmetric Dimethylation Of H3 Arginine 2 Is A Novel 2e-15
3n0e_A315 Crystal Structure Of Wdr5 Mutant (W330y) Length = 3 2e-15
2g99_A308 Structural Basis For The Specific Recognition Of Me 2e-15
3smr_A312 Crystal Structure Of Human Wd Repeat Domain 5 With 2e-15
3psl_A318 Fine-Tuning The Stimulation Of Mll1 Methyltransfera 2e-15
2h9m_A313 Wdr5 In Complex With Unmodified H3k4 Peptide Length 2e-15
2h68_A312 Histone H3 Recognition And Presentation By The Wdr5 2e-15
2h13_A317 Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length 2e-15
2g9a_A311 Structural Basis For The Specific Recognition Of Me 2e-15
2co0_A315 Wdr5 And Unmodified Histone H3 Complex At 2.25 Angs 3e-15
2ymu_A577 Structure Of A Highly Repetitive Propeller Structur 8e-14
2ymu_A 577 Structure Of A Highly Repetitive Propeller Structur 6e-08
1erj_A393 Crystal Structure Of The C-Terminal Wd40 Domain Of 2e-12
4g31_A299 Crystal Structure Of Gsk6414 Bound To Perk (R587-R1 3e-12
3qd2_B332 Crsytal Structure Of Mouse Perk Kinase Domain Lengt 3e-11
3iza_B1263 Structure Of An Apoptosome-Procaspase-9 Card Comple 5e-10
3shf_A1256 Crystal Structure Of The R265s Mutant Of Full-Lengt 9e-10
3sfz_A1249 Crystal Structure Of Full-Length Murine Apaf-1 Leng 1e-09
3zey_7318 High-resolution Cryo-electron Microscopy Structure 8e-09
3zey_7318 High-resolution Cryo-electron Microscopy Structure 2e-04
2ovp_B445 Structure Of The Skp1-Fbw7 Complex Length = 445 1e-08
2ovp_B445 Structure Of The Skp1-Fbw7 Complex Length = 445 4e-08
2yno_A310 Yeast Betaprime Cop 1-304h6 Length = 310 7e-08
2ynn_A304 Yeast Betaprime Cop 1-304 With Ktktn Motif Length = 7e-08
3mkq_A 814 Crystal Structure Of Yeast AlphaBETAPRIME-Cop Subco 9e-08
1p22_A435 Structure Of A Beta-Trcp1-Skp1-Beta-Catenin Complex 1e-07
2ynp_A 604 Yeast Betaprime Cop 1-604 With Ktktn Motif Length = 1e-07
3dm0_A694 Maltose Binding Protein Fusion With Rack1 From A. T 2e-07
3cfv_B414 Structural Basis Of The Interaction Of Rbap46RBAP48 2e-07
3cfs_B414 Structural Basis Of The Interaction Of Rbap46RBAP48 2e-07
3gfc_A425 Crystal Structure Of Histone-Binding Protein Rbbp4 3e-07
2pbi_B354 The Multifunctional Nature Of Gbeta5RGS9 REVEALED F 8e-07
3ow8_A321 Crystal Structure Of The Wd Repeat-Containing Prote 9e-07
2xyi_A430 Crystal Structure Of Nurf55 In Complex With A H4 Pe 1e-06
2yba_A422 Crystal Structure Of Nurf55 In Complex With Histone 1e-06
3c99_A432 Structural Basis Of Histone H4 Recognition By P55 L 1e-06
1vyh_C410 Paf-Ah Holoenzyme: Lis1ALFA2 Length = 410 2e-06
1vyh_C410 Paf-Ah Holoenzyme: Lis1ALFA2 Length = 410 2e-05
2zkq_a317 Structure Of A Mammalian Ribosomal 40s Subunit With 8e-06
4aow_A340 Crystal Structure Of The Human Rack1 Protein At A R 8e-06
4a11_B408 Structure Of The Hsddb1-Hscsa Complex Length = 408 2e-05
1gg2_B340 G Protein Heterotrimer Mutant Gi_alpha_1(G203a) Bet 2e-05
3sn6_B351 Crystal Structure Of The Beta2 Adrenergic Receptor- 2e-05
2bcj_B340 Crystal Structure Of G Protein-coupled Receptor Kin 2e-05
1nex_B 464 Crystal Structure Of Scskp1-Sccdc4-Cpd Peptide Comp 2e-05
3mks_B 464 Crystal Structure Of Yeast Cdc4SKP1 IN COMPLEX WITH 2e-05
4ggd_A431 Structural Analysis Of Human Cdc20 Supports Multisi 3e-05
1got_B340 Heterotrimeric Complex Of A Gt-AlphaGI-Alpha Chimer 3e-05
1a0r_B340 Heterotrimeric Complex Of PhosducinTRANSDUCIN BETA- 3e-05
4gga_A420 Structural Analysis Of Human Cdc20 Supports Multi-S 3e-05
4ggc_A318 Structural Analysis Of Human Cdc20 Supports Multi-S 2e-04
1zy4_A303 Crystal Structure Of Eif2alpha Protein Kinase Gcn2: 3e-04
1zyc_A303 Crystal Structure Of Eif2alpha Protein Kinase Gcn2: 3e-04
3rfg_A319 Crystal Structure Of The Yeast Rack1 Dimer In Space 3e-04
1trj_A314 Homology Model Of Yeast Rack1 Protein Fitted Into 1 3e-04
3jyv_R313 Structure Of The 40s Rrna And Proteins And PE TRNA 3e-04
3izb_a319 Localization Of The Small Subunit Ribosomal Protein 4e-04
3rfh_A319 Crystal Structure Of The Yeast Rack1 Dimer In Space 4e-04
3frx_A319 Crystal Structure Of The Yeast Orthologue Of Rack1, 8e-04
>pdb|3MXX|A Chain A, Crystal Structure Of Wdr5 Mutant (S62a) Length = 315 Back     alignment and structure 
Iteration: 1

 Score = 82.8 bits (203), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 70/251 (27%), Positives = 122/251 (48%), Gaps = 21/251 (8%)
Query: 576 FDRDGELFAAAGVNKKIKVFECDAIINENRDIHYPVVEMASRSKLSSICWNSYIKSQIAS 635
           F  +GE  AA+  +K IK++          D  +       +  +S + W+S     +++
Sbjct: 34  FSPNGEWLAASSADKLIKIWGA-------YDGKFEKTISGHKLGISDVAWSSDSNLLVSA 86
Query: 636 SNFEGVVQVWDVSRSQVLTEMREHERRVWSIDFSSADPTLLASGSDDGSVKLWSINQGVS 695
           S+ +  +++WDVS  + L  ++ H   V+  +F+     L+ SGS D SV++W +  G  
Sbjct: 87  SD-DKTLKIWDVSSGKCLKTLKGHSNYVFCCNFN-PQSNLIVSGSFDESVRIWDVKTGKC 144
Query: 696 IGTIKTKAN-VCCVQFPLDSGRSLAFGSADHRIYYYDLRNSKIPLCTLIGHNKTVSYVKF 754
           + T+   ++ V  V F  D G  +   S D     +D  + +     +   N  VS+VKF
Sbjct: 145 LKTLPAHSDPVSAVHFNRD-GSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKF 203
Query: 755 V-DATTLVSASTDNTLKLWDLSMCTSRVIDTPLHSFTGHTNVKN--FVGLSVWDG-YVAT 810
             +   +++A+ DNTLKLWD S          L ++TGH N K   F   SV  G ++ +
Sbjct: 204 SPNGKYILAATLDNTLKLWDYSK------GKCLKTYTGHKNEKYCIFANFSVTGGKWIVS 257
Query: 811 GSETNEVFVYH 821
           GSE N V++++
Sbjct: 258 GSEDNLVYIWN 268
>pdb|2CNX|A Chain A, Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2.1 Angstrom Length = 315 Back     alignment and structure
>pdb|2XL2|A Chain A, Wdr5 In Complex With An Rbbp5 Peptide Recruited To Novel Site Length = 334 Back     alignment and structure
>pdb|2GNQ|A Chain A, Structure Of Wdr5 Length = 336 Back     alignment and structure
>pdb|3EMH|A Chain A, Structural Basis Of Wdr5-Mll Interaction Length = 318 Back     alignment and structure
>pdb|3N0D|A Chain A, Crystal Structure Of Wdr5 Mutant (W330f) Length = 315 Back     alignment and structure
>pdb|2H9L|A Chain A, Wdr5delta23 Length = 329 Back     alignment and structure
>pdb|4A7J|A Chain A, Symmetric Dimethylation Of H3 Arginine 2 Is A Novel Histone Mark That Supports Euchromatin Maintenance Length = 318 Back     alignment and structure
>pdb|3N0E|A Chain A, Crystal Structure Of Wdr5 Mutant (W330y) Length = 315 Back     alignment and structure
>pdb|2G99|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 308 Back     alignment and structure
>pdb|3SMR|A Chain A, Crystal Structure Of Human Wd Repeat Domain 5 With Compound Length = 312 Back     alignment and structure
>pdb|3PSL|A Chain A, Fine-Tuning The Stimulation Of Mll1 Methyltransferase Activity By A Histone H3 Based Peptide Mimetic Length = 318 Back     alignment and structure
>pdb|2H9M|A Chain A, Wdr5 In Complex With Unmodified H3k4 Peptide Length = 313 Back     alignment and structure
>pdb|2H68|A Chain A, Histone H3 Recognition And Presentation By The Wdr5 Module Of The Mll1 Complex Length = 312 Back     alignment and structure
>pdb|2H13|A Chain A, Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length = 317 Back     alignment and structure
>pdb|2G9A|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 311 Back     alignment and structure
>pdb|2CO0|A Chain A, Wdr5 And Unmodified Histone H3 Complex At 2.25 Angstrom Length = 315 Back     alignment and structure
>pdb|2YMU|A Chain A, Structure Of A Highly Repetitive Propeller Structure Length = 577 Back     alignment and structure
>pdb|2YMU|A Chain A, Structure Of A Highly Repetitive Propeller Structure Length = 577 Back     alignment and structure
>pdb|1ERJ|A Chain A, Crystal Structure Of The C-Terminal Wd40 Domain Of Tup1 Length = 393 Back     alignment and structure
>pdb|4G31|A Chain A, Crystal Structure Of Gsk6414 Bound To Perk (R587-R1092, Delete A660- T867) At 2.28 A Resolution Length = 299 Back     alignment and structure
>pdb|3QD2|B Chain B, Crsytal Structure Of Mouse Perk Kinase Domain Length = 332 Back     alignment and structure
>pdb|3SHF|A Chain A, Crystal Structure Of The R265s Mutant Of Full-Length Murine Apaf-1 Length = 1256 Back     alignment and structure
>pdb|3SFZ|A Chain A, Crystal Structure Of Full-Length Murine Apaf-1 Length = 1249 Back     alignment and structure
>pdb|3ZEY|7 Chain 7, High-resolution Cryo-electron Microscopy Structure Of The Trypanosoma Brucei Ribosome Length = 318 Back     alignment and structure
>pdb|3ZEY|7 Chain 7, High-resolution Cryo-electron Microscopy Structure Of The Trypanosoma Brucei Ribosome Length = 318 Back     alignment and structure
>pdb|2OVP|B Chain B, Structure Of The Skp1-Fbw7 Complex Length = 445 Back     alignment and structure
>pdb|2OVP|B Chain B, Structure Of The Skp1-Fbw7 Complex Length = 445 Back     alignment and structure
>pdb|2YNO|A Chain A, Yeast Betaprime Cop 1-304h6 Length = 310 Back     alignment and structure
>pdb|2YNN|A Chain A, Yeast Betaprime Cop 1-304 With Ktktn Motif Length = 304 Back     alignment and structure
>pdb|3MKQ|A Chain A, Crystal Structure Of Yeast AlphaBETAPRIME-Cop Subcomplex Of The Copi Vesicular Coat Length = 814 Back     alignment and structure
>pdb|1P22|A Chain A, Structure Of A Beta-Trcp1-Skp1-Beta-Catenin Complex: Destruction Motif Binding And Lysine Specificity On The Scfbeta-Trcp1 Ubiquitin Ligase Length = 435 Back     alignment and structure
>pdb|2YNP|A Chain A, Yeast Betaprime Cop 1-604 With Ktktn Motif Length = 604 Back     alignment and structure
>pdb|3DM0|A Chain A, Maltose Binding Protein Fusion With Rack1 From A. Thaliana Length = 694 Back     alignment and structure
>pdb|3CFV|B Chain B, Structural Basis Of The Interaction Of Rbap46RBAP48 WITH Histone H4 Length = 414 Back     alignment and structure
>pdb|3CFS|B Chain B, Structural Basis Of The Interaction Of Rbap46RBAP48 WITH Histone H4 Length = 414 Back     alignment and structure
>pdb|3GFC|A Chain A, Crystal Structure Of Histone-Binding Protein Rbbp4 Length = 425 Back     alignment and structure
>pdb|2PBI|B Chain B, The Multifunctional Nature Of Gbeta5RGS9 REVEALED FROM ITS CRYSTAL Structure Length = 354 Back     alignment and structure
>pdb|3OW8|A Chain A, Crystal Structure Of The Wd Repeat-Containing Protein 61 Length = 321 Back     alignment and structure
>pdb|2XYI|A Chain A, Crystal Structure Of Nurf55 In Complex With A H4 Peptide Length = 430 Back     alignment and structure
>pdb|2YBA|A Chain A, Crystal Structure Of Nurf55 In Complex With Histone H3 Length = 422 Back     alignment and structure
>pdb|3C99|A Chain A, Structural Basis Of Histone H4 Recognition By P55 Length = 432 Back     alignment and structure
>pdb|1VYH|C Chain C, Paf-Ah Holoenzyme: Lis1ALFA2 Length = 410 Back     alignment and structure
>pdb|1VYH|C Chain C, Paf-Ah Holoenzyme: Lis1ALFA2 Length = 410 Back     alignment and structure
>pdb|2ZKQ|AA Chain a, Structure Of A Mammalian Ribosomal 40s Subunit Within An 80s Complex Obtained By Docking Homology Models Of The Rna And Proteins Into An 8.7 A Cryo-Em Map Length = 317 Back     alignment and structure
>pdb|4AOW|A Chain A, Crystal Structure Of The Human Rack1 Protein At A Resolution Of 2.45 Angstrom Length = 340 Back     alignment and structure
>pdb|4A11|B Chain B, Structure Of The Hsddb1-Hscsa Complex Length = 408 Back     alignment and structure
>pdb|1GG2|B Chain B, G Protein Heterotrimer Mutant Gi_alpha_1(G203a) Beta_1 Gamma_2 With Gdp Bound Length = 340 Back     alignment and structure
>pdb|3SN6|B Chain B, Crystal Structure Of The Beta2 Adrenergic Receptor-Gs Protein Complex Length = 351 Back     alignment and structure
>pdb|2BCJ|B Chain B, Crystal Structure Of G Protein-coupled Receptor Kinase 2 In Complex With Galpha-q And Gbetagamma Subunits Length = 340 Back     alignment and structure
>pdb|1NEX|B Chain B, Crystal Structure Of Scskp1-Sccdc4-Cpd Peptide Complex Length = 464 Back     alignment and structure
>pdb|3MKS|B Chain B, Crystal Structure Of Yeast Cdc4SKP1 IN COMPLEX WITH AN ALLOSTERIC Inhibitor Scf-I2 Length = 464 Back     alignment and structure
>pdb|4GGD|A Chain A, Structural Analysis Of Human Cdc20 Supports Multisite Degron Recognition By ApcC. Length = 431 Back     alignment and structure
>pdb|1GOT|B Chain B, Heterotrimeric Complex Of A Gt-AlphaGI-Alpha Chimera And The Gt-Beta-Gamma Subunits Length = 340 Back     alignment and structure
>pdb|1A0R|B Chain B, Heterotrimeric Complex Of PhosducinTRANSDUCIN BETA-Gamma Length = 340 Back     alignment and structure
>pdb|4GGA|A Chain A, Structural Analysis Of Human Cdc20 Supports Multi-Site Degron Recognition By ApcC Length = 420 Back     alignment and structure
>pdb|4GGC|A Chain A, Structural Analysis Of Human Cdc20 Supports Multi-Site Degron Recognition By ApcC Length = 318 Back     alignment and structure
>pdb|1ZY4|A Chain A, Crystal Structure Of Eif2alpha Protein Kinase Gcn2: R794g Hyperactivating Mutant In Apo Form. Length = 303 Back     alignment and structure
>pdb|1ZYC|A Chain A, Crystal Structure Of Eif2alpha Protein Kinase Gcn2: Wild- Type In Apo Form. Length = 303 Back     alignment and structure
>pdb|3RFG|A Chain A, Crystal Structure Of The Yeast Rack1 Dimer In Space Group P63 Length = 319 Back     alignment and structure
>pdb|1TRJ|A Chain A, Homology Model Of Yeast Rack1 Protein Fitted Into 11.7a Cryo-em Map Of Yeast 80s Ribosome Length = 314 Back     alignment and structure
>pdb|3JYV|R Chain R, Structure Of The 40s Rrna And Proteins And PE TRNA FOR EUKARYOTIC Ribosome Based On Cryo-Em Map Of Thermomyces Lanuginosus Ribosome At 8.9a Resolution Length = 313 Back     alignment and structure
>pdb|3IZB|AA Chain a, Localization Of The Small Subunit Ribosomal Proteins Into A 6.1 A Cryo-Em Map Of Saccharomyces Cerevisiae Translating 80s Ribosome Length = 319 Back     alignment and structure
>pdb|3RFH|A Chain A, Crystal Structure Of The Yeast Rack1 Dimer In Space Group P21 Length = 319 Back     alignment and structure
>pdb|3FRX|A Chain A, Crystal Structure Of The Yeast Orthologue Of Rack1, Asc1. Length = 319 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

No hit with probability above 80.00

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 879
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 2e-22
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 3e-16
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 3e-14
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 8e-09
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 1e-21
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 7e-19
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 1e-15
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 2e-15
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 1e-13
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 2e-19
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 2e-18
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 1e-14
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 3e-11
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 2e-16
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 3e-14
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 5e-07
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 5e-06
d2java1269 d.144.1.7 (A:3-271) Serine/threonine-protein kinas 9e-13
d1t4ha_270 d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sa 1e-12
d1yhwa1293 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [ 5e-12
d1koaa2350 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {C 8e-12
d2ozaa1335 d.144.1.7 (A:51-385) MAP kinase activated protein 1e-11
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 2e-11
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 6e-07
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 3e-06
d1nvra_271 d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 { 3e-11
d1tkia_321 d.144.1.7 (A:) Titin, kinase domain {Human (Homo s 3e-11
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 3e-11
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 5e-11
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 1e-10
d2ovrb2 342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 1e-05
d2ovrb2 342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 1e-04
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 3e-11
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 6e-09
d1gxra_ 337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 1e-04
d2j4za1263 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aur 4e-11
d2j4za1263 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aur 0.003
d1a06a_307 d.144.1.7 (A:) Calmodulin-dependent protein kinase 4e-11
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 8e-11
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 4e-08
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 2e-05
d1pgua2 287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 5e-05
d1yfqa_ 342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 9e-11
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 5e-08
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 2e-06
d1yfqa_ 342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 7e-05
d1jksa_293 d.144.1.7 (A:) Death-associated protein kinase, Da 1e-10
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 2e-10
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 2e-08
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 8e-06
d1sm2a_263 d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Hu 2e-10
d1o6ya_277 d.144.1.7 (A:) Mycobacterial protein kinase PknB, 3e-10
d1xwsa_273 d.144.1.7 (A:) Proto-oncogene serine/threonine-pro 4e-10
d1uwha_276 d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) 5e-10
d1koba_352 d.144.1.7 (A:) Twitchin, kinase domain {California 7e-10
d1byga_262 d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) 1e-09
d1mqba_283 d.144.1.7 (A:) epha2 receptor tyrosine kinase {Hum 1e-09
d1u5ra_309 d.144.1.7 (A:) Serine/threonine protein kinase TAO 1e-09
d1qpca_272 d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Hom 1e-09
d2jfla1288 d.144.1.7 (A:21-308) STE20-like serine/threonine-p 1e-09
d2jfla1288 d.144.1.7 (A:21-308) STE20-like serine/threonine-p 0.002
d1xjda_320 d.144.1.7 (A:) Protein kinase C, theta type {Human 3e-09
d1fmka3285 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human 3e-09
d1r0pa_311 d.144.1.7 (A:) Hepatocyte growth factor receptor, 3e-09
d1xbba_277 d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human 4e-09
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 5e-09
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 1e-08
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 3e-06
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 0.001
d1k2pa_258 d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Hum 6e-09
d1phka_277 d.144.1.7 (A:) gamma-subunit of glycogen phosphory 6e-09
d1ckia_299 d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus n 7e-09
d1jpaa_299 d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mou 8e-09
d1u46a_273 d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Hum 1e-08
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 1e-08
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 9e-08
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 5e-07
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 8e-06
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 1e-08
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 4e-08
d1nexb2 355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 4e-07
d1nexb2 355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 6e-07
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 2e-06
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 6e-05
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 2e-08
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 1e-07
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 8e-07
d1nr0a2 299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 2e-05
d1rjba_325 d.144.1.7 (A:) Fl cytokine receptor {Human (Homo s 2e-08
d1fvra_309 d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [ 3e-08
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 4e-08
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 4e-07
d1jmxb_ 346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 1e-06
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 9e-05
d1csna_293 d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast 5e-08
d1uu3a_288 d.144.1.7 (A:) 3-phosphoinositide dependent protei 6e-08
d1fgka_299 d.144.1.7 (A:) Fibroblast growth factor receptor 1 8e-08
d1lufa_301 d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus n 1e-07
d1mp8a_273 d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Huma 2e-07
d1qksa2 432 b.70.2.1 (A:136-567) C-terminal (heme d1) domain o 2e-07
d1qksa2 432 b.70.2.1 (A:136-567) C-terminal (heme d1) domain o 2e-06
d1xkka_317 d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb- 2e-07
d1s9ja_322 d.144.1.7 (A:) Dual specificity mitogen-activated 2e-07
d2bbkh_355 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 3e-07
d2bbkh_355 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 0.001
d1opja_287 d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mou 3e-07
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 4e-07
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 4e-07
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 1e-06
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 1e-04
d1pbyb_337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 4e-07
d1pbyb_337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 3e-06
d1blxa_305 d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (H 4e-07
d1hzua2 426 b.70.2.1 (A:118-543) C-terminal (heme d1) domain o 6e-07
d1hzua2 426 b.70.2.1 (A:118-543) C-terminal (heme d1) domain o 8e-06
d1hzua2426 b.70.2.1 (A:118-543) C-terminal (heme d1) domain o 0.004
d1u59a_285 d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Hum 1e-06
d1u59a_285 d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Hum 6e-04
d1unla_292 d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (H 2e-06
d1ua2a_299 d.144.1.7 (A:) Cell division protein kinase 7, CDK 3e-06
d1mdah_368 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 3e-06
d1mdah_368 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 1e-04
d1fota_316 d.144.1.7 (A:) cAMP-dependent PK, catalytic subuni 4e-06
d1t46a_311 d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens 5e-06
d1cm8a_346 d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo s 5e-06
d1p4oa_308 d.144.1.7 (A:) Insulin-like growth factor 1 recept 5e-06
d1o6la_337 d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sap 6e-06
d1omwa3364 d.144.1.7 (A:186-549) G-protein coupled receptor k 9e-06
d1gz8a_298 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (H 9e-06
d1ywna1299 d.144.1.7 (A:818-1166) Vascular endothelial growth 1e-05
d1pmea_345 d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapien 2e-05
d1vzoa_322 d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5 2e-05
d1l0qa2301 b.69.2.3 (A:1-301) Surface layer protein {Archaeon 3e-05
d1l0qa2301 b.69.2.3 (A:1-301) Surface layer protein {Archaeon 2e-04
d1l0qa2301 b.69.2.3 (A:1-301) Surface layer protein {Archaeon 2e-04
d2gfsa1348 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sa 3e-05
d1ri6a_333 b.69.11.1 (A:) Putative isomerase YbhE {Escherichi 4e-05
d1ri6a_333 b.69.11.1 (A:) Putative isomerase YbhE {Escherichi 0.003
d1vjya_303 d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human 4e-05
d1q5ka_350 d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gs 5e-05
d2b1pa1355 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3 9e-05
d1ob3a_286 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmod 1e-04
d1rdqe_350 d.144.1.7 (E:) cAMP-dependent PK, catalytic subuni 3e-04
d1q8ya_362 d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces 7e-04
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure

class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: beta1-subunit of the signal-transducing G protein heterotrimer
species: Cow (Bos taurus) [TaxId: 9913]

 Score = 97.1 bits (240), Expect = 2e-22
 Identities = 33/154 (21%), Positives = 57/154 (37%), Gaps = 7/154 (4%)

Query: 624 CWNSYIKSQIASSNFEGVVQVWDVSRSQVLTEMREHERRVWSIDFSSADPTLLASGSDDG 683
              +       S   +   ++WDV           HE  + +I F   +    A+GSDD 
Sbjct: 190 LSLAPDTRLFVSGACDASAKLWDVREGMCRQTFTGHESDINAICFFP-NGNAFATGSDDA 248

Query: 684 SVKL---WSINQGVSIGTIKTKANVCCVQFPLDSGRSLAFGSADHRIYYYDLRNSKIPLC 740
           + +L    +  + ++         +  V F    GR L  G  D     +D   +     
Sbjct: 249 TCRLFDLRADQELMTYSHDNIICGITSVSFSKS-GRLLLAGYDDFNCNVWDALKAD-RAG 306

Query: 741 TLIGHNKTVSYVKFV-DATTLVSASTDNTLKLWD 773
            L GH+  VS +    D   + + S D+ LK+W+
Sbjct: 307 VLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWN 340
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Length = 350 Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Length = 335 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Length = 321 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 307 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 277 Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 276 Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Length = 352 Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 262 Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 283 Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 309 Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Length = 272 Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Length = 320 Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Length = 277 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Length = 258 Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 277 Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 299 Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 299 Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 325 Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 309 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 293 Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 301 Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Length = 432 Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Length = 432 Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 317 Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 355 Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 355 Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Length = 287 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Length = 305 Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Length = 426 Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Length = 426 Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Length = 426 Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Length = 292 Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 368 Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 368 Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 316 Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Length = 346 Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 308 Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 364 Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Length = 298 Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Length = 345 Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Length = 301 Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Length = 301 Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Length = 301 Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Length = 348 Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Length = 333 Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Length = 333 Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Length = 303 Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Length = 350 Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Length = 355 Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Length = 286 Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 350 Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 362 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query879
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 100.0
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 100.0
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 100.0
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 100.0
d1yhwa1293 pak1 {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1nvra_271 Cell cycle checkpoint kinase chk1 {Human (Homo sap 100.0
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 100.0
d1koaa2350 Twitchin, kinase domain {Caenorhabditis elegans, p 100.0
d1koba_352 Twitchin, kinase domain {California sea hare (Aply 100.0
d2j4za1263 Aurora-related kinase 1 (aurora-2) {Human (Homo sa 100.0
d1u5ra_309 Serine/threonine protein kinase TAO2 {Rat (Rattus 100.0
d1a06a_307 Calmodulin-dependent protein kinase {Rat (Rattus n 100.0
d2jfla1288 STE20-like serine/threonine-protein kinase, SLK {H 100.0
d1t4ha_270 Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 100.0
d2java1269 Serine/threonine-protein kinase Nek2 {Human (Homo 100.0
d1s9ja_322 Dual specificity mitogen-activated protein kinase 100.0
d1tbga_340 beta1-subunit of the signal-transducing G protein 100.0
d1o6la_337 Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9 100.0
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d2ozaa1335 MAP kinase activated protein kinase 2, mapkap2 {Hu 100.0
d1omwa3364 G-protein coupled receptor kinase 2 {Cow (Bos taur 100.0
d1uu3a_288 3-phosphoinositide dependent protein kinase-1 Pdk1 100.0
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 100.0
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1rjba_325 Fl cytokine receptor {Human (Homo sapiens) [TaxId: 100.0
d1fota_316 cAMP-dependent PK, catalytic subunit {Baker's yeas 100.0
d1rdqe_350 cAMP-dependent PK, catalytic subunit {Mouse (Mus m 100.0
d1jksa_293 Death-associated protein kinase, Dap {Human (Homo 100.0
d1ua2a_299 Cell division protein kinase 7, CDK7 {Human (Homo 100.0
d1uwha_276 B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1jpaa_299 ephb2 receptor tyrosine kinase {Mouse (Mus musculu 100.0
d1sm2a_263 Tyrosine-protein kinase Itk/Tsk {Human (Homo sapie 100.0
d1xjda_320 Protein kinase C, theta type {Human (Homo sapiens) 100.0
d1tkia_321 Titin, kinase domain {Human (Homo sapiens) [TaxId: 100.0
d1opja_287 Abelsone tyrosine kinase (abl) {Mouse (Mus musculu 100.0
d1blxa_305 Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [T 100.0
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 100.0
d1ywna1299 Vascular endothelial growth factor receptor 2 (kdr 100.0
d1qpca_272 Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax 100.0
d1u59a_285 Tyrosine-protein kinase ZAP-70 {Human (Homo sapien 100.0
d1phka_277 gamma-subunit of glycogen phosphorylase kinase (Ph 100.0
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 100.0
d1xbba_277 Tyrosine-protein kinase SYK {Human (Homo sapiens) 100.0
d1tbga_340 beta1-subunit of the signal-transducing G protein 100.0
d1mqba_283 epha2 receptor tyrosine kinase {Human (Homo sapien 100.0
d1mp8a_273 Focal adhesion kinase 1 (fak) {Human (Homo sapiens 100.0
d1xkka_317 EGF receptor tyrosine kinase, Erbb-1 {Human (Homo 100.0
d1fmka3285 c-src tyrosine kinase {Human (Homo sapiens) [TaxId 100.0
d1xwsa_273 Proto-oncogene serine/threonine-protein kinase Pim 100.0
d1q5ka_350 Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho 100.0
d3bqca1328 Protein kinase CK2, alpha subunit {Rattus norvegic 100.0
d1pmea_345 MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606 100.0
d1cm8a_346 MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 100.0
d1gz8a_298 Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [T 100.0
d1r0pa_311 Hepatocyte growth factor receptor, c-MET {Human (H 100.0
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 100.0
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 100.0
d1k2pa_258 Bruton's tyrosine kinase (Btk) {Human (Homo sapien 100.0
d1o6ya_277 Mycobacterial protein kinase PknB, catalytic domai 100.0
d1fgka_299 Fibroblast growth factor receptor 1 {Human (Homo s 100.0
d1fvra_309 Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} 100.0
d3blha1318 Cell division protein kinase 9, CDK9 {Human (Homo 100.0
d1byga_262 Carboxyl-terminal src kinase (csk) {Human (Homo sa 100.0
d2gfsa1348 MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606] 100.0
d1lufa_301 Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax 100.0
d2b1pa1355 c-jun N-terminal kinase (jnk3s) {Human (Homo sapie 100.0
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 100.0
d1u46a_273 Activated CDC42 kinase 1, ACK1 {Human (Homo sapien 100.0
d1t46a_311 c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] 100.0
d1ob3a_286 Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) 100.0
d1unla_292 Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [T 100.0
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 100.0
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1vzoa_322 Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( 100.0
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 100.0
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 100.0
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 100.0
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 100.0
d1vjya_303 Type I TGF-beta receptor R4 {Human (Homo sapiens) 100.0
d1p4oa_308 Insulin-like growth factor 1 receptor {Human (Homo 100.0
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 100.0
d1ckia_299 Casein kinase-1, CK1 {Rat (Rattus norvegicus) [Tax 100.0
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 100.0
d1csna_293 Casein kinase-1, CK1 {Fission yeast (Schizosacchar 100.0
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 100.0
d1q8ya_362 Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T 100.0
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 100.0
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 100.0
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 100.0
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 100.0
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.97
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.97
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.97
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.95
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.95
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.94
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.93
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.93
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.93
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.92
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.92
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.89
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.88
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.88
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.87
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.84
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.82
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.74
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.66
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 99.64
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.6
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 99.5
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.47
d1zara2191 Rio2 serine protein kinase C-terminal domain {Arch 99.47
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 99.4
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 99.38
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 99.36
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 99.3
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 99.27
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 99.24
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 99.18
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 99.16
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 99.16
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 99.14
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 99.1
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 99.07
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 98.9
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 98.76
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 98.75
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 98.67
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 98.54
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 98.18
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 97.66
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 97.28
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 97.11
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 97.06
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 97.03
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 96.91
d1j7la_263 Type IIIa 3',5"-aminoglycoside phosphotransferase 96.82
d1utca2327 Clathrin heavy-chain terminal domain {Rat (Rattus 96.82
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 96.77
d1nd4a_255 Aminoglycoside 3'-phosphotransferase IIa (Kanamyci 96.6
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 96.51
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 96.5
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 96.16
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 96.12
d1utca2327 Clathrin heavy-chain terminal domain {Rat (Rattus 95.76
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 95.51
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 95.19
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 95.07
d1w6sa_596 Methanol dehydrogenase, heavy chain {Methylobacter 94.59
d1w6sa_596 Methanol dehydrogenase, heavy chain {Methylobacter 94.46
d2ppqa1316 Homoserine kinase ThrB {Agrobacterium tumefaciens 93.99
d1flga_582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 93.32
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 92.94
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 92.58
d1zyla1325 RdoA {Escherichia coli [TaxId: 562]} 91.58
d2pula1392 Methylthioribose kinase MtnK {Bacillus subtilis [T 90.38
d1xipa_381 Nucleoporin NUP159 {Baker's yeast (Saccharomyces c 89.47
d1h6la_353 Thermostable phytase (3-phytase) {Bacillus amyloli 89.09
d1nw1a_395 Choline kinase {Caenorhabditis elegans [TaxId: 623 88.01
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 85.84
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Tup1, C-terminal domain
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=100.00  E-value=0  Score=298.31  Aligned_cols=322  Identities=22%  Similarity=0.369  Sum_probs=265.2

Q ss_pred             ECCCCCCCEEEEEECCCEEE-EEECCCCCCCCCCCEEEEEECCCCCEEEEEECCCCEEEEECCCCCCCCC----------
Q ss_conf             40444681689850475797-8721353458999889999938999999995899299995486447676----------
Q 002801          537 INPFLEGLCKYLSFSKLRVK-ADLNQGDLLNSSNLVCSLSFDRDGELFAAAGVNKKIKVFECDAIINENR----------  605 (879)
Q Consensus       537 l~~~~d~~i~~w~~~~~~~~-~~l~~~~l~~h~~~V~si~fspdg~~lat~~~dg~I~iwd~~~~~~~~~----------  605 (879)
                      +.+..++...+|+....+.. ..+.  ...+|.+.|+|++|+|||++||+|+ |++|+||++.+......          
T Consensus        32 ~~~~~~~~~~~~~~~~~~~~~~~l~--~~~~H~~~V~~l~fs~dg~~lasg~-d~~i~iW~~~~~~~~~~~~~~~~~~~~  108 (388)
T d1erja_          32 LKKQTNDYYILYNPALPREIDVELH--KSLDHTSVVCCVKFSNDGEYLATGC-NKTTQVYRVSDGSLVARLSDDSAANKD  108 (388)
T ss_dssp             SEEECSSCEEEECTTSCCCEEEEEE--EEEECSSCCCEEEECTTSSEEEEEC-BSCEEEEETTTCCEEEEECC-------
T ss_pred             CCCCCCCCEEEECCCCCCCEEEEEE--EECCCCCCEEEEEECCCCCEEEEEE-CCEEEEEEECCCCEEEEECCCCCCCCC
T ss_conf             2468897089868877762054107--6079999689999999999999994-994899981364057663166544324


Q ss_pred             -CCCCCEEEECCCCCEEEEEEECCCCCEEEEEECCCCEEEEECCCCEEEEEECCCCCCEEEEEEECCCCCEEEEEECCCC
Q ss_conf             -4113417723589813899817899969996079829999868872889812478749999980399999999949994
Q 002801          606 -DIHYPVVEMASRSKLSSICWNSYIKSQIASSNFEGVVQVWDVSRSQVLTEMREHERRVWSIDFSSADPTLLASGSDDGS  684 (879)
Q Consensus       606 -~~~~~~~~~~~~~~I~~i~~~~~~~~~l~s~~~dg~V~iwd~~t~~~~~~~~~h~~~V~si~fsp~~~~~lasgs~Dg~  684 (879)
                       ..........+...|.+++|+|. +.+|++++.||.|++||..+++....+.+|...|+++.+++ ++..+++|+.++.
T Consensus       109 ~~~~~~~~~~~~~~~V~~l~~s~~-~~~l~s~~~dg~v~i~~~~~~~~~~~~~~h~~~v~~~~~~~-~~~~~~~~~~~~~  186 (388)
T d1erja_         109 PENLNTSSSPSSDLYIRSVCFSPD-GKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFP-SGDKLVSGSGDRT  186 (388)
T ss_dssp             ----------CCCCBEEEEEECTT-SSEEEEEETTSCEEEEETTTTEEEEEECCCSSCEEEEEECT-TSSEEEEEETTSE
T ss_pred             CCCCCCCCCCCCCCCEEEEEECCC-CCCCEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCEE
T ss_conf             432111014677898899998899-98012134441111211111111111111111111101111-1111112221015


Q ss_pred             EEEEECCCCCEEEEEECCCCEEEEEEECCCCCEEEEEECCCEEEEEECCCCCEEEEE-------ECCCCCCEEEEEEC-C
Q ss_conf             999969999148899539966999962899979999967991999985799600699-------81578878999974-9
Q 002801          685 VKLWSINQGVSIGTIKTKANVCCVQFPLDSGRSLAFGSADHRIYYYDLRNSKIPLCT-------LIGHNKTVSYVKFV-D  756 (879)
Q Consensus       685 V~iwD~~~~~~i~~~~~~~~v~~v~~~p~~~~~l~tgs~D~~I~iwDl~~~~~~~~~-------~~~h~~~V~~i~fs-~  756 (879)
                      +++||..+.........+....++.+.+.+++++++|+.|+.|++||.++... ...       ..+|...|+++.|+ +
T Consensus       187 i~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~d~~i~i~~~~~~~~-~~~~~~~~~~~~~h~~~v~~l~~s~~  265 (388)
T d1erja_         187 VRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFL-VERLDSENESGTGHKDSVYSVVFTRD  265 (388)
T ss_dssp             EEEEETTTTEEEEEEECSSCEEEEEECSTTCCEEEEEETTSCEEEEETTTCCE-EEEEC------CCCSSCEEEEEECTT
T ss_pred             EEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEECCCCEEEEEECCCCCC-CEEECCCCCCCCCCCCCEEEEEECCC
T ss_conf             65410111111000012454421123688787589973898199963455730-00102443334577898789999799


Q ss_pred             CCEEEEEECCCCEEEEECCCCCCC------CCCCCEEEEECCCCCEEEEEEECCCCEEEEEECCCCEEEEECCCCCCCEE
Q ss_conf             988999976990999956999645------56876079718788679999931999999992999199982599997200
Q 002801          757 ATTLVSASTDNTLKLWDLSMCTSR------VIDTPLHSFTGHTNVKNFVGLSVWDGYVATGSETNEVFVYHKAFPMPALS  830 (879)
Q Consensus       757 ~~~l~sgs~D~~i~iwd~~~~~~~------~~~~~~~~~~~h~~~v~~v~~sp~~~~lasgs~Dg~v~iw~~~~~~~~~~  830 (879)
                      +.+|++++.|+.|++||+......      ....+......|...+.+++|+|++.+|++|+.||.|++|++..++++..
T Consensus       266 ~~~l~s~~~d~~i~iwd~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~s~~~~~l~sg~~dg~i~vwd~~~~~~~~~  345 (388)
T d1erja_         266 GQSVVSGSLDRSVKLWNLQNANNKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKKSGNPLLM  345 (388)
T ss_dssp             SSEEEEEETTSEEEEEEC---------------CEEEEEECCSSCEEEEEECGGGCEEEEEETTSEEEEEETTTCCEEEE
T ss_pred             CCEEEEEECCCCEEEEECCCCCCCCCCCCCCCCCEEEECCCCCCEEEEEEECCCCCEEEEEECCCEEEEEECCCCCEEEE
T ss_conf             99999997899289875157764321013444200110124553278999889999999996989799999999969999


Q ss_pred             CCCCCCCCCCCCCCCCCCCCEEEEEE------ECCCCCEEEEEECCCCEEEEEE
Q ss_conf             03479999999987878997999999------0799939999937984999991
Q 002801          831 FNFNHADPLSGPETDDAAQFISSVCW------RGQSSNTLVAANSSGNIKILEM  878 (879)
Q Consensus       831 ~~~~~~~~~~~~~~~~h~~~V~~v~~------~p~~~~~l~s~~~Dg~I~iw~l  878 (879)
                      ++             +|.+.|.+++|      +|++. +|++|+.||.|+||++
T Consensus       346 l~-------------~H~~~V~~~~~~~~~~~spd~~-~l~s~s~Dg~I~iW~~  385 (388)
T d1erja_         346 LQ-------------GHRNSVISVAVANGSSLGPEYN-VFATGSGDCKARIWKY  385 (388)
T ss_dssp             EE-------------CCSSCEEEEEECSSCTTCTTCE-EEEEEETTSEEEEEEE
T ss_pred             EE-------------CCCCCEEEEEEECCCCCCCCCC-EEEEEECCCEEEEEEE
T ss_conf             96-------------8899789999846742589999-9999918997999762
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1j7la_ d.144.1.6 (A:) Type IIIa 3',5"-aminoglycoside phosphotransferase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nd4a_ d.144.1.6 (A:) Aminoglycoside 3'-phosphotransferase IIa (Kanamycin kinase) {Bacteria (Klebsiella pneumoniae) [TaxId: 573]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d2ppqa1 d.144.1.6 (A:5-320) Homoserine kinase ThrB {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1zyla1 d.144.1.6 (A:4-328) RdoA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pula1 d.144.1.6 (A:5-396) Methylthioribose kinase MtnK {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1xipa_ b.69.14.1 (A:) Nucleoporin NUP159 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]} Back     information, alignment and structure
>d1nw1a_ d.144.1.8 (A:) Choline kinase {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure