Citrus Sinensis ID: 002972

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860--
MDALQVVSAATQIVTSMVGAVHALEQASRNLDEAPKRIRSLEDFVCDLENLMRRIKQKHAYKLHNPQLDHQLKSLNSLIERLHPKIRKARRMVSKSKIKNLAHVVWTSMAGDPLRKLLNSINDDLNWWLESQILAQNVEKVIELTAQEVPTRLKVKAEQGYPISSKSKFLRKLLEQEETHQVILIVGLSGIGKSCLARQVASDPPERFVGGAVELGFGQWCSRAACNGSKSDYQKRLARKISKFLVQIGFWKKIKDENSDLEYLCCLLQEALYGKSILILLDDVWEQDIVERFAKLYDNDCKYLVTTRNEAVYEITEAEKVELSKDDIMEISKSILLYHSLLAEEELPAAAESLLERCGHHPLTVAVMGKALRKELRSEKWEKAITDLSTFATCAPGPVSYVNEKEAENTLTIFGSFEFSLEAMPRDSRRLFIALAALSWAEPVPEACLEAIWSILVQKSLFSLAVCKLVEGSLLMKDDTDPLYQVHDMVSLYLDSKTNDSIQMLINGLKAEEIAFICPWFLIFGKENIKNIAEEKVELSLSVSEEKLVIITIEAILQALMASKSISELEVSRICFSGILGPRIADLISRDSQSLTVVSAEAITNIFSKGDYCSYIPSLETTGAVDKLAGLLQKSEDPMIQTDILTVLTKLAEFGTPETVDKVLQSIPFDKLATLLSYDAKEWHENMFTILMSLAKVGKSKAVEKMFAFEIDKNLIKLLENGSEVVQHHAIVTLKAFYELAGSPANASLRPANLNLLPWQVRLRLERFIISDRTVPPSPKSQTFEDVIHRLLDGDNKQVQGATQDLIPFLEKAGGEPCIKKFLEYDIIPELVKMMQCCVPEIQDSAYAAPDVLQQWWTTCLG
cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccHHHHHHHHHcccccccEEEEEccccccHHHHHHHHHccccccccccccccccccEEEccEEccccccHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHcccEEEEEEcccccHHHHHHHHcccccccEEEEEEccHHHHHHcccccccccHHHHHHHHHHHHccccccccccHHHHHHHHHHHccccHHHHHHHHHHHcccccHHHHHHHHHHHcccccccccccccccHHHccccccHHHHHHcccccccHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEccccccEEEcHHHHHHHHHHHHHHHHHHHcccccccccccccEEEEcccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHcccccccccHHHHHHHHHHccccccccccccccccHHHHHHHccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHcccccEEEEcccccccccccccHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccHHHHHHHHcccHHHHHHHHHcccccccccccccHHHHHHHHHHHcc
cHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEccccccccccHHHHHHHHHcccccccEEEEEccccccHHHHHHHHHccccHHccccEEEEEEEEEEEEEEEEccccHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHccccEEEEEEccccHHHHHHHHcccccccEEEEEEccHHHHHHHccccccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHcccHHHccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHccHHHHHHHHHHHccEEEccccccEEEEHHHHHHHHHHHcHHHHHHHHccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccHHHHHccccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHcHHHHHHHHHcccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHccHHHHHHHcccccHHHHHHHHHHHHHHHHHccHHHHHHHHHccHHHHHHHHHccccHHHHHHHHHHHHHHHHHccccccccccccHHcccccEEEEEEEEEEEEcccccccccccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHcHHHHHHHHHHccHHHHHHHHHHcHHHHHHHHHHHcc
MDALQVVSAATQIVTSMVGAVHALEQASRNLDEAPKRIRSLEDFVCDLENLMRRIKQKHayklhnpqldHQLKSLNSLIERLHPKIRKARRMVSKSKIKNLAHVVWTSMAGDPLRKLLNSINDDLNWWLESQILAQNVEKVIELTAQEVPTRLKvkaeqgypissKSKFLRKLLEQEETHQVILIVGLSGIGKSCLarqvasdpperfvggavelgfgqwcsraacngskSDYQKRLARKISKFLVQIGFWKKIKDENSDLEYLCCLLQEALYGKSILILLDDVWEQDIVERFAKLYDNDCKYLVTTRNEAVYEITEAEKVELSKDDIMEISKSILLYHSLLAEEELPAAAESLLErcghhpltVAVMGKALRKELRSEKWEKAITDLstfatcapgpvsyvnekeaentltifgsfefsleamprDSRRLFIALAAlswaepvpEACLEAIWSILVQKSLFSLAVCKLVegsllmkddtdplyqvHDMVSLYLDSKTNDSIQMLINGLKAEEIAFICPWFLIFGKENIKNIAEEKVELSLSVSEEKLVIITIEAILQALMASKSISELEVSRIcfsgilgpriadlisrdsqslTVVSAEAITNIfskgdycsyipslettGAVDKLAGLlqksedpmiqTDILTVLTKlaefgtpetvdkvlqsipfdklaTLLSYDAKEWHENMFTILMSLAKVGKSKAVEKMFAFEIDKNLIKLLENGSEVVQHHAIVTLKAFYElagspanaslrpanlnllPWQVRLRLERFIisdrtvppspksqtFEDVIHRLLdgdnkqvqgATQDLIPFlekaggepcikkfLEYDIIPELVKMMQCCvpeiqdsayaapdVLQQWWTTCLG
MDALQVVSAATQIVTSMVGAVHALEQAsrnldeapkrIRSLEDFVCDLENLMRRIKQKHayklhnpqldhQLKSLNSLIERLHPKIRKARRMVSKSKIKNLAHVVWTSMAGDPLRKLLNSINDDLNWWLESQILAQNVEKVIELTaqevptrlkvkaeqgypissKSKFLRKLLEQEETHQVILIVGLSGIGKSCLARQVASDPPERFVGGAVELGFGQWCSRAACNGSKSDYQKRLARKISKFLVQIGFWKKIKDENSDLEYLCCLLQEALYGKSILILLDDVWEQDIVERFAklydndckylVTTRneavyeiteaekvelskddIMEISKSILLYHSLLAEEELPAAAESLLERCGHHPLTVAVMGKALRKELRSEKWEKAITDLSTFATCAPGPVSYVNEKEAENTLTIFGSFEFSLEAMPRDSRRLFIALAALSWAEPVPEACLEAIWSILVQKSLFSLAVCKLVEGSLLMKDDTDPLYQVHDMVSLYLDSKTNDSIQMLINGLKAEEIAFICPWFLIFGKENIKNIAEEKVELSLSVSEEKLVIITIEAILQALMASKSISELEVSRICFSGILGPRIADLISRDSQSLTVVSAEAITNIFSKGDYCSYIPSLETTGAVDKLAGLLQKSEDPMIQTDILTVLTKLAEFGTPETVDKVLQSIPFDKLATLLSYDAKEWHENMFTILMSLAKVGKSKAVEKMFAFEIDKNLIKLLENGSEVVQHHAIVTLKAFYELAGSPANASLRPANLNLLPWQVRLRLERFIisdrtvppspksqTFEDVIHRLLDGDNKQVQGATQDLIPFLEKAGGEPCIKKFLEYDIIPELVKMMQCCVPEIQDSAYAAPDVLQQWWTTCLG
MDALQVVSAATQIVTSMVGAVHALEQASRNLDEAPKRIRSLEDFVCDLENLMRRIKQKHAYKLHNPQLDHQLKSLNSLIERLHPKIRKARRMVSKSKIKNLAHVVWTSMAGDPLRKLLNSINDDLNWWLESQILAQNVEKVIELTAQEVPTRLKVKAEQGYPISSKSKFLRKLLEQEETHQVILIVGLSGIGKSCLARQVASDPPERFVGGAVELGFGQWCSRAACNGSKSDYQKRLARKISKFLVQIGFWKKIKDENSDLEYLCCLLQEALYGKSILILLDDVWEQDIVERFAKLYDNDCKYLVTTRNEAVYEITEAEKVELSKDDIMEISKSILLYHsllaeeelpaaaeslleRCGHHPLTVAVMGKALRKELRSEKWEKAITDLSTFATCAPGPVSYVNEKEAENTLTIFGSFEFSLEAMPRDSRRLFIALAALSWAEPVPEACLEAIWSILVQKSLFSLAVCKLVEGSLLMKDDTDPLYQVHDMVSLYLDSKTNDSIQMLINGLKAEEIAFICPWFLIFGKENIKNIAeekvelslsvseeklvIITIEAILQALMASKSISELEVSRICFSGILGPRIADLISRDSQSLTVVSAEAITNIFSKGDYCSYIPSLETTGAVDKLAGLLQKSEDPMIQTDILTVLTKLAEFGTPETVDKVLQSIPFDKLATLLSYDAKEWHENMFTILMSLAKVGKSKAVEKMFAFEIDKNLIKLLENGSEVVQHHAIVTLKAFYELAGSPANASLRPANLNLLPWQVRLRLERFIISDRTVPPSPKSQTFEDVIHRLLDGDNKQVQGATQDLIPFLEKAGGEPCIKKFLEYDIIPELVKMMQCCVPEIQDSAYAAPDVLQQWWTTCLG
******VSAATQIVTSMVGAVHAL*************IRSLEDFVCDLENLMRRIKQKHAYKLHNPQLDHQLKSLNSLIERLHPKIRKARRMVSKSKIKNLAHVVWTSMAGDPLRKLLNSINDDLNWWLESQILAQNVEKVIELTAQEVPTRLKVKAEQGYPISSKSKFLRKLLEQEETHQVILIVGLSGIGKSCLARQVASDPPERFVGGAVELGFGQWCSRAACNGSKSDYQKRLARKISKFLVQIGFWKKIKDENSDLEYLCCLLQEALYGKSILILLDDVWEQDIVERFAKLYDNDCKYLVTTRNEAVYEITEAEKVELSKDDIMEISKSILLYHSLLAEEELPAAAESLLERCGHHPLTVAVMGKALRKELRSEKWEKAITDLSTFATCAPGPVSYVNEKEAENTLTIFGSFEFSLEAMPRDSRRLFIALAALSWAEPVPEACLEAIWSILVQKSLFSLAVCKLVEGSLLMKDDTDPLYQVHDMVSLYLDSKTNDSIQMLINGLKAEEIAFICPWFLIFGKENIKNIAEEKVELSLSVSEEKLVIITIEAILQALMASKSISELEVSRICFSGILGPRIADLISRDSQSLTVVSAEAITNIFSKGDYCSYIPSLETTGAVDKLAGLLQKSEDPMIQTDILTVLTKLAEFGTPETVDKVLQSIPFDKLATLLSYDAKEWHENMFTILMSLAKVGKSKAVEKMFAFEIDKNLIKLLENGSEVVQHHAIVTLKAFYELAGSPANASLRPANLNLLPWQVRLRLERFIISDR**********FEDVIHRLLDGDNKQVQGATQDLIPFLEKAGGEPCIKKFLEYDIIPELVKMMQCCVPEIQDSAYAAPDVLQQWWTTCL*
MDALQVVSAATQIVTSMVGAVHALEQASRNLDEAPKRIRSLEDFVCDLENLMRRIKQKHAYKLHNPQLDHQLKSLNSLIERLHPKIRKA**************VVWTSMA*********SIND*************************************YPISSKSKFLRKLLEQEETHQVILIVGLSGIGKSCLARQVASDPPERFVGGAVELGFGQWCSRAACNGSKSDYQKRLARKISKFLV****************YLCCLLQEALYGKSILILLDDVWEQDIVERFAKLYDNDCKYLVTTRNEAVYEITEAEKVELSKDDIMEISKSILLYHSLLAEEELPAAAESLLERCGHHPLTVAVMGKALRKELRSEKWEKAITDLSTFATCAPGPVSYVNEKEAENTLTIFGSFEFSLEAMPRDSRRLFIALAALSWAEPVPEACLEAIWSILVQKSLFSLAVCKLVEGSLLMKDDTDPLYQVHDMVSLYLDSKTNDSIQMLI*************WFLIFGKENI**IAEEKVELSLSVSEEKLVIITIEAILQALMASKSISELEVSRICFSGILGPRIADLISRDSQSLTVVSAEAITNIFSKGDYCSYIPSLETTGAVDKLAGLLQKSEDPMIQTDILTVLTKLAEFGTPETVDKVLQSIPFDKLATLLSYDAKEWHENMFTILMSLAKVGKSKAVEKMFAFEIDKNLIKLLEN*SEVVQHHAIVTLKAFYELAGSPANASLRPANLNLLPWQVRLRLERFIISDRTVPPSPKSQTFEDVIHRLLDGDNKQVQGATQDLIPFLEKAGGEPCIKKFLEYDIIPELVKMMQCCVPEIQDSAYAAPDVLQQWWTTCLG
********AATQIVTSMVGAVHALEQASRNLDEAPKRIRSLEDFVCDLENLMRRIKQKHAYKLHNPQLDHQLKSLNSLIERLHPKIRKARRMVSKSKIKNLAHVVWTSMAGDPLRKLLNSINDDLNWWLESQILAQNVEKVIELTAQEVPTRLKVKAEQGYPISSKSKFLRKLLEQEETHQVILIVGLSGIGKSCLARQVASDPPERFVGGAVELGFGQWCSRAACNGSKSDYQKRLARKISKFLVQIGFWKKIKDENSDLEYLCCLLQEALYGKSILILLDDVWEQDIVERFAKLYDNDCKYLVTTRNEAVYEITEAEKVELSKDDIMEISKSILLYHSLLAEEELPAAAESLLERCGHHPLTVAVMGKALRKELRSEKWEKAITDLSTFATCAPGPVSYVNEKEAENTLTIFGSFEFSLEAMPRDSRRLFIALAALSWAEPVPEACLEAIWSILVQKSLFSLAVCKLVEGSLLMKDDTDPLYQVHDMVSLYLDSKTNDSIQMLINGLKAEEIAFICPWFLIFGKENIKNIAEEKVELSLSVSEEKLVIITIEAILQALMASKSISELEVSRICFSGILGPRIADLISRDSQSLTVVSAEAITNIFSKGDYCSYIPSLETTGAVDKLAGLLQKSEDPMIQTDILTVLTKLAEFGTPETVDKVLQSIPFDKLATLLSYDAKEWHENMFTILMSLAKVGKSKAVEKMFAFEIDKNLIKLLENGSEVVQHHAIVTLKAFYELAGSPANASLRPANLNLLPWQVRLRLERFIISDRTVPPSPKSQTFEDVIHRLLDGDNKQVQGATQDLIPFLEKAGGEPCIKKFLEYDIIPELVKMMQCCVPEIQDSAYAAPDVLQQWWTTCLG
MDALQVVSAA*QIVTSMVGAVHALEQASRNLDEAPKRIRSLEDFVCDLENLMRRIKQKHAYKLHNPQLDHQLKSLNSLIERLHPKIRKARRMVSKSKIKNLAHVVWTSMAGDPLRKLLNSINDDLNWWLESQILAQNVEKVIELTAQEVPTRLKVKAEQGYPISSKSKFLRKLLEQEETHQVILIVGLSGIGKSCLARQVASDPPERFVGGAVELGFGQWCSRAACNGSKSDYQKRLARKISKFLVQIGFWKKIKDENSDLEYLCCLLQEALYGKSILILLDDVWEQDIVERFAKLYDNDCKYLVTTRNEAVYEITEAEKVELSKDDIMEISKSILLYHSLLAEEELPAAAESLLERCGHHPLTVAVMGKALRKELRSEKWEKAITDLSTFATCAPGPVSYVNEKEAENTLTIFGSFEFSLEAMPRDSRRLFIALAALSWAEPVPEACLEAIWSILVQKSLFSLAVCKLVEGSLLMKDDTDPLYQVHDMVSLYLDSKTNDSIQMLINGLKAEEIAFICPWFLIFGKENIKNIAEEKVELSLSVSEEKLVIITIEAILQALMASKSISELEVSRICFSGILGPRIADLISRDSQSLTVVSAEAITNIFSKGDYCSYIPSLETTGAVDKLAGLLQKSEDPMIQTDILTVLTKLAEFGTPETVDKVLQSIPFDKLATLLSYDAKEWHENMFTILMSLAKVGKSKAVEKMFAFEIDKNLIKLLENGSEVVQHHAIVTLKAFYELAGSPANASLRPANLNLLPWQVRLRLERFIISDRTVPPSPKSQTFEDVIHRLLDGDNKQVQGATQDLIPFLEKAGGEPCIKKFLEYDIIPELVKMMQCCVPEIQDSAYAAPDVLQQWWTTCLG
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDALQVVSAATQIVTSMVGAVHALEQASRNLDEAPKRIRSLEDFVCDLENLMRRIKQKHAYKLHNPQLDHQLKSLNSLIERLHPKIRKARRMVSKSKIKNLAHVVWTSMAGDPLRKLLNSINDDLNWWLESQILAQNVEKVIELTAQEVPTRLKVKAEQGYPISSKSKFLRKLLEQEETHQVILIVGLSGIGKSCLARQVASDPPERFVGGAVELGFGQWCSRAACNGSKSDYQKRLARKISKFLVQIGFWKKIKDENSDLEYLCCLLQEALYGKSILILLDDVWEQDIVERFAKLYDNDCKYLVTTRNEAVYEITEAEKVELSKDDIMEISKSILLYHSLLAEEELPAAAESLLERCGHHPLTVAVMGKALRKELRSEKWEKAITDLSTFATCAPGPVSYVNEKEAENTLTIFGSFEFSLEAMPRDSRRLFIALAALSWAEPVPEACLEAIWSILVQKSLFSLAVCKLVEGSLLMKDDTDPLYQVHDMVSLYLDSKTNDSIQMLINGLKAEEIAFICPWFLIFGKENIKNIAEEKVELSLSVSEEKLVIITIEAILQALMASKSISELEVSRICFSGILGPRIADLISRDSQSLTVVSAEAITNIFSKGDYCSYIPSLETTGAVDKLAGLLQKSEDPMIQTDILTVLTKLAEFGTPETVDKVLQSIPFDKLATLLSYDAKEWHENMFTILMSLAKVGKSKAVEKMFAFEIDKNLIKLLENGSEVVQHHAIVTLKAFYELAGSPANASLRPANLNLLPWQVRLRLERFIISDRTVPPSPKSQTFEDVIHRLLDGDNKQVQGATQDLIPFLEKAGGEPCIKKFLEYDIIPELVKMMQCCVPEIQDSAYAAPDVLQQWWTTCLG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query862 2.2.26 [Sep-21-2011]
Q9LQ54870 Probable disease resistan no no 0.279 0.277 0.244 1e-08
Q9I9H8 1261 Apoptotic protease-activa yes no 0.367 0.251 0.242 2e-08
O04093727 Putative inactive disease no no 0.264 0.313 0.227 8e-08
Q8W3K0 1138 Probable disease resistan no no 0.279 0.211 0.261 8e-08
A9QGV6910 Inactive disease suscepti no no 0.264 0.250 0.227 2e-07
A7XGN8910 Disease susceptibility pr no no 0.264 0.250 0.231 2e-07
Q9FJB5901 Disease resistance RPP8-l no no 0.283 0.270 0.244 2e-07
Q42484909 Disease resistance protei no no 0.302 0.287 0.241 3e-07
P60838894 Probable disease resistan no no 0.240 0.231 0.240 4e-07
O64789925 Probable disease resistan no no 0.266 0.248 0.230 5e-07
>sp|Q9LQ54|DRL12_ARATH Probable disease resistance protein At1g59620 OS=Arabidopsis thaliana GN=At1g59620 PE=2 SV=3 Back     alignment and function desciption
 Score = 62.8 bits (151), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 71/290 (24%), Positives = 128/290 (44%), Gaps = 49/290 (16%)

Query: 168 KFLRKLLEQEETHQVILIVGLSGIGKSCLARQVASDPPERFVGGAVELGFGQ--WCSRAA 225
           K +  L+E E++ QV+ I G+ GIGK+ LARQV       F    V+  F Q  W     
Sbjct: 148 KLVGHLVEVEDSSQVVSITGMGGIGKTTLARQV-------FNHETVKSHFAQLAW----V 196

Query: 226 CNGSKSDYQKRLARKISKFLVQIGFWKKIKDENSDLEYLCCLLQEALY----GKSILILL 281
           C          ++++ ++  V     +K+  E   LE     LQE L+     +  LI+L
Sbjct: 197 C----------VSQQFTRKYVWQTILRKVGPEYIKLEMTEDELQEKLFRLLGTRKALIVL 246

Query: 282 DDVWEQ---DIVERFAKLYDNDCKYLVTTRNEAVYEITEAEKVELSKDDIMEISKSILLY 338
           DD+W +   D++E    L     K L+T+RNE V  +       + K D +   +S  ++
Sbjct: 247 DDIWREEDWDMIEPIFPL-GKGWKVLLTSRNEGV-ALRANPNGFIFKPDCLTPEESWTIF 304

Query: 339 HSLL----------AEEELPAAAESLLERCGHHPLTVAVMGKALRKELRSEKWEKAITDL 388
             ++           +E++    + +++ CG  PL + V+G  L      ++W++   ++
Sbjct: 305 RRIVFPGENTTEYKVDEKMEELGKQMIKHCGGLPLALKVLGGLLVVHFTLDEWKRIYGNI 364

Query: 389 STFATCAPGPVSYVNEKEAENTLTIFGSFEFSLEAMPRDSRRLFIALAAL 438
            +      G  S+ N+K   N  +++     S E +P   +  F+ LA  
Sbjct: 365 KSHIV---GGTSF-NDK---NMSSVYHILHLSFEELPIYLKHCFLYLAQF 407
Probable disease resistance protein.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9I9H8|APAF_DANRE Apoptotic protease-activating factor 1 OS=Danio rerio GN=apaf1 PE=2 SV=1 Back     alignment and function description
>sp|O04093|LOV1A_ARATH Putative inactive disease susceptibility protein LOV1 OS=Arabidopsis thaliana GN=LOV1 PE=5 SV=3 Back     alignment and function description
>sp|Q8W3K0|DRL9_ARATH Probable disease resistance protein At1g58602 OS=Arabidopsis thaliana GN=At1g58602 PE=2 SV=1 Back     alignment and function description
>sp|A9QGV6|LOV1C_ARATH Inactive disease susceptibility protein LOV1 OS=Arabidopsis thaliana GN=LOV1 PE=3 SV=1 Back     alignment and function description
>sp|A7XGN8|LOV1B_ARATH Disease susceptibility protein LOV1 OS=Arabidopsis thaliana GN=LOV1 PE=1 SV=1 Back     alignment and function description
>sp|Q9FJB5|RP8L3_ARATH Disease resistance RPP8-like protein 3 OS=Arabidopsis thaliana GN=RPP8L3 PE=2 SV=1 Back     alignment and function description
>sp|Q42484|RPS2_ARATH Disease resistance protein RPS2 OS=Arabidopsis thaliana GN=RPS2 PE=1 SV=1 Back     alignment and function description
>sp|P60838|DRL1_ARATH Probable disease resistance protein At1g12280 OS=Arabidopsis thaliana GN=At1g12280 PE=3 SV=1 Back     alignment and function description
>sp|O64789|DRL18_ARATH Probable disease resistance protein At1g61310 OS=Arabidopsis thaliana GN=At1g61310 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query862
224058687 1043 NBS resistance protein [Populus trichoca 0.984 0.813 0.719 0.0
359482679 1046 PREDICTED: uncharacterized protein LOC10 0.984 0.811 0.718 0.0
147862186 1076 hypothetical protein VITISV_020212 [Viti 0.979 0.784 0.719 0.0
224073738 1047 NBS resistance protein [Populus trichoca 0.984 0.810 0.704 0.0
357139876 1042 PREDICTED: uncharacterized protein LOC10 0.983 0.813 0.547 0.0
46390095 1040 hypothetical protein [Oryza sativa Japon 0.983 0.815 0.550 0.0
297598787 1078 Os02g0203500 [Oryza sativa Japonica Grou 0.983 0.786 0.550 0.0
413926182 1041 hypothetical protein ZEAMMB73_778765 [Ze 0.983 0.814 0.542 0.0
125538532 1036 hypothetical protein OsI_06295 [Oryza sa 0.889 0.740 0.550 0.0
242064446 1017 hypothetical protein SORBIDRAFT_04g00710 0.950 0.805 0.511 0.0
>gi|224058687|ref|XP_002299603.1| NBS resistance protein [Populus trichocarpa] gi|222846861|gb|EEE84408.1| NBS resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score = 1320 bits (3416), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 645/897 (71%), Positives = 745/897 (83%), Gaps = 48/897 (5%)

Query: 1   MDALQVVSAATQIVTSMVGAVHALEQASRNLDEAPKRIRSLEDFVCDLENLMRRIKQKHA 60
           M+ALQV+S+ATQI++SMVGAV AL+QASRNLDEAPKRIRSLE+FV DLENL R I+QKH 
Sbjct: 1   MEALQVISSATQIISSMVGAVSALDQASRNLDEAPKRIRSLEEFVYDLENLTRGIRQKHV 60

Query: 61  YKLHNPQLDHQLKSLNSLIERLHPKIRKARRMVSKSKIKNLAHVVWTSMAGDPLRKLLNS 120
           YKLHNPQLDHQ++SLN+LIERL P I KARR+VS+S+IKNLA VVW+SMAGDPL KL+N+
Sbjct: 61  YKLHNPQLDHQIQSLNALIERLRPNITKARRIVSRSRIKNLAKVVWSSMAGDPLSKLINT 120

Query: 121 INDDLNWWLESQILAQNVEKVIELTAQEVPTRLKVKAEQGYPISSKSKFLRKLLEQEETH 180
           I DDLNWWLESQ L Q+V+KVIE TAQ+VP RLK+K EQG+P+SSK  F+R LLEQE++H
Sbjct: 121 IRDDLNWWLESQRLTQHVQKVIESTAQDVPVRLKIKIEQGWPLSSKCHFVRNLLEQEDSH 180

Query: 181 QVILIVGLSGIGKSCLARQVASDPPERFVGGAVELGFGQWCSRAACNGSKSDYQKRLARK 240
           +VILIVGLSGIGKSCLARQVAS+PP +FVGGAVELGFGQWCSR ACNG+K +YQ+RLARK
Sbjct: 181 RVILIVGLSGIGKSCLARQVASNPPTKFVGGAVELGFGQWCSRNACNGNKDEYQRRLARK 240

Query: 241 ISKFLVQIGFWKKIKDENS-DLEYLCCLLQEALYGKSILILLDDVWEQDIVERFAKLYDN 299
           IS FLVQIGFWKKIKDENS DLEY+CC+LQEALYGKSI+ILLDDVWEQDIVERFAKLYDN
Sbjct: 241 ISNFLVQIGFWKKIKDENSGDLEYVCCILQEALYGKSIVILLDDVWEQDIVERFAKLYDN 300

Query: 300 DCKYLVTTRNEAVYEITEAEKVELSKDDIMEISKSILLYHSLLAEEELPAAAESLLERCG 359
           DCKYLVTTRNEAV EITEAEKVELSKDD  EISK+IL YHSLL  EELP  AE+LLERCG
Sbjct: 301 DCKYLVTTRNEAVCEITEAEKVELSKDDTREISKAILQYHSLLGMEELPGIAETLLERCG 360

Query: 360 HHPLTVAVMGKALRKELRSEKWEKAITDLSTFATCAPGPVSYVNEKEAENTLTIFGSFEF 419
           HHPLTVAVMGKALRKE+R+EKWEKAIT+LSTFATCAPGPVSYVNEKEAE+TLTIFGSFEF
Sbjct: 361 HHPLTVAVMGKALRKEVRAEKWEKAITNLSTFATCAPGPVSYVNEKEAESTLTIFGSFEF 420

Query: 420 SLEAMPRDSRRLFIALAALSWAEPVPEACLEAIWSILVQKSLFSLAVCKLVEGSLLMKDD 479
           SLEAMPRDS+RLFIALA+LSWAEPVPEACLEA+WS++  +SLF L VCKLVEGSLL+K D
Sbjct: 421 SLEAMPRDSKRLFIALASLSWAEPVPEACLEAVWSVIGDESLFPLIVCKLVEGSLLIKTD 480

Query: 480 TDPLYQVHDMVSLYLDSKTNDSIQMLINGLKAEEIAFICPWFLIFGKENIKNIAEEKVEL 539
            DPLY VHDMVSLYL SK +DS ++L+N    +E AFICPW LIFGKEN+K IAEE++E 
Sbjct: 481 MDPLYLVHDMVSLYLASKADDSTEILLNEYSPDETAFICPWLLIFGKENVKKIAEERMEF 540

Query: 540 SLSVSEEKLVIITIEAILQALMASKSISELEVSRICFSGILGPRIADLISRDSQSLTVVS 599
             +V E K V+ T+EA++ ALMASKS+SELEVSR  FS ILGPRIADLIS DS SL  V+
Sbjct: 541 LFNVLEGKQVVTTLEALIHALMASKSMSELEVSREKFSRILGPRIADLISTDSLSLIAVT 600

Query: 600 AEAITNIFSKGDYCSYIPSLETTGAVDKLAGLLQK-SEDPMIQTDILTVLTKLAEFGTPE 658
            EAITNIFSK DYC+Y PSLETTGA+++LA  L+   E+P+ Q  IL VL KLAEFG+P 
Sbjct: 601 TEAITNIFSKSDYCNYFPSLETTGAINRLATTLEYCEENPITQIHILIVLAKLAEFGSPG 660

Query: 659 TVDKVLQSIPFDKLATLLSYDAKEWHENMFTILMSLAKVGKSKAVEKMFAFEIDKNLIKL 718
           TVDKVL SIPF++LA LLS  A++WHE+MFT+L SL K GKS AVE+MFA  I+K LIKL
Sbjct: 661 TVDKVLDSIPFNQLADLLSSSAEKWHESMFTVLNSLTKAGKSNAVERMFASGIEKKLIKL 720

Query: 719 LENGSEVVQHHAIVTLKAFYELAGSPANASLRPANLNLLPWQVRLRLERFIISDRTVPPS 778
           LENGSEV+QHHAIVTLK FYE+A +P N SL+P+NLNLLPWQVR RLE F++SDRTVP S
Sbjct: 721 LENGSEVLQHHAIVTLKGFYEVARTPENVSLQPSNLNLLPWQVRHRLETFVLSDRTVPHS 780

Query: 779 PKSQTFEDVIHRLLDGDNKQVQGATQDLIPFLEK-------------------------- 812
           PK  +FED+++++LDG+ +QV  A QDLIP +EK                          
Sbjct: 781 PKPLSFEDLVYKVLDGNKRQVLQAMQDLIPIIEKSADSRVREMILHSPLVNRLSELLQSR 840

Query: 813 --------------------AGGEPCIKKFLEYDIIPELVKMMQCCVPEIQDSAYAA 849
                               +GGEPCIKKFL++DI+PELVKMMQC V E+QDSAY A
Sbjct: 841 HSEHNSIRSESAFLLMKLAFSGGEPCIKKFLDHDIVPELVKMMQCNVVELQDSAYTA 897

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359482679|ref|XP_003632806.1| PREDICTED: uncharacterized protein LOC100261821 [Vitis vinifera] gi|297743414|emb|CBI36281.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147862186|emb|CAN82596.1| hypothetical protein VITISV_020212 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224073738|ref|XP_002304149.1| NBS resistance protein [Populus trichocarpa] gi|222841581|gb|EEE79128.1| NBS resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357139876|ref|XP_003571502.1| PREDICTED: uncharacterized protein LOC100841952 [Brachypodium distachyon] Back     alignment and taxonomy information
>gi|46390095|dbj|BAD15512.1| hypothetical protein [Oryza sativa Japonica Group] gi|46390511|dbj|BAD15999.1| hypothetical protein [Oryza sativa Japonica Group] gi|125581217|gb|EAZ22148.1| hypothetical protein OsJ_05811 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|297598787|ref|NP_001046239.2| Os02g0203500 [Oryza sativa Japonica Group] gi|255670696|dbj|BAF08153.2| Os02g0203500 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|413926182|gb|AFW66114.1| hypothetical protein ZEAMMB73_778765 [Zea mays] Back     alignment and taxonomy information
>gi|125538532|gb|EAY84927.1| hypothetical protein OsI_06295 [Oryza sativa Indica Group] Back     alignment and taxonomy information
>gi|242064446|ref|XP_002453512.1| hypothetical protein SORBIDRAFT_04g007100 [Sorghum bicolor] gi|241933343|gb|EES06488.1| hypothetical protein SORBIDRAFT_04g007100 [Sorghum bicolor] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query862
ZFIN|ZDB-GENE-000616-4 1264 apaf1 "apoptotic protease acti 0.365 0.249 0.232 4.6e-08
UNIPROTKB|J9NS21 1250 APAF1 "Apoptotic protease-acti 0.351 0.242 0.229 1.7e-05
UNIPROTKB|F1MUW4 1251 APAF1 "Uncharacterized protein 0.351 0.242 0.217 4.6e-05
TAIR|locus:2008510 967 AT1G61190 "AT1G61190" [Arabido 0.265 0.236 0.237 5.3e-05
TAIR|locus:504956483847 AT3G46730 [Arabidopsis thalian 0.235 0.239 0.276 6e-05
TAIR|locus:2008440899 AT1G61180 [Arabidopsis thalian 0.285 0.273 0.244 9.2e-05
TAIR|locus:2197739762 AT1G61300 [Arabidopsis thalian 0.251 0.284 0.236 0.00017
RGD|620575 1249 Apaf1 "apoptotic peptidase act 0.378 0.261 0.208 0.0002
TAIR|locus:2175070 1114 AT5G41740 [Arabidopsis thalian 0.276 0.213 0.25 0.00025
UNIPROTKB|F1SQT5 1249 APAF1 "Uncharacterized protein 0.348 0.240 0.215 0.00033
ZFIN|ZDB-GENE-000616-4 apaf1 "apoptotic protease activating factor 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 165 (63.1 bits), Expect = 4.6e-08, P = 4.6e-08
 Identities = 80/344 (23%), Positives = 148/344 (43%)

Query:   170 LRKLLEQ-EETHQVILIVGLSGIGKSCLARQVASDPP---ERFVGGAVELGFGQWCSRAA 225
             +R++L +  +T   + + G++G GKS +A +V  D     E F  G   L  GQ C RA 
Sbjct:   137 IREMLYRLRDTPGWVTVFGMAGSGKSVMAAEVVRDRSLIKECFPDGVHWLSVGQ-CERAD 195

Query:   226 CNGSKSDYQKRLARKISKFLVQIGFWKKIKDENSDLEYLCCLLQEALYGKSILILLDDVW 285
                       RL +  S    Q      +++    L +L  +L+   + +S+LIL DDVW
Sbjct:   196 LLVRMQSLCFRLEQCQSSDTSQRPP-STVEEAKERLRFL--MLRR--FPRSLLIL-DDVW 249

Query:   286 EQDIVERFAKLYDNDCKYLVTTRNEAVYEITEAEKVELSKDDIMEISKS--ILLYHXXXX 343
             +   +  F    D  C+ L+TTRN A+ +     + E+  ++ ++  K+  IL  +    
Sbjct:   250 DSSSLRSF----DIQCRVLLTTRNRALTDSVSGVRYEVPVENGLDEEKALEILALYVNGK 305

Query:   344 XXXXXXXXXXXXXRCGHHPLTVAVMGKALRKELRSEKWEKAITDLSTFATCAPGPVSYVN 403
                           C   PL V+++G AL +E   ++W   +  L             + 
Sbjct:   306 MHKLPEQARSIVSECKGSPLVVSLIG-ALLREF-PDRWSYYLRQLQQ------KQFKRIR 357

Query:   404 EKEAENTLTIFGSFEFSLEAMPRDSRRLFIALAALSWAEPVPEACLEAIWSILVQKSLFS 463
             +  + +   +  + + SL+ +  + + L+  L+ +     VP   L  +W + +++    
Sbjct:   358 KSSSYDYEALDQAMDASLQVLEAEHQELYRDLSVMQKDIKVPAKVLSVLWGLELEEVEDV 417

Query:   464 LAVCKLVEGSLLMKD-DTDPL-YQVHDMVSLYLDSKTNDSIQML 505
             L   + V  SLL +D +  P  Y +HD+   +L  +  D I  L
Sbjct:   418 LQ--EFVNKSLLFRDCNQRPYRYYLHDLQLDFLAEQNRDQIAEL 459
GO:0042981 "regulation of apoptotic process" evidence=IEA
GO:0006952 "defense response" evidence=IEA
GO:0043531 "ADP binding" evidence=IEA
GO:0005622 "intracellular" evidence=IEA
GO:0005737 "cytoplasm" evidence=IEA
GO:0008233 "peptidase activity" evidence=IEA
GO:0000166 "nucleotide binding" evidence=IEA
GO:0006508 "proteolysis" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0006915 "apoptotic process" evidence=IEA
UNIPROTKB|J9NS21 APAF1 "Apoptotic protease-activating factor 1" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1MUW4 APAF1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
TAIR|locus:2008510 AT1G61190 "AT1G61190" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504956483 AT3G46730 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2008440 AT1G61180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2197739 AT1G61300 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
RGD|620575 Apaf1 "apoptotic peptidase activating factor 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
TAIR|locus:2175070 AT5G41740 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|F1SQT5 APAF1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query862
pfam00931285 pfam00931, NB-ARC, NB-ARC domain 1e-23
>gnl|CDD|216202 pfam00931, NB-ARC, NB-ARC domain Back     alignment and domain information 
 Score =  101 bits (254), Expect = 1e-23
 Identities = 71/283 (25%), Positives = 125/283 (44%), Gaps = 34/283 (12%)

Query: 164 SSKSKFLRKLLEQEETHQVILIVGLSGIGKSCLARQVASDPPERFVGGAVELGFGQWCSR 223
                 + KLLE  +   V+ IVG+ G+GK+ LA+Q+ +D        +V   F    S 
Sbjct: 3   DMIEALIEKLLEMSDNLGVVGIVGMGGVGKTTLAKQIYNDD-------SVGGHFD---SV 52

Query: 224 AACNGSKSDYQKRLARKISKFLVQIGFWKKIKDENSDLEYLCCLLQEALYGKSILILLDD 283
           A    SK+  + RL + I + L         K+E+     +     EAL  K  L++LDD
Sbjct: 53  AWVVVSKTYTEFRLQKDILQELGLDDSDWVEKNESELAVKIK----EALLRKRFLLVLDD 108

Query: 284 VWEQDIVERFAKLY---DNDCKYLVTTRNEAV----YEITEAEKVE-LSKDDIMEISKSI 335
           VWE++  ++    +   +N  + +VTTR+E+V       ++  +VE L  ++  E+  + 
Sbjct: 109 VWEKNDWDKIGVPFPDGENGSRVIVTTRSESVAGRMGGTSKPHEVESLEPEESWELFSNK 168

Query: 336 LLYHSLLAEEELPAAAESLLERCGHHPLTVAVMGKALRKELRSEKWEKAITDLSTFATCA 395
           +    L    EL   A+ ++E+C   PL + V+G  L  +   ++WE  +  L+      
Sbjct: 169 VFEKELPPCPELEEVAKEIVEKCKGLPLALKVLGGLLAFKSTVQEWEHVLEQLNNE---- 224

Query: 396 PGPVSYVNEKEAENTLTIFGSFEFSLEAMPRDSRRLFIALAAL 438
                 +NE        +      S + +P   +R F+ LA  
Sbjct: 225 LAGRDGLNE--------VLSILSLSYDNLPMHLKRCFLYLALF 259

Length = 285

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 862
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 100.0
PLN03210 1153 Resistant to P. syringae 6; Provisional 100.0
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 100.0
PRK04841 903 transcriptional regulator MalT; Provisional 99.47
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 99.23
PRK00411394 cdc6 cell division control protein 6; Reviewed 98.89
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 98.87
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 98.84
TIGR02928365 orc1/cdc6 family replication initiation protein. M 98.81
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 98.8
PF05729166 NACHT: NACHT domain 98.67
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 98.56
COG3903414 Predicted ATPase [General function prediction only 98.55
PRK13342413 recombination factor protein RarA; Reviewed 98.29
COG3899849 Predicted ATPase [General function prediction only 98.25
PRK06893229 DNA replication initiation factor; Validated 98.23
PF13173128 AAA_14: AAA domain 98.16
COG2256436 MGS1 ATPase related to the helicase subunit of the 98.13
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 98.06
PTZ001121164 origin recognition complex 1 protein; Provisional 98.02
PRK12402337 replication factor C small subunit 2; Reviewed 97.99
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 97.98
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 97.96
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 97.92
PLN03025319 replication factor C subunit; Provisional 97.9
PRK09087226 hypothetical protein; Validated 97.9
PRK13341725 recombination factor protein RarA/unknown domain f 97.88
PRK04195482 replication factor C large subunit; Provisional 97.85
PRK12323700 DNA polymerase III subunits gamma and tau; Provisi 97.84
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 97.81
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 97.81
PRK14963504 DNA polymerase III subunits gamma and tau; Provisi 97.79
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 97.78
PRK14960702 DNA polymerase III subunits gamma and tau; Provisi 97.73
PRK08727233 hypothetical protein; Validated 97.73
PRK08084235 DNA replication initiation factor; Provisional 97.7
PRK05564313 DNA polymerase III subunit delta'; Validated 97.7
PRK14957546 DNA polymerase III subunits gamma and tau; Provisi 97.69
PRK08691709 DNA polymerase III subunits gamma and tau; Validat 97.69
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 97.66
PRK14956484 DNA polymerase III subunits gamma and tau; Provisi 97.66
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 97.64
PRK06645507 DNA polymerase III subunits gamma and tau; Validat 97.62
KOG2028554 consensus ATPase related to the helicase subunit o 97.62
PRK00440319 rfc replication factor C small subunit; Reviewed 97.6
PF14516331 AAA_35: AAA-like domain 97.58
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 97.57
PRK07994647 DNA polymerase III subunits gamma and tau; Validat 97.56
PRK14962472 DNA polymerase III subunits gamma and tau; Provisi 97.56
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 97.54
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 97.54
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 97.52
PHA02544316 44 clamp loader, small subunit; Provisional 97.49
PRK14964491 DNA polymerase III subunits gamma and tau; Provisi 97.49
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 97.48
PRK05642234 DNA replication initiation factor; Validated 97.47
PRK14951618 DNA polymerase III subunits gamma and tau; Provisi 97.44
PTZ00202550 tuzin; Provisional 97.44
PRK14970367 DNA polymerase III subunits gamma and tau; Provisi 97.43
smart00382148 AAA ATPases associated with a variety of cellular 97.43
PRK14958509 DNA polymerase III subunits gamma and tau; Provisi 97.43
PRK09112351 DNA polymerase III subunit delta'; Validated 97.43
PRK05896605 DNA polymerase III subunits gamma and tau; Validat 97.41
PRK14088440 dnaA chromosomal replication initiation protein; P 97.39
PRK14969527 DNA polymerase III subunits gamma and tau; Provisi 97.37
TIGR02903615 spore_lon_C ATP-dependent protease, Lon family. Me 97.35
PRK07471365 DNA polymerase III subunit delta'; Validated 97.33
PRK09111598 DNA polymerase III subunits gamma and tau; Validat 97.3
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 97.28
PRK08903227 DnaA regulatory inactivator Hda; Validated 97.27
PRK14959624 DNA polymerase III subunits gamma and tau; Provisi 97.27
PF00004132 AAA: ATPase family associated with various cellula 97.24
PRK08451535 DNA polymerase III subunits gamma and tau; Validat 97.24
PRK06620214 hypothetical protein; Validated 97.22
cd01128249 rho_factor Transcription termination factor rho is 97.21
PRK06305451 DNA polymerase III subunits gamma and tau; Validat 97.2
PRK03992389 proteasome-activating nucleotidase; Provisional 97.19
PRK14087450 dnaA chromosomal replication initiation protein; P 97.19
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 97.16
PRK08116268 hypothetical protein; Validated 97.16
PRK00149450 dnaA chromosomal replication initiation protein; R 97.15
PRK14954620 DNA polymerase III subunits gamma and tau; Provisi 97.15
PRK14952584 DNA polymerase III subunits gamma and tau; Provisi 97.15
KOG0989346 consensus Replication factor C, subunit RFC4 [Repl 97.14
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 97.13
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 97.13
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 97.12
PRK07133725 DNA polymerase III subunits gamma and tau; Validat 97.12
PRK14950585 DNA polymerase III subunits gamma and tau; Provisi 97.11
PF07693325 KAP_NTPase: KAP family P-loop domain; InterPro: IP 97.08
CHL00095821 clpC Clp protease ATP binding subunit 97.08
PRK07940394 DNA polymerase III subunit delta'; Validated 97.07
PRK09376416 rho transcription termination factor Rho; Provisio 97.06
TIGR00362405 DnaA chromosomal replication initiator protein Dna 97.06
KOG2004906 consensus Mitochondrial ATP-dependent protease PIM 97.03
PRK14971614 DNA polymerase III subunits gamma and tau; Provisi 96.97
PRK14953486 DNA polymerase III subunits gamma and tau; Provisi 96.96
PRK05707328 DNA polymerase III subunit delta'; Validated 96.96
PRK14948620 DNA polymerase III subunits gamma and tau; Provisi 96.93
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 96.88
PRK10865857 protein disaggregation chaperone; Provisional 96.85
PRK14086617 dnaA chromosomal replication initiation protein; P 96.81
PRK06647563 DNA polymerase III subunits gamma and tau; Validat 96.8
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 96.78
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 96.73
PRK14965576 DNA polymerase III subunits gamma and tau; Provisi 96.71
PRK10536262 hypothetical protein; Provisional 96.71
PRK06921266 hypothetical protein; Provisional 96.7
KOG2543438 consensus Origin recognition complex, subunit 5 [R 96.69
COG1373398 Predicted ATPase (AAA+ superfamily) [General funct 96.68
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 96.68
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 96.67
TIGR01241495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 96.63
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 96.62
CHL00181287 cbbX CbbX; Provisional 96.62
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 96.59
PRK12422445 chromosomal replication initiation protein; Provis 96.57
TIGR00767415 rho transcription termination factor Rho. Members 96.57
CHL00176638 ftsH cell division protein; Validated 96.56
PF10443431 RNA12: RNA12 protein; InterPro: IPR018850 Mitochon 96.56
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 96.55
PRK07261171 topology modulation protein; Provisional 96.52
PF04665241 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 96.49
cd01393226 recA_like RecA is a bacterial enzyme which has rol 96.46
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 96.46
PRK05563559 DNA polymerase III subunits gamma and tau; Validat 96.43
COG0593408 DnaA ATPase involved in DNA replication initiation 96.42
PRK08181269 transposase; Validated 96.35
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 96.31
PRK09361225 radB DNA repair and recombination protein RadB; Pr 96.31
PF05673249 DUF815: Protein of unknown function (DUF815); Inte 96.31
PRK08118167 topology modulation protein; Reviewed 96.28
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 96.27
TIGR00602637 rad24 checkpoint protein rad24. This family is bas 96.27
PRK12377248 putative replication protein; Provisional 96.23
COG2255332 RuvB Holliday junction resolvasome, helicase subun 96.21
COG1484254 DnaC DNA replication protein [DNA replication, rec 96.2
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 96.2
PRK10865857 protein disaggregation chaperone; Provisional 96.18
COG0542786 clpA ATP-binding subunits of Clp protease and DnaK 96.12
PRK09183259 transposase/IS protein; Provisional 96.08
COG0466782 Lon ATP-dependent Lon protease, bacterial type [Po 95.99
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 95.97
TIGR02858270 spore_III_AA stage III sporulation protein AA. Mem 95.96
PRK06835329 DNA replication protein DnaC; Validated 95.95
cd01394218 radB RadB. The archaeal protein radB shares simila 95.95
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 95.95
PRK07399314 DNA polymerase III subunit delta'; Validated 95.95
cd01133274 F1-ATPase_beta F1 ATP synthase beta subunit, nucle 95.92
PRK06526254 transposase; Provisional 95.92
TIGR02237209 recomb_radB DNA repair and recombination protein R 95.91
PRK06762166 hypothetical protein; Provisional 95.89
COG4618580 ArpD ABC-type protease/lipase transport system, AT 95.89
CHL00095821 clpC Clp protease ATP binding subunit 95.86
PRK11331459 5-methylcytosine-specific restriction enzyme subun 95.84
PRK06067234 flagellar accessory protein FlaH; Validated 95.84
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 95.79
PRK08233182 hypothetical protein; Provisional 95.79
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r 95.76
KOG0733802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 95.72
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 95.71
cd03216163 ABC_Carb_Monos_I This family represents the domain 95.69
COG3267269 ExeA Type II secretory pathway, component ExeA (pr 95.57
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, c 95.56
TIGR01420343 pilT_fam pilus retraction protein PilT. This model 95.54
KOG2228408 consensus Origin recognition complex, subunit 4 [R 95.5
TIGR01359183 UMP_CMP_kin_fam UMP-CMP kinase family. This subfam 95.5
TIGR03877237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 95.49
PRK05800170 cobU adenosylcobinamide kinase/adenosylcobinamide- 95.49
PRK05541176 adenylylsulfate kinase; Provisional 95.48
PRK05973237 replicative DNA helicase; Provisional 95.41
PRK08939306 primosomal protein DnaI; Reviewed 95.4
PRK08058329 DNA polymerase III subunit delta'; Validated 95.34
PRK07952244 DNA replication protein DnaC; Validated 95.33
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 95.32
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 95.26
cd01125239 repA Hexameric Replicative Helicase RepA. RepA is 95.26
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 95.25
PRK12608380 transcription termination factor Rho; Provisional 95.22
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 95.22
cd03269210 ABC_putative_ATPase This subfamily is involved in 95.22
KOG0741744 consensus AAA+-type ATPase [Posttranslational modi 95.21
PLN00020413 ribulose bisphosphate carboxylase/oxygenase activa 95.18
PRK08769319 DNA polymerase III subunit delta'; Validated 95.17
TIGR01360188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 95.17
PRK04296190 thymidine kinase; Provisional 95.14
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 95.14
COG1618179 Predicted nucleotide kinase [Nucleotide transport 95.13
PRK14974336 cell division protein FtsY; Provisional 95.13
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 95.12
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 95.12
COG1223368 Predicted ATPase (AAA+ superfamily) [General funct 95.08
PRK06696223 uridine kinase; Validated 95.08
KOG0733802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 95.06
PRK04132846 replication factor C small subunit; Provisional 95.06
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 95.04
cd03217200 ABC_FeS_Assembly ABC-type transport system involve 95.04
CHL00195489 ycf46 Ycf46; Provisional 95.04
KOG0744423 consensus AAA+-type ATPase [Posttranslational modi 95.04
COG1102179 Cmk Cytidylate kinase [Nucleotide transport and me 95.03
COG0470325 HolB ATPase involved in DNA replication [DNA repli 95.03
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 95.01
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 95.0
PRK06871325 DNA polymerase III subunit delta'; Validated 94.99
cd00544169 CobU Adenosylcobinamide kinase / adenosylcobinamid 94.98
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 94.98
cd03283199 ABC_MutS-like MutS-like homolog in eukaryotes. The 94.97
PRK10867433 signal recognition particle protein; Provisional 94.97
COG2884223 FtsE Predicted ATPase involved in cell division [C 94.96
COG4608268 AppF ABC-type oligopeptide transport system, ATPas 94.95
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 94.95
cd01124187 KaiC KaiC is a circadian clock protein primarily f 94.92
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 94.91
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC tra 94.91
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 94.91
PRK04328249 hypothetical protein; Provisional 94.9
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 94.87
PRK07993334 DNA polymerase III subunit delta'; Validated 94.86
KOG0736953 consensus Peroxisome assembly factor 2 containing 94.86
cd03115173 SRP The signal recognition particle (SRP) mediates 94.84
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 94.83
PRK00771437 signal recognition particle protein Srp54; Provisi 94.83
PF00485194 PRK: Phosphoribulokinase / Uridine kinase family; 94.79
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 94.78
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-li 94.78
cd03220224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo 94.78
cd03246173 ABCC_Protease_Secretion This family represents the 94.73
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase compon 94.69
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 94.68
KOG0735952 consensus AAA+-type ATPase [Posttranslational modi 94.68
TIGR01189198 ccmA heme ABC exporter, ATP-binding protein CcmA. 94.66
PRK07667193 uridine kinase; Provisional 94.59
KOG0730693 consensus AAA+-type ATPase [Posttranslational modi 94.57
PF06745226 KaiC: KaiC; InterPro: IPR014774 This entry represe 94.57
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 94.56
PRK13539207 cytochrome c biogenesis protein CcmA; Provisional 94.55
PRK03839180 putative kinase; Provisional 94.55
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 94.54
PRK05480209 uridine/cytidine kinase; Provisional 94.51
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component 94.51
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 94.5
COG0563178 Adk Adenylate kinase and related kinases [Nucleoti 94.49
PF08423256 Rad51: Rad51; InterPro: IPR013632 This domain is f 94.48
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 94.46
TIGR02324224 CP_lyasePhnL phosphonate C-P lyase system protein 94.46
KOG0729435 consensus 26S proteasome regulatory complex, ATPas 94.45
TIGR02012321 tigrfam_recA protein RecA. This model describes or 94.44
TIGR00959428 ffh signal recognition particle protein. This mode 94.42
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 94.41
TIGR01188302 drrA daunorubicin resistance ABC transporter ATP-b 94.41
PRK13546264 teichoic acids export protein ATP-binding subunit; 94.4
PRK04301317 radA DNA repair and recombination protein RadA; Va 94.39
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 94.36
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 94.36
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 94.34
cd03235213 ABC_Metallic_Cations ABC component of the metal-ty 94.34
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 94.33
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.33
KOG1969877 consensus DNA replication checkpoint protein CHL12 94.33
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 94.28
TIGR00235207 udk uridine kinase. Model contains a number of lon 94.28
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the mal 94.26
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 94.26
TIGR01277213 thiQ thiamine ABC transporter, ATP-binding protein 94.25
PRK10584228 putative ABC transporter ATP-binding protein YbbA; 94.25
TIGR01166190 cbiO cobalt transport protein ATP-binding subunit. 94.25
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 94.23
PRK09270229 nucleoside triphosphate hydrolase domain-containin 94.21
PRK10619257 histidine/lysine/arginine/ornithine transporter su 94.2
PRK09354349 recA recombinase A; Provisional 94.2
KOG1514767 consensus Origin recognition complex, subunit 1, a 94.17
cd03258233 ABC_MetN_methionine_transporter MetN (also known a 94.17
KOG0617264 consensus Ras suppressor protein (contains leucine 94.15
cd03297214 ABC_ModC_molybdenum_transporter ModC is an ABC-typ 94.13
PRK11264250 putative amino-acid ABC transporter ATP-binding pr 94.13
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 94.13
PRK00131175 aroK shikimate kinase; Reviewed 94.12
PTZ00301210 uridine kinase; Provisional 94.11
cd00983325 recA RecA is a bacterial enzyme which has roles in 94.11
PRK10908222 cell division protein FtsE; Provisional 94.11
KOG2227529 consensus Pre-initiation complex, subunit CDC6, AA 94.11
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 94.1
PRK11248255 tauB taurine transporter ATP-binding subunit; Prov 94.09
TIGR02236310 recomb_radA DNA repair and recombination protein R 94.09
PRK00625173 shikimate kinase; Provisional 94.08
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o 94.07
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 94.07
PRK09544251 znuC high-affinity zinc transporter ATPase; Review 94.07
TIGR02655484 circ_KaiC circadian clock protein KaiC. Members of 94.05
PRK10463290 hydrogenase nickel incorporation protein HypB; Pro 94.03
TIGR00763775 lon ATP-dependent protease La. This protein is ind 94.03
TIGR01351210 adk adenylate kinases. Adenylate kinase (EC 2.7.4. 94.01
COG0396251 sufC Cysteine desulfurase activator ATPase [Posttr 94.0
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 93.99
PRK06547172 hypothetical protein; Provisional 93.97
TIGR03740223 galliderm_ABC gallidermin-class lantibiotic protec 93.97
TIGR03878259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 93.95
PRK04040188 adenylate kinase; Provisional 93.94
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding compo 93.9
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding su 93.89
TIGR03881229 KaiC_arch_4 KaiC domain protein, PAE1156 family. M 93.89
COG1131293 CcmA ABC-type multidrug transport system, ATPase c 93.87
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 93.87
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 93.87
PRK13537306 nodulation ABC transporter NodI; Provisional 93.87
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the gly 93.81
PRK13947171 shikimate kinase; Provisional 93.78
TIGR02868529 CydC thiol reductant ABC exporter, CydC subunit. T 93.78
PHA02244383 ATPase-like protein 93.78
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 93.78
PRK11124242 artP arginine transporter ATP-binding subunit; Pro 93.76
COG1136226 SalX ABC-type antimicrobial peptide transport syst 93.75
TIGR03771223 anch_rpt_ABC anchored repeat-type ABC transporter, 93.75
PRK10733644 hflB ATP-dependent metalloprotease; Reviewed 93.73
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; 93.72
KOG0991333 consensus Replication factor C, subunit RFC2 [Repl 93.72
PRK14247250 phosphate ABC transporter ATP-binding protein; Pro 93.71
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexame 93.69
PRK11300255 livG leucine/isoleucine/valine transporter ATP-bin 93.68
PRK14267253 phosphate ABC transporter ATP-binding protein; Pro 93.66
COG0572218 Udk Uridine kinase [Nucleotide transport and metab 93.65
TIGR01288303 nodI ATP-binding ABC transporter family nodulation 93.64
CHL00131252 ycf16 sulfate ABC transporter protein; Validated 93.57
COG2812515 DnaX DNA polymerase III, gamma/tau subunits [DNA r 93.56
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). 93.56
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the 93.55
TIGR01069771 mutS2 MutS2 family protein. Function of MutS2 is u 93.53
PRK06090319 DNA polymerase III subunit delta'; Validated 93.52
PRK01184184 hypothetical protein; Provisional 93.51
PRK10418254 nikD nickel transporter ATP-binding protein NikD; 93.5
TIGR03005252 ectoine_ehuA ectoine/hydroxyectoine ABC transporte 93.49
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 93.48
PRK06217183 hypothetical protein; Validated 93.48
PLN03187344 meiotic recombination protein DMC1 homolog; Provis 93.47
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 93.47
TIGR02322179 phosphon_PhnN phosphonate metabolism protein/1,5-b 93.44
cd03215182 ABC_Carb_Monos_II This family represents domain II 93.43
PRK14269246 phosphate ABC transporter ATP-binding protein; Pro 93.42
PRK14738206 gmk guanylate kinase; Provisional 93.41
PRK14250241 phosphate ABC transporter ATP-binding protein; Pro 93.4
PRK13648269 cbiO cobalt transporter ATP-binding subunit; Provi 93.39
PRK13948182 shikimate kinase; Provisional 93.39
cd02020147 CMPK Cytidine monophosphate kinase (CMPK) catalyze 93.37
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 93.37
PRK09984262 phosphonate/organophosphate ester transporter subu 93.33
KOG0734752 consensus AAA+-type ATPase containing the peptidas 93.32
PRK09302509 circadian clock protein KaiC; Reviewed 93.31
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 93.31
KOG0727408 consensus 26S proteasome regulatory complex, ATPas 93.3
PF13481193 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. 93.27
PRK15439510 autoinducer 2 ABC transporter ATP-binding protein 93.25
TIGR02238313 recomb_DMC1 meiotic recombinase Dmc1. This model d 93.22
cd01428194 ADK Adenylate kinase (ADK) catalyzes the reversibl 93.22
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. 93.22
COG3854308 SpoIIIAA ncharacterized protein conserved in bacte 93.21
PRK13647274 cbiO cobalt transporter ATP-binding subunit; Provi 93.18
PRK13949169 shikimate kinase; Provisional 93.11
TIGR03873256 F420-0_ABC_ATP proposed F420-0 ABC transporter, AT 93.11
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tr 93.09
TIGR02655484 circ_KaiC circadian clock protein KaiC. Members of 93.09
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 93.09
KOG0735952 consensus AAA+-type ATPase [Posttranslational modi 93.09
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phospho 93.09
PRK11144352 modC molybdate transporter ATP-binding protein; Pr 93.07
COG1428216 Deoxynucleoside kinases [Nucleotide transport and 93.05
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-bind 93.04
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 93.03
PRK13651305 cobalt transporter ATP-binding subunit; Provisiona 93.03
COG0703172 AroK Shikimate kinase [Amino acid transport and me 93.01
PF00406151 ADK: Adenylate kinase; InterPro: IPR000850 Adenyla 93.0
PRK11153343 metN DL-methionine transporter ATP-binding subunit 93.0
TIGR03263180 guanyl_kin guanylate kinase. Members of this famil 93.0
PRK06964342 DNA polymerase III subunit delta'; Validated 92.99
TIGR03575340 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryoti 92.99
cd02024187 NRK1 Nicotinamide riboside kinase (NRK) is an enzy 92.97
smart00534185 MUTSac ATPase domain of DNA mismatch repair MUTS f 92.97
PF14532138 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 92.96
PRK00889175 adenylylsulfate kinase; Provisional 92.95
TIGR03522301 GldA_ABC_ATP gliding motility-associated ABC trans 92.94
cd02025220 PanK Pantothenate kinase (PanK) catalyzes the phos 92.93
PRK13545549 tagH teichoic acids export protein ATP-binding sub 92.92
cd00464154 SK Shikimate kinase (SK) is the fifth enzyme in th 92.89
TIGR02314343 ABC_MetN D-methionine ABC transporter, ATP-binding 92.89
PTZ00088229 adenylate kinase 1; Provisional 92.88
PRK00279215 adk adenylate kinase; Reviewed 92.88
PRK11231255 fecE iron-dicitrate transporter ATP-binding subuni 92.87
PF07726131 AAA_3: ATPase family associated with various cellu 92.87
PF00910107 RNA_helicase: RNA helicase; InterPro: IPR000605 He 92.84
COG0468279 RecA RecA/RadA recombinase [DNA replication, recom 92.81
cd03281213 ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS 92.8
PF01583156 APS_kinase: Adenylylsulphate kinase; InterPro: IPR 92.8
PHA00729226 NTP-binding motif containing protein 92.8
PRK08533230 flagellar accessory protein FlaH; Reviewed 92.78
PRK10771232 thiQ thiamine transporter ATP-binding subunit; Pro 92.76
TIGR00416454 sms DNA repair protein RadA. The gene protuct code 92.76
cd02028179 UMPK_like Uridine monophosphate kinase_like (UMPK_ 92.75
PRK05439311 pantothenate kinase; Provisional 92.72
cd03282204 ABC_MSH4_euk MutS4 homolog in eukaryotes. The MutS 92.68
PRK13946184 shikimate kinase; Provisional 92.62
PF03308266 ArgK: ArgK protein; InterPro: IPR005129 Bacterial 92.58
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 92.55
PRK00300205 gmk guanylate kinase; Provisional 92.52
COG1066456 Sms Predicted ATP-dependent serine protease [Postt 92.51
smart00487201 DEXDc DEAD-like helicases superfamily. 92.5
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 92.49
TIGR00064272 ftsY signal recognition particle-docking protein F 92.48
PRK13536340 nodulation factor exporter subunit NodI; Provision 92.48
PRK10875615 recD exonuclease V subunit alpha; Provisional 92.48
PRK10078186 ribose 1,5-bisphosphokinase; Provisional 92.46
PRK11650356 ugpC glycerol-3-phosphate transporter ATP-binding 92.41
TIGR01313163 therm_gnt_kin carbohydrate kinase, thermoresistant 92.4
COG1126240 GlnQ ABC-type polar amino acid transport system, A 92.38
PRK11823446 DNA repair protein RadA; Provisional 92.36
PRK03846198 adenylylsulfate kinase; Provisional 92.35
PRK05057172 aroK shikimate kinase I; Reviewed 92.34
PRK13652277 cbiO cobalt transporter ATP-binding subunit; Provi 92.33
PRK14528186 adenylate kinase; Provisional 92.33
PRK15064530 ABC transporter ATP-binding protein; Provisional 92.33
TIGR02524358 dot_icm_DotB Dot/Icm secretion system ATPase DotB. 92.31
PRK13975196 thymidylate kinase; Provisional 92.28
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP- 92.28
PRK04182180 cytidylate kinase; Provisional 92.24
PRK11000369 maltose/maltodextrin transporter ATP-binding prote 92.23
PRK10070400 glycine betaine transporter ATP-binding subunit; P 92.23
KOG0927614 consensus Predicted transporter (ABC superfamily) 92.18
PF03969362 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 92.18
PRK14530215 adenylate kinase; Provisional 92.16
PRK12339197 2-phosphoglycerate kinase; Provisional 92.16
KOG0472565 consensus Leucine-rich repeat protein [Function un 92.1
TIGR03375694 type_I_sec_LssB type I secretion system ATPase, Ls 92.07
PRK14527191 adenylate kinase; Provisional 92.06
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pi 92.05
PRK10762501 D-ribose transporter ATP binding protein; Provisio 92.01
PRK14737186 gmk guanylate kinase; Provisional 92.0
PRK10751173 molybdopterin-guanine dinucleotide biosynthesis pr 91.99
TIGR00665434 DnaB replicative DNA helicase. This model describe 91.96
COG1875436 NYN ribonuclease and ATPase of PhoH family domains 91.96
TIGR00150133 HI0065_YjeE ATPase, YjeE family. Members of this f 91.95
cd03299235 ABC_ModC_like Archeal protein closely related to M 91.93
COG1936180 Predicted nucleotide kinase (related to CMP and AM 91.91
PF08477119 Miro: Miro-like protein; InterPro: IPR013684 Mitoc 91.89
TIGR03265353 PhnT2 putative 2-aminoethylphosphonate ABC transpo 91.88
PRK13549506 xylose transporter ATP-binding subunit; Provisiona 91.87
PF03205140 MobB: Molybdopterin guanine dinucleotide synthesis 91.85
PRK13409590 putative ATPase RIL; Provisional 91.85
PRK11432351 fbpC ferric transporter ATP-binding subunit; Provi 91.84
PF00625183 Guanylate_kin: Guanylate kinase; InterPro: IPR0081 91.84
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 91.83
TIGR00554290 panK_bact pantothenate kinase, bacterial type. Sho 91.79
COG4088261 Predicted nucleotide kinase [Nucleotide transport 91.79
PRK15455644 PrkA family serine protein kinase; Provisional 91.77
PTZ00035337 Rad51 protein; Provisional 91.75
cd00561159 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B 91.75
PLN02348395 phosphoribulokinase 91.73
COG2607287 Predicted ATPase (AAA+ superfamily) [General funct 91.73
COG0378202 HypB Ni2+-binding GTPase involved in regulation of 91.67
TIGR02173171 cyt_kin_arch cytidylate kinase, putative. Proteins 91.66
PRK08760476 replicative DNA helicase; Provisional 91.56
PRK09700510 D-allose transporter ATP-binding protein; Provisio 91.55
PRK14526211 adenylate kinase; Provisional 91.52
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 91.52
PLN02318656 phosphoribulokinase/uridine kinase 91.51
PRK11607377 potG putrescine transporter ATP-binding subunit; P 91.51
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) cat 91.48
cd03285222 ABC_MSH2_euk MutS2 homolog in eukaryotes. The MutS 91.47
cd03243202 ABC_MutS_homologs The MutS protein initiates DNA m 91.46
PLN03186342 DNA repair protein RAD51 homolog; Provisional 91.44
PF10236309 DAP3: Mitochondrial ribosomal death-associated pro 91.43
COG0488530 Uup ATPase components of ABC transporters with dup 91.4
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 91.39
PRK00409782 recombination and DNA strand exchange inhibitor pr 91.38
PRK03731171 aroL shikimate kinase II; Reviewed 91.37
COG1100219 GTPase SAR1 and related small G proteins [General 91.36
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational 91.32
TIGR02788308 VirB11 P-type DNA transfer ATPase VirB11. The VirB 91.31
TIGR01447586 recD exodeoxyribonuclease V, alpha subunit. This f 91.29
TIGR02142354 modC_ABC molybdenum ABC transporter, ATP-binding p 91.29
PRK12597461 F0F1 ATP synthase subunit beta; Provisional 91.28
PRK05537568 bifunctional sulfate adenylyltransferase subunit 1 91.28
PLN02200234 adenylate kinase family protein 91.26
cd00820107 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC 91.24
PF03266168 NTPase_1: NTPase; InterPro: IPR004948 This entry r 91.23
COG1119257 ModF ABC-type molybdenum transport system, ATPase 91.22
PRK05748448 replicative DNA helicase; Provisional 91.17
TIGR03258362 PhnT 2-aminoethylphosphonate ABC transport system, 91.16
PRK13657588 cyclic beta-1,2-glucan ABC transporter; Provisiona 91.16
PRK14532188 adenylate kinase; Provisional 91.15
COG0467260 RAD55 RecA-superfamily ATPases implicated in signa 91.11
PRK06761282 hypothetical protein; Provisional 91.1
PRK12678672 transcription termination factor Rho; Provisional 91.09
TIGR00073207 hypB hydrogenase accessory protein HypB. HypB is i 91.09
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 91.04
PRK13233275 nifH nitrogenase reductase; Reviewed 91.04
cd03280200 ABC_MutS2 MutS2 homologs in bacteria and eukaryote 91.03
PRK09825176 idnK D-gluconate kinase; Provisional 90.95
smart00072184 GuKc Guanylate kinase homologues. Active enzymes c 90.86
TIGR03574249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem 90.79
PF03796259 DnaB_C: DnaB-like helicase C terminal domain; Inte 90.78
PF13521163 AAA_28: AAA domain; PDB: 1LW7_A. 90.74
PTZ00494664 tuzin-like protein; Provisional 90.73
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information 
Probab=100.00  E-value=2.9e-59  Score=564.87  Aligned_cols=548  Identities=17%  Similarity=0.203  Sum_probs=383.3

Q ss_pred             HHHHHHHHHHHHHHHHHhHhHhHHHHHHHHHHHHHHHHHHHHHhhhhHhhhcHHHHHHHHHHHHHHHHHhhHHHHHhh--
Q 002972           13 IVTSMVGAVHALEQASRNLDEAPKRIRSLEDFVCDLENLMRRIKQKHAYKLHNPQLDHQLKSLNSLIERLHPKIRKAR--   90 (862)
Q Consensus        13 ~vs~l~~~~~~l~~~~~~l~~l~~~L~~l~~~L~~~~~~~~~~~~~~~~~~w~~qvr~~~yd~eD~ld~~~~~~~~~~--   90 (862)
                      +.+.+.+....+......+.++++.|..|+.+++|++...   .+......|...++++.|+++|.++.+.......+  
T Consensus        12 ~~~~l~~~~~~~~~~~~~i~~Lk~~L~~l~~~l~d~~a~~---~~~~~~~~~~e~~~~~~~~~e~~~~~~~v~~~~~~~~   88 (889)
T KOG4658|consen   12 LDQLLNRESECLDGKDNYILELKENLKALQSALEDLDAKR---DDLERRVNWEEDVGDLVYLAEDIIWLFLVEEIERKAN   88 (889)
T ss_pred             HHHHHHHHHHHHhchHHHHHHHHHHHHHHHHHHHHHHhhc---chHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            3445555566667777789999999999999999999977   55666788999999999999999999876665421  


Q ss_pred             Hhhhhc-cccccccchhhhhcccHHHHHHHHHHHHHHHHHHHhhhhhhhhhhhhccc------ccCCccccccccCCCcC
Q 002972           91 RMVSKS-KIKNLAHVVWTSMAGDPLRKLLNSINDDLNWWLESQILAQNVEKVIELTA------QEVPTRLKVKAEQGYPI  163 (862)
Q Consensus        91 ~~~~~~-~~~~~~~~~~~~~~~~~l~~~I~~I~~~i~~~~~~~~~~~~~~~~~~~~~------~~~~~~~~~~~~~~~g~  163 (862)
                      ...... ...+.....   .........+..+..++............ ...+....      ..+.......... +|.
T Consensus        89 ~~l~~~~~~~~~~c~~---~~~~~~~~~~~~~~~rv~~~l~~ve~l~~-~~~~~~~~~~~~~~~~~e~~~~~~~~~-VG~  163 (889)
T KOG4658|consen   89 DLLSTRSVERQRLCLC---GFCSKNVSDSYKYGKRVSKVLREVESLGS-KGVFEVVGESLDPREKVETRPIQSESD-VGL  163 (889)
T ss_pred             HHhhhhHHHHHHHhhh---hhHhHhhhhhHhHHHHHHHHHHHHHHhcc-ccceecccccccchhhcccCCCCcccc-ccH
Confidence            111100 000000000   11112222233333333222221111100 00011000      0111111111122 888


Q ss_pred             ccHHHHHHHHHhcCCCceEEEEEcCCCCCHHHHHHHHHhCCC---CCccCceEEEeeeeeeecccccCCCchHHHHHHHH
Q 002972          164 SSKSKFLRKLLEQEETHQVILIVGLSGIGKSCLARQVASDPP---ERFVGGAVELGFGQWCSRAACNGSKSDYQKRLARK  240 (862)
Q Consensus       164 ~~~~~~l~~LL~~~~~~~vI~I~G~gGiGKTtLA~~v~~~~~---~~F~~~~~~~~~~~w~~~~~~~~s~~~~~~~l~~~  240 (862)
                      +...+.+...|-.++. .+++|+||||+||||||++++|+..   .+| +.++      |+.+     |+++....+..+
T Consensus       164 e~~~~kl~~~L~~d~~-~iv~i~GMGGvGKTTL~~qi~N~~~~v~~~F-d~~i------WV~V-----Sk~f~~~~iq~~  230 (889)
T KOG4658|consen  164 ETMLEKLWNRLMEDDV-GIVGIYGMGGVGKTTLARQIFNKFDEVGNHF-DGVI------WVVV-----SKEFTTRKIQQT  230 (889)
T ss_pred             HHHHHHHHHHhccCCC-CEEEEECCCcccHHHHHHHHhcccchhcccC-ceEE------EEEE-----cccccHHhHHHH
Confidence            8888777777766544 8999999999999999999999875   345 4444      5433     778888888888


Q ss_pred             HHHHHHHhccccccCCCCCCHHHHHHHHHHHhcCCCeEEEEEcCCCchHHHHHhhccCC---CceEEEEccchhhhhh-c
Q 002972          241 ISKFLVQIGFWKKIKDENSDLEYLCCLLQEALYGKSILILLDDVWEQDIVERFAKLYDN---DCKYLVTTRNEAVYEI-T  316 (862)
Q Consensus       241 i~~~l~~lg~~~~~~~~~~~~~~l~~~l~~~L~~kr~LLVLDDV~~~~~~~~l~~~~~~---gsrILvTTR~~~va~~-~  316 (862)
                      |.+.+...+    ......+.++....+.+.|++|||||||||||+..+|+.+..+++.   ||+|++|||+..|+.. +
T Consensus       231 Il~~l~~~~----~~~~~~~~~~~~~~i~~~L~~krfllvLDDIW~~~dw~~I~~~~p~~~~g~KvvlTTRs~~V~~~~m  306 (889)
T KOG4658|consen  231 ILERLGLLD----EEWEDKEEDELASKLLNLLEGKRFLLVLDDIWEEVDWDKIGVPFPSRENGSKVVLTTRSEEVCGRAM  306 (889)
T ss_pred             HHHHhccCC----cccchhhHHHHHHHHHHHhccCceEEEEecccccccHHhcCCCCCCccCCeEEEEEeccHhhhhccc
Confidence            876553222    1112223478899999999999999999999999999999987764   6999999999999997 6


Q ss_pred             cccc---c-cCChhhHHHHHHHHhhhcccccCcchHHHHHHHHhhhCCchHHHHHHhhhhhccCCHHHHHHHHHHhhhhh
Q 002972          317 EAEK---V-ELSKDDIMEISKSILLYHSLLAEEELPAAAESLLERCGHHPLTVAVMGKALRKELRSEKWEKAITDLSTFA  392 (862)
Q Consensus       317 ~~~~---~-~L~~~ea~~Lf~~~~~~~~~~~~~~l~~~~~~Iv~~cgGLPLAI~~ig~~L~~~~~~~~W~~~l~~L~~~~  392 (862)
                      ++..   + .|+++|||+||.+.++.......+.++++|++++++|+|+|||+.++|+.|+.+.+..+|+.+++.+.+..
T Consensus       307 ~~~~~~~v~~L~~~eaW~LF~~~v~~~~~~~~~~i~~lak~v~~kC~GLPLAl~viG~~ma~K~t~~eW~~~~~~l~s~~  386 (889)
T KOG4658|consen  307 GVDYPIEVECLTPEEAWDLFQKKVGPNTLGSHPDIEELAKEVAEKCGGLPLALNVLGGLLACKKTVQEWRRALNVLKSSL  386 (889)
T ss_pred             cCCccccccccCccccHHHHHHhhccccccccccHHHHHHHHHHHhCChHHHHHHHHHHhcCCCcHHHHHHHHccccccc
Confidence            6533   2 79999999999999987766566669999999999999999999999999999989999999999998763


Q ss_pred             -ccCCCCCCccchhhhhcccccccchhhhhccCcHHHHHHHHHhcccCCCCCCChHHHHHHHHHhhh----------cch
Q 002972          393 -TCAPGPVSYVNEKEAENTLTIFGSFEFSLEAMPRDSRRLFIALAALSWAEPVPEACLEAIWSILVQ----------KSL  461 (862)
Q Consensus       393 -~~~~~~~~~~~~~~~~~~~~I~~~L~lSy~~L~~~~k~cfl~lsiFp~~~~i~~~~L~~lW~a~g~----------~~~  461 (862)
                       ...++           ....|+++|.+||+.||++.|.||+|||+||+|+.|+.+.|+.+|+|+|.          .+.
T Consensus       387 ~~~~~~-----------~~~~i~~iLklSyd~L~~~lK~CFLycalFPED~~I~~e~Li~yWiaEGfi~~~~~~~~~~d~  455 (889)
T KOG4658|consen  387 AADFSG-----------MEESILPILKLSYDNLPEELKSCFLYCALFPEDYEIKKEKLIEYWIAEGFIDPLDGGETAEDV  455 (889)
T ss_pred             cCCCCc-----------hhhhhHHhhhccHhhhhHHHHHHHHhhccCCcccccchHHHHHHHHhccCcCccccccchhcc
Confidence             22211           11378999999999999999999999999999999999999999999992          256


Q ss_pred             HHHHHHHHHHCCCCcccC---CCCcEEeCHHHHHHHHHhhcccch----hhhccc-----ccc--ccccccccccccCcc
Q 002972          462 FSLAVCKLVEGSLLMKDD---TDPLYQVHDMVSLYLDSKTNDSIQ----MLINGL-----KAE--EIAFICPWFLIFGKE  527 (862)
Q Consensus       462 ~e~~l~~L~~rsLl~~~~---~~~~~~mHdLVr~~a~~~~~e~~~----~l~~~~-----~~~--~~~~~~~~~~~~~~~  527 (862)
                      ++.|+++|+++||+....   ...+|.|||+||++|..++.+.+.    .++...     .+.  .....++.....+..
T Consensus       456 G~~~i~~LV~~~Ll~~~~~~~~~~~~kmHDvvRe~al~ias~~~~~~e~~iv~~~~~~~~~~~~~~~~~~rr~s~~~~~~  535 (889)
T KOG4658|consen  456 GYDYIEELVRASLLIEERDEGRKETVKMHDVVREMALWIASDFGKQEENQIVSDGVGLSEIPQVKSWNSVRRMSLMNNKI  535 (889)
T ss_pred             hHHHHHHHHHHHHHhhcccccceeEEEeeHHHHHHHHHHhccccccccceEEECCcCccccccccchhheeEEEEeccch
Confidence            789999999999999875   346899999999999999984222    222221     010  010111111111110


Q ss_pred             -hh-ccccccchhhhhccchhhhhHhhHHHH-HHHhccCCcccEEEecc-cccccccChhhccccCCCcccccccchh
Q 002972          528 -NI-KNIAEEKVELSLSVSEEKLVIITIEAI-LQALMASKSISELEVSR-ICFSGILGPRIADLISRDSQSLTVVSAE  601 (862)
Q Consensus       528 -~~-~~ls~~~l~sl~~~~~~~~~~~~l~~~-~~~l~~~~~LrvLdLs~-~~i~~~LP~~I~~L~~Lr~L~l~~s~~~  601 (862)
                       .+ ......++++++......    .+..+ ..+|..++.|||||||+ ..+.+ ||++||+|.|||||+++.|.++
T Consensus       536 ~~~~~~~~~~~L~tLll~~n~~----~l~~is~~ff~~m~~LrVLDLs~~~~l~~-LP~~I~~Li~LryL~L~~t~I~  608 (889)
T KOG4658|consen  536 EHIAGSSENPKLRTLLLQRNSD----WLLEISGEFFRSLPLLRVLDLSGNSSLSK-LPSSIGELVHLRYLDLSDTGIS  608 (889)
T ss_pred             hhccCCCCCCccceEEEeecch----hhhhcCHHHHhhCcceEEEECCCCCccCc-CChHHhhhhhhhcccccCCCcc
Confidence             11 111222466665554432    11123 44799999999999995 66788 9999999999999999998543

>PLN03210 Resistant to P Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>COG3903 Predicted ATPase [General function prediction only] Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>COG3899 Predicted ATPase [General function prediction only] Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PF14516 AAA_35: AAA-like domain Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PTZ00202 tuzin; Provisional Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF07693 KAP_NTPase: KAP family P-loop domain; InterPro: IPR011646 The KAP (after Kidins220/ARMS and PifA) family of predicted NTPases are sporadically distributed across a wide phylogenetic range in bacteria and in animals Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK09376 rho transcription termination factor Rho; Provisional Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>KOG2543 consensus Origin recognition complex, subunit 5 [Replication, recombination and repair] Back     alignment and domain information
>COG1373 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>TIGR00767 rho transcription termination factor Rho Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>PF10443 RNA12: RNA12 protein; InterPro: IPR018850 Mitochondrial escape protein 2 (also known as RNA12) plays a role in maintaining the mitochondrial genome and in controlling mtDNA escape [, ] Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein Back     alignment and domain information
>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>TIGR02858 spore_III_AA stage III sporulation protein AA Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>cd01133 F1-ATPase_beta F1 ATP synthase beta subunit, nucleotide-binding domain Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>PRK06762 hypothetical protein; Provisional Back     alignment and domain information
>COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion] Back     alignment and domain information
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>KOG2228 consensus Origin recognition complex, subunit 4 [Replication, recombination and repair] Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PRK05973 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>cd01125 repA Hexameric Replicative Helicase RepA Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>PRK12608 transcription termination factor Rho; Provisional Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PRK06696 uridine kinase; Validated Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK04132 replication factor C small subunit; Provisional Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) Back     alignment and domain information
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>PRK04328 hypothetical protein; Provisional Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>PRK07667 uridine kinase; Provisional Back     alignment and domain information
>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK03839 putative kinase; Provisional Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>PRK05480 uridine/cytidine kinase; Provisional Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>PF08423 Rad51: Rad51; InterPro: IPR013632 This domain is found at the C terminus of the DNA repair and recombination protein Rad51 Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>PRK13546 teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>PRK04301 radA DNA repair and recombination protein RadA; Validated Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed Back     alignment and domain information
>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>PRK09354 recA recombinase A; Provisional Back     alignment and domain information
>KOG1514 consensus Origin recognition complex, subunit 1, and related proteins [Replication, recombination and repair] Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB Back     alignment and domain information
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>PTZ00301 uridine kinase; Provisional Back     alignment and domain information
>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>PRK10908 cell division protein FtsE; Provisional Back     alignment and domain information
>KOG2227 consensus Pre-initiation complex, subunit CDC6, AAA+ superfamily ATPase [Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02236 recomb_radA DNA repair and recombination protein RadA Back     alignment and domain information
>PRK00625 shikimate kinase; Provisional Back     alignment and domain information
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>TIGR01351 adk adenylate kinases Back     alignment and domain information
>COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>PRK06547 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>PRK04040 adenylate kinase; Provisional Back     alignment and domain information
>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter Back     alignment and domain information
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family Back     alignment and domain information
>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>PRK13537 nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea Back     alignment and domain information
>PRK13947 shikimate kinase; Provisional Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] Back     alignment and domain information
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG0572 Udk Uridine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>CHL00131 ycf16 sulfate ABC transporter protein; Validated Back     alignment and domain information
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) Back     alignment and domain information
>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D Back     alignment and domain information
>TIGR01069 mutS2 MutS2 family protein Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK01184 hypothetical protein; Provisional Back     alignment and domain information
>PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional Back     alignment and domain information
>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>PRK06217 hypothetical protein; Validated Back     alignment and domain information
>PLN03187 meiotic recombination protein DMC1 homolog; Provisional Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14738 gmk guanylate kinase; Provisional Back     alignment and domain information
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13948 shikimate kinase; Provisional Back     alignment and domain information
>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional Back     alignment and domain information
>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09302 circadian clock protein KaiC; Reviewed Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>TIGR02238 recomb_DMC1 meiotic recombinase Dmc1 Back     alignment and domain information
>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) Back     alignment and domain information
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13949 shikimate kinase; Provisional Back     alignment and domain information
>TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate Back     alignment and domain information
>PRK11144 modC molybdate transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1428 Deoxynucleoside kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK13651 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG0703 AroK Shikimate kinase [Amino acid transport and metabolism] Back     alignment and domain information
>PF00406 ADK: Adenylate kinase; InterPro: IPR000850 Adenylate kinases (ADK) are phosphotransferases that catalyse the reversible reaction AMP + MgATP = ADP + MgADP an essential reaction for many processes in living cells Back     alignment and domain information
>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR03575 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryotic Back     alignment and domain information
>cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+) Back     alignment and domain information
>smart00534 MUTSac ATPase domain of DNA mismatch repair MUTS family Back     alignment and domain information
>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H Back     alignment and domain information
>PRK00889 adenylylsulfate kinase; Provisional Back     alignment and domain information
>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway Back     alignment and domain information
>PRK13545 tagH teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants Back     alignment and domain information
>TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>PTZ00088 adenylate kinase 1; Provisional Back     alignment and domain information
>PRK00279 adk adenylate kinase; Reviewed Back     alignment and domain information
>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model Back     alignment and domain information
>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) Back     alignment and domain information
>COG0468 RecA RecA/RadA recombinase [DNA replication, recombination, and repair] Back     alignment and domain information
>cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes Back     alignment and domain information
>PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR00416 sms DNA repair protein RadA Back     alignment and domain information
>cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>PRK05439 pantothenate kinase; Provisional Back     alignment and domain information
>cd03282 ABC_MSH4_euk MutS4 homolog in eukaryotes Back     alignment and domain information
>PRK13946 shikimate kinase; Provisional Back     alignment and domain information
>PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>PRK13536 nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>PRK10875 recD exonuclease V subunit alpha; Provisional Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>PRK03846 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PRK05057 aroK shikimate kinase I; Reviewed Back     alignment and domain information
>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14528 adenylate kinase; Provisional Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB Back     alignment and domain information
>PRK13975 thymidylate kinase; Provisional Back     alignment and domain information
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>PRK04182 cytidylate kinase; Provisional Back     alignment and domain information
>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only] Back     alignment and domain information
>PF03969 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 ATPase family gene 1 (AFG1) ATPase is a 377 amino acid putative protein with an ATPase motif typical of the protein family including SEC18p PAS1, CDC48-VCP and TBP Back     alignment and domain information
>PRK14530 adenylate kinase; Provisional Back     alignment and domain information
>PRK12339 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family Back     alignment and domain information
>PRK14527 adenylate kinase; Provisional Back     alignment and domain information
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>PRK14737 gmk guanylate kinase; Provisional Back     alignment and domain information
>PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional Back     alignment and domain information
>TIGR00665 DnaB replicative DNA helicase Back     alignment and domain information
>COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only] Back     alignment and domain information
>TIGR00150 HI0065_YjeE ATPase, YjeE family Back     alignment and domain information
>cd03299 ABC_ModC_like Archeal protein closely related to ModC Back     alignment and domain information
>COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] Back     alignment and domain information
>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases Back     alignment and domain information
>TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PF00625 Guanylate_kin: Guanylate kinase; InterPro: IPR008144 Guanylate kinase (2 Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>TIGR00554 panK_bact pantothenate kinase, bacterial type Back     alignment and domain information
>COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK15455 PrkA family serine protein kinase; Provisional Back     alignment and domain information
>PTZ00035 Rad51 protein; Provisional Back     alignment and domain information
>cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP Back     alignment and domain information
>PLN02348 phosphoribulokinase Back     alignment and domain information
>COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>COG0378 HypB Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase [Posttranslational modification, protein turnover, chaperones / Transcription] Back     alignment and domain information
>TIGR02173 cyt_kin_arch cytidylate kinase, putative Back     alignment and domain information
>PRK08760 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14526 adenylate kinase; Provisional Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PLN02318 phosphoribulokinase/uridine kinase Back     alignment and domain information
>PRK11607 potG putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) Back     alignment and domain information
>cd03285 ABC_MSH2_euk MutS2 homolog in eukaryotes Back     alignment and domain information
>cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch Back     alignment and domain information
>PLN03186 DNA repair protein RAD51 homolog; Provisional Back     alignment and domain information
>PF10236 DAP3: Mitochondrial ribosomal death-associated protein 3; InterPro: IPR019368 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed Back     alignment and domain information
>PRK03731 aroL shikimate kinase II; Reviewed Back     alignment and domain information
>COG1100 GTPase SAR1 and related small G proteins [General function prediction only] Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 Back     alignment and domain information
>TIGR01447 recD exodeoxyribonuclease V, alpha subunit Back     alignment and domain information
>TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK12597 F0F1 ATP synthase subunit beta; Provisional Back     alignment and domain information
>PRK05537 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Validated Back     alignment and domain information
>PLN02200 adenylate kinase family protein Back     alignment and domain information
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] Back     alignment and domain information
>COG1119 ModF ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK05748 replicative DNA helicase; Provisional Back     alignment and domain information
>TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>PRK14532 adenylate kinase; Provisional Back     alignment and domain information
>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] Back     alignment and domain information
>PRK06761 hypothetical protein; Provisional Back     alignment and domain information
>PRK12678 transcription termination factor Rho; Provisional Back     alignment and domain information
>TIGR00073 hypB hydrogenase accessory protein HypB Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK13233 nifH nitrogenase reductase; Reviewed Back     alignment and domain information
>cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes Back     alignment and domain information
>PRK09825 idnK D-gluconate kinase; Provisional Back     alignment and domain information
>smart00072 GuKc Guanylate kinase homologues Back     alignment and domain information
>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal Back     alignment and domain information
>PF03796 DnaB_C: DnaB-like helicase C terminal domain; InterPro: IPR007694 The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork Back     alignment and domain information
>PF13521 AAA_28: AAA domain; PDB: 1LW7_A Back     alignment and domain information
>PTZ00494 tuzin-like protein; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query862
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-59
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-09
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 1e-27
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 1e-26
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 3e-23
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 3e-08
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 1e-05
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 2e-06
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 2e-06
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 4e-06
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 2e-05
2jdq_A 450 Importin alpha-1 subunit; transport, PB2 subunit, 8e-06
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 6e-05
3oqs_A 510 Importin subunit alpha-2; importin alpha, karyophe 1e-05
3oqs_A 510 Importin subunit alpha-2; importin alpha, karyophe 2e-05
1wa5_B 530 Importin alpha subunit; nuclear transport/complex, 1e-04
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 4e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score =  217 bits (553), Expect = 9e-59
 Identities = 112/643 (17%), Positives = 219/643 (34%), Gaps = 153/643 (23%)

Query: 41  LEDFVC-DLENLMRRIKQKHAYKLHNPQLDHQLKSLNSLIERLHPKIRKARRMVS--KSK 97
           +++F C D++++ + I       L   ++DH + S +         +    R+     SK
Sbjct: 30  VDNFDCKDVQDMPKSI-------LSKEEIDHIIMSKD--------AVSGTLRLFWTLLSK 74

Query: 98  IKNLAHVVWTSMAGDPLRKLLNSINDDLNW-WLESQILAQNVEKVIELTAQEVPTRLK-- 154
            + +          + LR          N+ +L S I  +  +  +  T   +  R +  
Sbjct: 75  QEEMVQK----FVEEVLRI---------NYKFLMSPIKTEQRQPSMM-TRMYIEQRDRLY 120

Query: 155 --VKAEQGYPISSKSKF--LRKLLEQEETHQVILIVGLSGIGKSCLARQVASDPP--ERF 208
              +    Y +S    +  LR+ L +    + +LI G+ G GK+ +A  V        + 
Sbjct: 121 NDNQVFAKYNVSRLQPYLKLRQALLELRPAKNVLIDGVLGSGKTWVALDVCLSYKVQCKM 180

Query: 209 VGGAVELGFGQWCSRAACNGSKS--DYQKRLARKISKFLVQIG-FWKKIKDENSDL-EYL 264
                   F  W +   CN  ++  +  ++L  +I             IK     +   L
Sbjct: 181 DFKI----F--WLNLKNCNSPETVLEMLQKLLYQIDPNWTSRSDHSSNIKLRIHSIQAEL 234

Query: 265 CCLLQEALYGKSILILLDDVWEQDIVERFAKLYDNDCKYLVTTRNEAVYE-ITEAEKVEL 323
             LL+   Y   +L+ L +V        F    +  CK L+TTR + V + ++ A    +
Sbjct: 235 RRLLKSKPYENCLLV-LLNVQNAKAWNAF----NLSCKILLTTRFKQVTDFLSAATTTHI 289

Query: 324 SKDDIMEI-----SKSILLYHSLLAEEELPAAAESLLERCGHHPLTVAVMGKALRKEL-R 377
           S D           KS+LL +     ++LP            +P  ++++ +++R  L  
Sbjct: 290 SLDHHSMTLTPDEVKSLLLKYLDCRPQDLPREV------LTTNPRRLSIIAESIRDGLAT 343

Query: 378 SEKWEKAITDLSTFATCAPGPVSYVNEKEAENTLTIFGSFEFSLEAM-PRDSRRLFIALA 436
            + W+                  +VN  +    +      E SL  + P + R++F  L+
Sbjct: 344 WDNWK------------------HVNCDKLTTII------ESSLNVLEPAEYRKMFDRLS 379

Query: 437 ALSWAEPVPEACLEAIWSILVQKSLFSLAVCKLVEGSLLMKDDTDPLYQVHDMVSLYLDS 496
               +  +P   L  IW  +++  +  + V KL + SL+ K   +    +     +YL+ 
Sbjct: 380 VFPPSAHIPTILLSLIWFDVIKSDVMVV-VNKLHKYSLVEKQPKESTISIPS---IYLEL 435

Query: 497 KTNDSI-----QMLIN----GLKAEEIAFICP-------WFL---IFGKENIKNIAE-EK 536
           K          + +++        +    I P         +   +   E+ + +     
Sbjct: 436 KVKLENEYALHRSIVDHYNIPKTFDSDDLIPPYLDQYFYSHIGHHLKNIEHPERMTLFRM 495

Query: 537 VELSLSVSEEKLVIITIEAILQALMASKSISELEVSRICFSGILGPRIADL------ISR 590
           V L     E+K     I     A  AS SI                 +  L      I  
Sbjct: 496 VFLDFRFLEQK-----IRHDSTAWNASGSILNT--------------LQQLKFYKPYICD 536

Query: 591 DSQSLTVVSAEAITNIFSKGDYCSYIPSLETTGAVDKLAGLLQ 633
           +         E + N         ++P +E      K   LL+
Sbjct: 537 NDPKY-----ERLVN-----AILDFLPKIEENLICSKYTDLLR 569
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 Back     alignment and structure
>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 Back     alignment and structure
>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query862
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 100.0
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 100.0
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 100.0
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 100.0
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 99.57
2fna_A357 Conserved hypothetical protein; structural genomic 99.53
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 99.49
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 99.19
2v1u_A387 Cell division control protein 6 homolog; DNA repli 99.17
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 99.1
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 99.07
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 98.86
2chg_A226 Replication factor C small subunit; DNA-binding pr 98.77
3qfl_A115 MLA10; coiled-coil, (CC) domain, NLRS, nucleotide- 98.74
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 98.58
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 98.36
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 98.26
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 98.24
2chq_A319 Replication factor C small subunit; DNA-binding pr 98.11
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 98.02
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 97.98
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 97.95
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 97.9
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 97.82
3bos_A242 Putative DNA replication factor; P-loop containing 97.82
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 97.8
3pvs_A447 Replication-associated recombination protein A; ma 97.77
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 97.75
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 97.74
1sxj_A516 Activator 1 95 kDa subunit; clamp loader, processi 97.73
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 97.7
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 97.61
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 97.59
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 97.56
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 97.55
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 97.47
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 97.45
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 97.45
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 97.42
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 97.39
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 97.38
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 97.36
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 97.33
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 97.32
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 97.29
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 97.25
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 97.2
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 97.2
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 97.17
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 97.13
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 97.09
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.06
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 97.03
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 97.0
3qww_A433 SET and MYND domain-containing protein 2; methyltr 96.99
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 96.99
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 96.95
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 96.94
1qvr_A854 CLPB protein; coiled coil, AAA ATPase, chaperone; 96.89
3pxg_A468 Negative regulator of genetic competence CLPC/MEC; 96.85
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 96.81
2ce7_A476 Cell division protein FTSH; metalloprotease; HET: 96.72
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 96.64
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 96.6
2cvh_A220 DNA repair and recombination protein RADB; filamen 96.58
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 96.56
2kjq_A149 DNAA-related protein; solution structure, NESG, st 96.55
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 96.51
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 96.43
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 96.42
3cf2_A806 TER ATPase, transitional endoplasmic reticulum ATP 96.42
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 96.39
3co5_A143 Putative two-component system transcriptional RES 96.37
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 96.24
2gno_A305 DNA polymerase III, gamma subunit-related protein; 96.18
2vhj_A331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 96.01
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 95.84
4a74_A231 DNA repair and recombination protein RADA; hydrola 95.7
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 95.47
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 95.47
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 95.32
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 95.28
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 95.14
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 95.09
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 95.06
4hxt_A252 De novo protein OR329; structural genomics, PSI-bi 95.05
2dhr_A499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 95.04
1sgw_A214 Putative ABC transporter; structural genomics, P p 94.93
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 94.92
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 94.84
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 94.7
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 94.65
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 94.57
4hxt_A252 De novo protein OR329; structural genomics, PSI-bi 94.55
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 94.54
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 94.51
2eyu_A261 Twitching motility protein PILT; pilus retraction 94.5
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 94.49
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 94.44
2r62_A268 Cell division protease FTSH homolog; ATPase domain 94.32
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 94.29
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 94.29
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 94.26
1ji0_A240 ABC transporter; ATP binding protein, structural g 94.25
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 94.25
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 94.19
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 94.18
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 94.16
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 93.97
2z43_A324 DNA repair and recombination protein RADA; archaea 93.96
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 93.96
3vaa_A199 Shikimate kinase, SK; structural genomics, center 93.9
3io5_A333 Recombination and repair protein; storage dimer, i 93.89
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 93.87
1kag_A173 SKI, shikimate kinase I; transferase, structural g 93.82
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 93.81
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 93.8
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 93.68
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 93.67
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 93.65
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 93.64
1vma_A306 Cell division protein FTSY; TM0570, structural gen 93.61
1v43_A372 Sugar-binding transport ATP-binding protein; ATPas 93.59
4b8j_A 528 Importin subunit alpha-1A; transport protein, nucl 93.59
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 93.59
1qvr_A854 CLPB protein; coiled coil, AAA ATPase, chaperone; 93.58
1sky_E473 F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp 93.57
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 93.54
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 93.51
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 93.5
2q6t_A444 DNAB replication FORK helicase; hydrolase; 2.90A { 93.45
2ewv_A372 Twitching motility protein PILT; pilus retraction 93.44
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 93.4
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 93.39
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 93.37
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 93.35
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 93.33
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 93.33
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 93.32
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 93.23
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 93.21
2yyz_A359 Sugar ABC transporter, ATP-binding protein; sugar 93.2
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 93.1
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 93.07
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 93.05
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 93.04
4a1f_A338 DNAB helicase, replicative DNA helicase; hydrolase 93.04
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 93.03
3fvq_A359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 93.01
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 93.01
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 92.96
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 92.95
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 92.93
1odf_A290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 92.92
1via_A175 Shikimate kinase; structural genomics, transferase 92.92
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 92.91
2vli_A183 Antibiotic resistance protein; transferase, tunica 92.88
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 92.86
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 92.85
2r6a_A454 DNAB helicase, replicative helicase; replication, 92.84
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 92.83
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 92.8
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 92.79
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 92.77
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 92.76
1q57_A503 DNA primase/helicase; dntpase, DNA replication, tr 92.7
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 92.7
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 92.69
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 92.68
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 92.68
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 92.67
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 92.65
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 92.63
2i1q_A322 DNA repair and recombination protein RADA; ATPase, 92.61
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 92.58
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 92.57
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 92.57
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 92.5
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 92.5
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 92.46
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 92.43
3fwy_A314 Light-independent protochlorophyllide reductase I 92.41
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 92.35
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 92.3
2hf9_A226 Probable hydrogenase nickel incorporation protein 92.3
1jr3_D343 DNA polymerase III, delta subunit; processivity, p 92.29
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 92.29
1tue_A212 Replication protein E1; helicase, replication, E1E 92.28
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 92.28
1z47_A355 CYSA, putative ABC-transporter ATP-binding protein 92.19
4b8j_A 528 Importin subunit alpha-1A; transport protein, nucl 92.19
3ice_A422 Transcription termination factor RHO; transcriptio 92.13
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 92.1
3hws_A363 ATP-dependent CLP protease ATP-binding subunit CL; 92.07
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 92.02
2grj_A192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 91.98
1g5t_A196 COB(I)alamin adenosyltransferase; P-loop protein, 91.97
1xp8_A366 RECA protein, recombinase A; recombination, radior 91.96
3tlx_A243 Adenylate kinase 2; structural genomics, structura 91.94
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 91.93
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 91.9
3d31_A348 Sulfate/molybdate ABC transporter, ATP-binding pro 91.89
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 91.89
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 91.87
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 91.86
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 91.76
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 91.74
3ch4_B202 Pmkase, phosphomevalonate kinase; parallel beta-sh 91.68
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 91.66
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 91.64
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 91.58
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 91.56
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 91.5
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 91.41
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 91.38
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 91.36
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 91.36
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 91.36
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 91.32
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 91.3
3gmt_A230 Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle 91.28
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 91.24
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 91.22
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 91.21
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics 91.2
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 91.18
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 91.15
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 91.15
2f6r_A281 COA synthase, bifunctional coenzyme A synthase; 18 91.13
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 91.05
1xjc_A169 MOBB protein homolog; structural genomics, midwest 91.03
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 91.01
1um8_A376 ATP-dependent CLP protease ATP-binding subunit CL; 91.01
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 90.97
3qww_A433 SET and MYND domain-containing protein 2; methyltr 90.91
2ck3_D482 ATP synthase subunit beta\, mitochondrial; hydrola 90.86
3ake_A208 Cytidylate kinase; CMP kinase, CMP complex, open c 90.84
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 90.83
1fx0_B498 ATP synthase beta chain; latent ATPase, thermal st 90.81
3a8t_A339 Adenylate isopentenyltransferase; rossmann fold pr 90.78
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 90.74
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 90.65
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 90.65
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 90.63
2ffh_A425 Protein (FFH); SRP54, signal recognition particle, 90.62
2xxa_A433 Signal recognition particle protein; protein trans 90.59
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 90.51
3d3q_A340 TRNA delta(2)-isopentenylpyrophosphate transferase 90.5
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 90.45
1ojl_A304 Transcriptional regulatory protein ZRAR; response 90.32
3exa_A322 TRNA delta(2)-isopentenylpyrophosphate transferase 90.24
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 90.18
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 90.16
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 90.12
2jdq_A 450 Importin alpha-1 subunit; transport, PB2 subunit, 90.12
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 90.08
2r44_A331 Uncharacterized protein; putative ATPase, structur 90.06
2c9o_A456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 90.02
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 89.97
3crm_A323 TRNA delta(2)-isopentenylpyrophosphate transferase 89.97
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 89.96
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 89.92
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P- 89.91
3cf2_A806 TER ATPase, transitional endoplasmic reticulum ATP 89.9
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 89.84
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 89.84
3r20_A233 Cytidylate kinase; structural genomics, seattle st 89.81
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 89.76
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 89.67
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 89.63
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 89.58
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 89.57
2og2_A359 Putative signal recognition particle receptor; nuc 89.52
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 89.51
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 89.49
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 89.38
2qmh_A205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 89.26
3nbx_X500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 89.25
1cp2_A269 CP2, nitrogenase iron protein; oxidoreductase; 1.9 89.22
2v3c_C432 SRP54, signal recognition 54 kDa protein; nucleoti 89.21
3end_A307 Light-independent protochlorophyllide reductase ir 89.16
3foz_A316 TRNA delta(2)-isopentenylpyrophosphate transferas; 89.13
1yrb_A262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 89.01
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 89.0
3zvl_A416 Bifunctional polynucleotide phosphatase/kinase; hy 89.0
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 88.97
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 88.97
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 88.86
1a7j_A290 Phosphoribulokinase; transferase, calvin cycle; 2. 88.86
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 88.86
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 88.85
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 88.81
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 88.76
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 88.73
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 88.69
2wji_A165 Ferrous iron transport protein B homolog; membrane 88.68
1g41_A444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 88.67
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 88.63
1b0u_A262 Histidine permease; ABC transporter, transport pro 88.53
2ga8_A359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 88.52
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 88.49
3bgw_A444 DNAB-like replicative helicase; ATPase, replicatio 88.49
1g8p_A350 Magnesium-chelatase 38 kDa subunit; parallel beta 88.47
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 88.37
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 88.32
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 88.3
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 88.29
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 88.29
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 88.29
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 88.23
1q3t_A236 Cytidylate kinase; nucleotide monophosphate kinase 88.19
3l0o_A427 Transcription termination factor RHO; helicase, RH 88.18
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 88.12
2afh_E289 Nitrogenase iron protein 1; nitrogen fixation, iro 88.06
2zts_A251 Putative uncharacterized protein PH0186; KAIC like 88.06
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 88.06
1g6h_A257 High-affinity branched-chain amino acid transport 88.04
4a82_A578 Cystic fibrosis transmembrane conductance regulat; 87.96
2qgz_A308 Helicase loader, putative primosome component; str 87.93
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 87.92
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 87.8
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 87.74
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 87.68
1u0j_A267 DNA replication protein; AAA+ protein, P-loop atpa 87.62
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 87.57
2ghi_A260 Transport protein; multidrug resistance protein, M 87.54
3tpo_A529 Importin subunit alpha-2; nuclear import, protein 87.51
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 87.48
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 87.47
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 87.46
3thx_A934 DNA mismatch repair protein MSH2; ABC family ATPas 87.44
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 87.4
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 87.38
2ocp_A241 DGK, deoxyguanosine kinase; protein-nucleotide com 87.32
4f4c_A 1321 Multidrug resistance protein PGP-1; ABC transporte 87.31
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 87.21
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 87.19
3fdi_A201 Uncharacterized protein; cytidylate kinase like pr 87.08
2j37_W504 Signal recognition particle 54 kDa protein (SRP54) 87.04
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 87.01
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 86.98
2vp4_A230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 86.93
2ged_A193 SR-beta, signal recognition particle receptor beta 86.84
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 86.82
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 86.71
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 86.71
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 86.68
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 86.68
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 86.67
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 86.65
2p67_A341 LAO/AO transport system kinase; ARGK, structural G 86.62
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 86.6
3eph_A409 TRNA isopentenyltransferase; transferase, alternat 86.6
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 86.59
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 86.57
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 86.54
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 86.5
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 86.31
3ul1_B510 Importin subunit alpha-2; arm repeat, armadillo re 86.25
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 86.21
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 86.14
1p5z_B263 DCK, deoxycytidine kinase; nucleoside kinase, P-lo 86.1
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 86.09
3tpo_A 529 Importin subunit alpha-2; nuclear import, protein 86.09
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 86.07
2iw3_A986 Elongation factor 3A; acetylation, ATP-binding, pr 86.0
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 85.98
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 85.98
3kta_A182 Chromosome segregation protein SMC; structural mai 85.95
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 85.94
3k1j_A604 LON protease, ATP-dependent protease LON; ATP-bind 85.88
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 85.84
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 85.76
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 85.75
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 85.71
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 85.7
3ea0_A245 ATPase, para family; alpha-beta-alpha sandwich, st 85.67
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 85.64
3sop_A270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 85.63
1nij_A318 Hypothetical protein YJIA; structural genomics, P- 85.63
2h92_A219 Cytidylate kinase; rossmann fold, transferase; HET 85.59
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 85.59
1nrj_B218 SR-beta, signal recognition particle receptor beta 85.56
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 85.52
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 85.5
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 85.46
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 85.45
3t1o_A198 Gliding protein MGLA; G domain containing protein, 85.44
2r8r_A228 Sensor protein; KDPD, PFAM02702, MCSG, structural 85.43
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 85.43
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 85.42
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 85.42
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 85.38
3kjh_A254 CO dehydrogenase/acetyl-COA synthase complex, acce 85.34
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 85.33
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 85.28
2axn_A520 6-phosphofructo-2-kinase/fructose-2,6- biphosphata 85.27
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 85.21
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 85.17
3m6a_A543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 85.07
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 85.06
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 85.05
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 85.0
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 84.96
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 84.9
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 84.88
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 84.87
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 84.87
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 84.77
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 84.66
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 84.66
3llu_A196 RAS-related GTP-binding protein C; structural geno 84.6
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 84.55
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 84.54
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 84.49
3zq6_A324 Putative arsenical pump-driving ATPase; tail-ancho 84.49
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 84.48
1lw7_A365 Transcriptional regulator NADR; NMN, NMN adenylyl 84.43
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 84.36
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 84.35
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 84.31
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 84.23
3thx_B918 DNA mismatch repair protein MSH3; ABC family ATPas 84.19
1g8f_A511 Sulfate adenylyltransferase; alpha-beta protein, b 84.15
3rlf_A381 Maltose/maltodextrin import ATP-binding protein M; 84.1
1gwn_A205 RHO-related GTP-binding protein RHOE; GTPase, inac 84.06
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 84.05
3vr4_D465 V-type sodium ATPase subunit D; V-ATPase, rotary m 84.0
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 83.95
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 83.95
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 83.92
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 83.91
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 83.9
2cjw_A192 GTP-binding protein GEM; nucleotide-binding, small 83.88
3tqf_A181 HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co 83.87
2fh5_B214 SR-beta, signal recognition particle receptor beta 83.84
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 83.83
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 83.83
2it1_A362 362AA long hypothetical maltose/maltodextrin trans 83.79
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 83.77
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 83.75
3io3_A348 DEHA2D07832P; chaperone, membrane traffic, ATPase; 83.71
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 83.71
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 83.67
1g29_1372 MALK, maltose transport protein MALK; ATPase, acti 83.63
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 83.61
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 83.58
2www_A349 Methylmalonic aciduria type A protein, mitochondri 83.56
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 83.54
3cwq_A209 Para family chromosome partitioning protein; alpha 83.51
3nmz_A458 APC variant protein; protein-protein complex, arma 83.48
1w8a_A192 SLIT protein; signaling protein, secreted protein, 83.46
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 83.44
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 83.44
3e6j_A229 Variable lymphocyte receptor diversity region; var 83.4
1h65_A270 Chloroplast outer envelope protein OEP34; GTPase, 83.35
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 83.25
2q3h_A201 RAS homolog gene family, member U; GTPase, structu 83.25
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 83.23
4dzz_A206 Plasmid partitioning protein PARF; deviant walker 83.23
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 83.13
2qu8_A228 Putative nucleolar GTP-binding protein 1; GTPase, 83.12
3cmu_A2050 Protein RECA, recombinase A; homologous recombinat 83.08
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 83.03
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 83.01
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 82.98
1bif_A469 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; 82.95
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 82.94
2c61_A469 A-type ATP synthase non-catalytic subunit B; hydro 82.93
2o52_A200 RAS-related protein RAB-4B; G-protein, GDP, struct 82.87
3ug7_A349 Arsenical pump-driving ATPase; tail-anchored, memb 82.85
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 82.85
3gqb_B464 V-type ATP synthase beta chain; A3B3, V-ATPase, AT 82.84
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 82.8
4bas_A199 ADP-ribosylation factor, putative (small GTPase, p 82.79
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 82.74
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 82.71
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 82.67
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 82.66
4dkx_A216 RAS-related protein RAB-6A; GTP binding fold, memb 82.66
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 82.64
1tq4_A413 IIGP1, interferon-inducible GTPase; interferon gam 82.63
4edh_A213 DTMP kinase, thymidylate kinase; structural genomi 82.56
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 82.56
3lxx_A239 GTPase IMAP family member 4; structural genomics c 82.54
2atx_A194 Small GTP binding protein TC10; GTPase, P-loop, al 82.51
3def_A262 T7I23.11 protein; chloroplast, TOC33, GTPase, hydr 82.4
1p9r_A418 General secretion pathway protein E; bacterial typ 82.39
4gzl_A204 RAS-related C3 botulinum toxin substrate 1; rossma 82.37
1ega_A301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 82.34
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 82.33
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 82.33
2j1l_A214 RHO-related GTP-binding protein RHOD; GTPase, memb 82.3
3cr8_A552 Sulfate adenylyltranferase, adenylylsulfate kinase 82.3
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 82.29
3gd7_A390 Fusion complex of cystic fibrosis transmembrane co 82.25
2fv8_A207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 82.25
2j0v_A212 RAC-like GTP-binding protein ARAC7; nucleotide-bin 82.18
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 82.08
1u94_A356 RECA protein, recombinase A; homologous recombinat 82.07
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
Probab=100.00  E-value=1.1e-40  Score=393.16  Aligned_cols=305  Identities=17%  Similarity=0.194  Sum_probs=227.8

Q ss_pred             CcCccHHHHHHHHHhcC--CCceEEEEEcCCCCCHHHHHHHHHh----CCCCCccCceEEEeeeeeeecccccCCCchHH
Q 002972          161 YPISSKSKFLRKLLEQE--ETHQVILIVGLSGIGKSCLARQVAS----DPPERFVGGAVELGFGQWCSRAACNGSKSDYQ  234 (862)
Q Consensus       161 ~g~~~~~~~l~~LL~~~--~~~~vI~I~G~gGiGKTtLA~~v~~----~~~~~F~~~~~~~~~~~w~~~~~~~~s~~~~~  234 (862)
                      |||++..+.|..+|..+  .++++|+|+||||+||||||+++|+    ..+.+| ++++|++++.         ......
T Consensus       131 ~GR~~~~~~l~~~L~~~~~~~~~vv~I~G~gGvGKTtLA~~v~~~~~~~~~~~F-~~~~wv~vs~---------~~~~~~  200 (549)
T 2a5y_B          131 YIREYHVDRVIKKLDEMCDLDSFFLFLHGRAGSGKSVIASQALSKSDQLIGINY-DSIVWLKDSG---------TAPKST  200 (549)
T ss_dssp             CCCHHHHHHHHHHHHHHTTSSSEEEEEECSTTSSHHHHHHHHHHHCSSTBTTTB-SEEEEEECCC---------CSTTHH
T ss_pred             CCchHHHHHHHHHHhcccCCCceEEEEEcCCCCCHHHHHHHHHHhhhHHHhccC-CcEEEEEECC---------CCCCCH
Confidence            69998888888877543  3589999999999999999999997    445677 5677765521         111355


Q ss_pred             HHHHHHHHHHHHHhcc-ccccCCCCCCHHHHHHHHHHHhcCC-CeEEEEEcCCCchHHHHHhhccCCCceEEEEccchhh
Q 002972          235 KRLARKISKFLVQIGF-WKKIKDENSDLEYLCCLLQEALYGK-SILILLDDVWEQDIVERFAKLYDNDCKYLVTTRNEAV  312 (862)
Q Consensus       235 ~~l~~~i~~~l~~lg~-~~~~~~~~~~~~~l~~~l~~~L~~k-r~LLVLDDV~~~~~~~~l~~~~~~gsrILvTTR~~~v  312 (862)
                      ..+++.|...+..... .........+.+.+...+++.|.++ ||||||||||+.+++ .+..  .+||+||||||++.+
T Consensus       201 ~~~~~~il~~l~~~~~~~~~~~~~~~~~~~l~~~l~~~L~~~kr~LlVLDdv~~~~~~-~~~~--~~gs~ilvTTR~~~v  277 (549)
T 2a5y_B          201 FDLFTDILLMLKSEDDLLNFPSVEHVTSVVLKRMICNALIDRPNTLFVFDDVVQEETI-RWAQ--ELRLRCLVTTRDVEI  277 (549)
T ss_dssp             HHHHHHHHHHHTTTSCCTTCCCCTTCCHHHHHHHHHHHHTTSTTEEEEEEEECCHHHH-HHHH--HTTCEEEEEESBGGG
T ss_pred             HHHHHHHHHHHhcCcccccccccccccHHHHHHHHHHHHcCCCcEEEEEECCCCchhh-cccc--cCCCEEEEEcCCHHH
Confidence            6677777655532110 0001112235677889999999996 999999999998876 2222  389999999999999


Q ss_pred             hhhcc-c---ccc-cCChhhHHHHHHHHhhhcccccCcchHHHHHHHHhhhCCchHHHHHHhhhhhccCCHHHHHHHHHH
Q 002972          313 YEITE-A---EKV-ELSKDDIMEISKSILLYHSLLAEEELPAAAESLLERCGHHPLTVAVMGKALRKELRSEKWEKAITD  387 (862)
Q Consensus       313 a~~~~-~---~~~-~L~~~ea~~Lf~~~~~~~~~~~~~~l~~~~~~Iv~~cgGLPLAI~~ig~~L~~~~~~~~W~~~l~~  387 (862)
                      +..++ .   ..+ +|+.+|||+||.+.++...  .++.+++++++|+++|+|+||||+++|+.|+.+ +   |+.+ +.
T Consensus       278 ~~~~~~~~~~~~l~~L~~~ea~~Lf~~~a~~~~--~~~~~~~~~~~I~~~c~GlPLAl~~~g~~l~~~-~---w~~~-~~  350 (549)
T 2a5y_B          278 SNAASQTCEFIEVTSLEIDECYDFLEAYGMPMP--VGEKEEDVLNKTIELSSGNPATLMMFFKSCEPK-T---FEKM-AQ  350 (549)
T ss_dssp             GGGCCSCEEEEECCCCCHHHHHHHHHHTSCCCC----CHHHHHHHHHHHHHTTCHHHHHHHHTTCCSS-S---HHHH-HH
T ss_pred             HHHcCCCCeEEECCCCCHHHHHHHHHHHhcCCC--CchhHHHHHHHHHHHhCCChHHHHHHHHHhccc-h---HHHH-HH
Confidence            98764 2   223 8999999999999876432  246778899999999999999999999999764 2   5443 44


Q ss_pred             hhhhhccCCCCCCccchhhhhcccccccchhhhhccCcHHHHHHHH-----------HhcccCCCCCCChHHHHHHHHHh
Q 002972          388 LSTFATCAPGPVSYVNEKEAENTLTIFGSFEFSLEAMPRDSRRLFI-----------ALAALSWAEPVPEACLEAIWSIL  456 (862)
Q Consensus       388 L~~~~~~~~~~~~~~~~~~~~~~~~I~~~L~lSy~~L~~~~k~cfl-----------~lsiFp~~~~i~~~~L~~lW~a~  456 (862)
                      +.......             ....|..+|.+||++||+++|.||+           |||+||+++.|+    +.+|+++
T Consensus       351 l~~~l~~~-------------~~~~i~~~l~~Sy~~L~~~lk~~f~~Ls~~er~l~~~ls~fp~~~~i~----i~~w~a~  413 (549)
T 2a5y_B          351 LNNKLESR-------------GLVGVECITPYSYKSLAMALQRCVEVLSDEDRSALAFAVVMPPGVDIP----VKLWSCV  413 (549)
T ss_dssp             HHHHHHHH-------------CSSTTCCCSSSSSSSHHHHHHHHHHTSCHHHHHHTTGGGSSCTTCCEE----HHHHHHH
T ss_pred             hHHHhhcc-------------cHHHHHHHHhcccccccHHHHHHHhccchhhhhHhhheeeeCCCCeee----eeeeeee
Confidence            43322110             1136888999999999999999999           999999999988    7899998


Q ss_pred             --hh---------cchHHHHHHHHHHCCCCcccC--CCCcEEeCHHHHHHHHHhhcccc
Q 002972          457 --VQ---------KSLFSLAVCKLVEGSLLMKDD--TDPLYQVHDMVSLYLDSKTNDSI  502 (862)
Q Consensus       457 --g~---------~~~~e~~l~~L~~rsLl~~~~--~~~~~~mHdLVr~~a~~~~~e~~  502 (862)
                        |.         .+...+++++|+++||++...  ...+|+|||+||+|+++++.++.
T Consensus       414 ~~G~i~~~~~~~~~~~~~~~l~~L~~rsLl~~~~~~~~~~~~mHdlv~~~a~~~~~~~~  472 (549)
T 2a5y_B          414 IPVDICSNEEEQLDDEVADRLKRLSKRGALLSGKRMPVLTFKIDHIIHMFLKHVVDAQT  472 (549)
T ss_dssp             SCC-------CCCTHHHHHHHHHTTTBSSCSEEECSSSCEEECCHHHHHHHHTTSCTHH
T ss_pred             ccceeccCCCCCCHHHHHHHHHHHHHcCCeeEecCCCceEEEeChHHHHHHHHHHHHHH
Confidence              42         112334999999999999864  34579999999999999887653
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>3qfl_A MLA10; coiled-coil, (CC) domain, NLRS, nucleotide-binding domain, L rich repeat containing receptors, protein binding; 2.00A {Hordeum vulgare} Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Back     alignment and structure
>3fwy_A Light-independent protochlorophyllide reductase I ATP-binding protein; BCHL, electron donor, DPOR, Fe protein, nitrogenase; HET: ADP; 1.63A {Rhodobacter sphaeroides 2} Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>1jr3_D DNA polymerase III, delta subunit; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1jqj_C* 1xxh_A* 1xxi_A* 3glf_A* 3glg_A* 3glh_A* 3gli_A* Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A Back     alignment and structure
>3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>3ch4_B Pmkase, phosphomevalonate kinase; parallel beta-sheet with the strand order 23145, walker A motif, cholesterol biosynthesis, lipid synthesis; 1.76A {Homo sapiens} Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>2ck3_D ATP synthase subunit beta\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1cow_D* 1bmf_D* 1e1q_D* 1e1r_D* 1efr_D* 1e79_D* 1h8h_D* 1ohh_D* 1qo1_D 1w0j_D* 1w0k_D* 1h8e_D* 2jdi_D* 2jiz_D* 2jj1_D* 2jj2_D* 2v7q_D* 2wss_D* 2w6j_D 2w6e_D ... Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>1fx0_B ATP synthase beta chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_B* Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>1cp2_A CP2, nitrogenase iron protein; oxidoreductase; 1.93A {Clostridium pasteurianum} SCOP: c.37.1.10 Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>3l0o_A Transcription termination factor RHO; helicase, RHO factor, RNA capture mechanism, ATP-binding, hydrolase, nucleotide-binding, RN binding; 2.35A {Thermotoga maritima} Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>2afh_E Nitrogenase iron protein 1; nitrogen fixation, iron-sulfur, metal-binding, molybdenum, oxidoreductase; HET: HCA CFN CLF PGE PG4 P6G 1PE; 2.10A {Azotobacter vinelandii} SCOP: c.37.1.10 PDB: 1g1m_A 1g5p_A 1m1y_E* 1m34_E* 1n2c_E* 1nip_A* 1fp6_A* 2afi_E* 2afk_E* 2nip_A 1de0_A 1xcp_A* 1xdb_A 1xd8_A 1xd9_A* 1g20_E* 1g21_E* 2c8v_A* 1rw4_A Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Back     alignment and structure
>1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>3fdi_A Uncharacterized protein; cytidylate kinase like protein, PSI, MCSG, PRK04182 class ME structural genomics, protein structure initiative; 2.20A {Eubacterium ventriosum} Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ... Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>3ea0_A ATPase, para family; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: ATP; 2.20A {Chlorobium tepidum} Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 Back     alignment and structure
>2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>3kjh_A CO dehydrogenase/acetyl-COA synthase complex, accessory protein COOC; Zn-bound dimer, nickel binding protein, ATPase; 1.90A {Carboxydothermus hydrogenoformans} PDB: 3kjg_A* 3kje_A 3kji_A* Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3zq6_A Putative arsenical pump-driving ATPase; tail-anchored, membrane protein; HET: ADP; 2.11A {Methanothermobacter thermautotrophicusorganism_taxid} Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B* Back     alignment and structure
>1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3vr4_D V-type sodium ATPase subunit D; V-ATPase, rotary motor, P-loop, hydrolas ATPase, ATP binding; HET: MSE B3P; 2.17A {Enterococcus hirae} PDB: 3vr3_D* 3vr2_D* 3vr5_D 3vr6_D* Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Back     alignment and structure
>3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii} Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>3io3_A DEHA2D07832P; chaperone, membrane traffic, ATPase; HET: ADP; 1.80A {Debaryomyces hansenii} Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3cwq_A Para family chromosome partitioning protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: ADP; 2.47A {Synechocystis SP} Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>4dzz_A Plasmid partitioning protein PARF; deviant walker BOX, DNA segregation, unknown function; HET: ADP; 1.80A {Escherichia coli} PDB: 4e03_A* 4e07_A* 4e09_A* Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Back     alignment and structure
>2c61_A A-type ATP synthase non-catalytic subunit B; hydrolase, H+ ATPase, A1AO, ATP synthesis, hydrogen ION transport, ION transport; 1.5A {Methanosarcina mazei GO1} PDB: 3dsr_A* 3b2q_A* 2rkw_A* 3eiu_A* Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Back     alignment and structure
>3ug7_A Arsenical pump-driving ATPase; tail-anchored, membrane protein, targeting factor, ATP-bindi TRC40, ARSA, nucleotide-binding; HET: ADP; 2.90A {Methanocaldococcus jannaschii} PDB: 3ug6_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3gqb_B V-type ATP synthase beta chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_D* 3a5d_D 3j0j_D* Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Back     alignment and structure
>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4dkx_A RAS-related protein RAB-6A; GTP binding fold, membrane trafficking, GTP, cytosol, protei transport; HET: GDP; 1.90A {Homo sapiens} PDB: 3bbp_A* Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Back     alignment and structure
>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 862
d2a5yb3277 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenor 5e-16
d1knqa_171 c.37.1.17 (A:) Gluconate kinase {Escherichia coli 0.003
d1q1sc_ 434 a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus 0.004
d1qhxa_178 c.37.1.3 (A:) Chloramphenicol phosphotransferase { 0.004
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]

 Score = 76.8 bits (188), Expect = 5e-16
 Identities = 30/230 (13%), Positives = 73/230 (31%), Gaps = 14/230 (6%)

Query: 166 KSKFLRKLLE-QEETHQVILIVGLSGIGKSCLARQVASDPPERFVGGAVELGF-GQWCSR 223
             + ++KL E  +     + + G +G GKS +A Q  S   +      + + +      +
Sbjct: 29  VDRVIKKLDEMCDLDSFFLFLHGRAGSGKSVIASQALSKSDQL-----IGINYDSIVWLK 83

Query: 224 AACNGSKSDYQKRLARKISKFLVQIGFWKKIKDENSDLEYLCCLLQEALYGKSILILLDD 283
            +    KS +       +              +  + +     +    +   + L + DD
Sbjct: 84  DSGTAPKSTFDLFTDILLMLKSEDDLLNFPSVEHVTSVVLKRMICNALIDRPNTLFVFDD 143

Query: 284 VWEQDIVERFAKLYDNDCKYLVTTRNEAVYEITEAEKVELSKDDIMEISKSILLYHSLLA 343
           V +++ +       +   + LVTTR+  +          +    +        L    + 
Sbjct: 144 VVQEETIRWA---QELRLRCLVTTRDVEISNAASQTCEFIEVTSLEIDECYDFLEAYGMP 200

Query: 344 EE---ELPAAAESLLERCGHHPLTVAVMGKALRKELRSEKWEKAITDLST 390
                +        +E    +P T+ +  K+   +   EK  +    L +
Sbjct: 201 MPVGEKEEDVLNKTIELSSGNPATLMMFFKSCEPK-TFEKMAQLNNKLES 249
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Length = 171 Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 434 Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Length = 178 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query862
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 100.0
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 98.84
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 98.24
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 98.22
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 98.08
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 98.04
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 98.01
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 97.93
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 97.9
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 97.89
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 97.74
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 97.67
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 97.61
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 97.59
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 97.58
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 97.57
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 97.55
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 97.53
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 97.47
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 97.46
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 97.44
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 97.3
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 96.75
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 96.48
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 96.28
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 96.28
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 96.03
d2awna2232 Maltose transport protein MalK, N-terminal domain 95.92
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 95.91
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 95.89
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 95.81
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 95.74
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 95.66
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 95.63
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 95.63
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 95.62
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 95.6
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 95.53
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 95.52
d2qy9a2211 GTPase domain of the signal recognition particle r 95.42
d1g2912240 Maltose transport protein MalK, N-terminal domain 95.35
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 95.33
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 95.31
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 95.3
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 95.27
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 95.27
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 95.22
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 95.21
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 95.14
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 95.13
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 95.11
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 94.88
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 94.87
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 94.82
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 94.79
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 94.79
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 94.79
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 94.77
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 94.68
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 94.5
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 94.49
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 94.46
d1vmaa2213 GTPase domain of the signal recognition particle r 94.45
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 94.41
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 94.41
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 94.27
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 94.26
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 94.23
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 94.23
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 94.23
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 94.22
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 94.07
d1cp2a_269 Nitrogenase iron protein {Clostridium pasteurianum 94.0
d1ls1a2207 GTPase domain of the signal sequence recognition p 93.95
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 93.93
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 93.65
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 93.64
d1j8yf2211 GTPase domain of the signal sequence recognition p 93.64
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 93.47
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 93.45
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 93.4
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 93.33
d2jdid3276 Central domain of beta subunit of F1 ATP synthase 93.31
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 93.26
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 93.23
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 93.21
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 93.09
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 92.92
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 92.84
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 92.82
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 92.79
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 92.79
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 92.77
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 92.71
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 92.63
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 92.43
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 92.3
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 92.22
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 92.21
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 92.19
d1ihua2279 Arsenite-translocating ATPase ArsA {Escherichia co 91.99
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 91.95
d2afhe1289 Nitrogenase iron protein {Azotobacter vinelandii [ 91.79
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 91.72
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 91.67
d1okkd2207 GTPase domain of the signal recognition particle r 91.47
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 91.32
d1svma_362 Papillomavirus large T antigen helicase domain {Si 91.28
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 91.28
d1wa5b_ 503 Karyopherin alpha {Baker's yeast (Saccharomyces ce 91.12
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 91.11
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 91.07
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 90.91
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 90.86
d1ihua1296 Arsenite-translocating ATPase ArsA {Escherichia co 90.8
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 90.54
d1jdha_ 529 beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} 90.41
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 90.1
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 90.08
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 90.05
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 89.77
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 89.76
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 89.55
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 89.44
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 89.35
d1q1sc_434 Importin alpha {Mouse (Mus musculus) [TaxId: 10090 89.07
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 89.0
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 88.99
d1hyqa_232 Cell division regulator MinD {Archaeon Archaeoglob 88.94
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 88.93
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 88.89
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 88.88
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 88.85
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 88.76
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 88.7
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 88.65
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 88.6
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 88.59
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 88.31
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 88.25
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 88.17
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 88.15
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 88.13
d1g3qa_237 Cell division regulator MinD {Archaeon Pyrococcus 87.93
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 87.87
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 87.74
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 87.71
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 87.68
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 87.65
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 87.65
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 87.64
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 87.64
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 87.52
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 87.46
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 87.44
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 87.43
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 87.34
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 87.34
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 87.33
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 87.27
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 87.23
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 87.11
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 87.09
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 87.08
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 87.05
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 87.01
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 86.98
d1nrjb_209 Signal recognition particle receptor beta-subunit 86.84
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 86.84
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 86.72
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 86.63
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 86.58
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 86.56
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 86.47
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 86.4
d2fh5b1207 Signal recognition particle receptor beta-subunit 86.16
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 86.12
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 86.1
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 86.03
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 85.98
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 85.92
d1wa5b_503 Karyopherin alpha {Baker's yeast (Saccharomyces ce 85.9
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 85.47
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 85.36
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 85.32
d1q1sc_ 434 Importin alpha {Mouse (Mus musculus) [TaxId: 10090 85.31
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 85.3
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 84.96
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 84.88
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 84.84
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 84.82
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 84.56
d2hyda1255 Putative multidrug export ATP-binding/permease pro 84.53
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 84.47
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 84.38
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 84.36
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 84.29
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 84.24
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 84.05
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 84.04
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 83.96
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 83.93
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 83.78
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 83.77
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 83.62
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 83.55
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 83.47
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 83.45
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 83.12
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 83.08
d1fx0a3276 Central domain of alpha subunit of F1 ATP synthase 82.94
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 82.94
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 82.9
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 82.79
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 82.69
d1byia_224 Dethiobiotin synthetase {Escherichia coli [TaxId: 82.49
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 82.41
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 82.4
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 82.39
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 82.12
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 82.04
d1jdha_ 529 beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} 81.94
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 81.85
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 81.8
d1p9ag_266 von Willebrand factor binding domain of glycoprote 81.32
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 81.13
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 80.83
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 80.76
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 80.54
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 80.45
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 80.39
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]

Probab=100.00  E-value=2.9e-34  Score=306.31  Aligned_cols=245  Identities=15%  Similarity=0.122  Sum_probs=182.2

Q ss_pred             ccCCCcCccHHHHHHHHHhc--CCCceEEEEEcCCCCCHHHHHHHHHhCCC---CCccCceEEEeeeeeeecccccCCCc
Q 002972          157 AEQGYPISSKSKFLRKLLEQ--EETHQVILIVGLSGIGKSCLARQVASDPP---ERFVGGAVELGFGQWCSRAACNGSKS  231 (862)
Q Consensus       157 ~~~~~g~~~~~~~l~~LL~~--~~~~~vI~I~G~gGiGKTtLA~~v~~~~~---~~F~~~~~~~~~~~w~~~~~~~~s~~  231 (862)
                      .+..|||+...+.+..+|..  +.+.++|+|+||||+||||||+++|++..   ..|+++++|+.+.           ..
T Consensus        19 ~~~~~gR~~~~~~i~~~L~~~~~~~~~~v~I~GmgGiGKTtLA~~v~~~~~~~~~~~f~~~~Wv~vs-----------~~   87 (277)
T d2a5yb3          19 QMTCYIREYHVDRVIKKLDEMCDLDSFFLFLHGRAGSGKSVIASQALSKSDQLIGINYDSIVWLKDS-----------GT   87 (277)
T ss_dssp             CCCSCCCHHHHHHHHHHHHHHTTSSSEEEEEECSTTSSHHHHHHHHHHHCSSTBTTTBSEEEEEECC-----------CC
T ss_pred             CCceeCcHHHHHHHHHHHHhccCCCceEEEEECCCCCCHHHHHHHHHHhhhhhhhhcCceEEEEEec-----------CC
Confidence            35678999888777776643  34588999999999999999999998643   4466778877653           22


Q ss_pred             hHHHHHHHHHHHHHHHhcccccc--CC--CCCCHHHHHHHHHHHhcCCCeEEEEEcCCCchHHHHHhhccCCCceEEEEc
Q 002972          232 DYQKRLARKISKFLVQIGFWKKI--KD--ENSDLEYLCCLLQEALYGKSILILLDDVWEQDIVERFAKLYDNDCKYLVTT  307 (862)
Q Consensus       232 ~~~~~l~~~i~~~l~~lg~~~~~--~~--~~~~~~~l~~~l~~~L~~kr~LLVLDDV~~~~~~~~l~~~~~~gsrILvTT  307 (862)
                      .....+...+...+...+.....  +.  ...+.......+.+.+.++|+|+||||||+.++|+.+.   ..||||||||
T Consensus        88 ~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~~kr~LlVLDDv~~~~~~~~~~---~~~srilvTT  164 (277)
T d2a5yb3          88 APKSTFDLFTDILLMLKSEDDLLNFPSVEHVTSVVLKRMICNALIDRPNTLFVFDDVVQEETIRWAQ---ELRLRCLVTT  164 (277)
T ss_dssp             STTHHHHHHHHHHHHHTTTSCCTTCCCCTTCCHHHHHHHHHHHHTTSTTEEEEEEEECCHHHHHHHH---HTTCEEEEEE
T ss_pred             CCHHHHHHHHHHHHHHhcchhhcCCccchhhhhHHHHHHHHHHHhccCCeeEecchhhHHhhhhhhc---ccCceEEEEe
Confidence            33344555554444443321111  11  11233444556888899999999999999999998653   4689999999


Q ss_pred             cchhhhhhcccc----cc-cCChhhHHHHHHHHhhhcccccCcchHHHHHHHHhhhCCchHHHHHHhhhhhccCCHHHHH
Q 002972          308 RNEAVYEITEAE----KV-ELSKDDIMEISKSILLYHSLLAEEELPAAAESLLERCGHHPLTVAVMGKALRKELRSEKWE  382 (862)
Q Consensus       308 R~~~va~~~~~~----~~-~L~~~ea~~Lf~~~~~~~~~~~~~~l~~~~~~Iv~~cgGLPLAI~~ig~~L~~~~~~~~W~  382 (862)
                      |+..++..+...    .+ +|+.+||++||.+.++..  ...+..++++++|+++|+|+||||+++|+.|+.+ +.+.|.
T Consensus       165 R~~~v~~~~~~~~~~~~l~~L~~~ea~~Lf~~~~~~~--~~~~~~~~~~~~iv~~c~GlPLAl~~ig~~l~~k-~~~~~~  241 (277)
T d2a5yb3         165 RDVEISNAASQTCEFIEVTSLEIDECYDFLEAYGMPM--PVGEKEEDVLNKTIELSSGNPATLMMFFKSCEPK-TFEKMA  241 (277)
T ss_dssp             SBGGGGGGCCSCEEEEECCCCCHHHHHHHHHHTSCCC--C--CHHHHHHHHHHHHHTTCHHHHHHHHTTCCSS-SHHHHH
T ss_pred             ehHHHHHhcCCCCceEECCCCCHHHHHHHHHHHhCCc--cCchhhHHHHHHHHHHhCCCHHHHHHHHHHhccC-CHHHHH
Confidence            999998865432    23 899999999998876533  2345567899999999999999999999999865 678999


Q ss_pred             HHHHHhhhhhccCCCCCCccchhhhhcccccccchhhhhccCcHHHHHHHHHh
Q 002972          383 KAITDLSTFATCAPGPVSYVNEKEAENTLTIFGSFEFSLEAMPRDSRRLFIAL  435 (862)
Q Consensus       383 ~~l~~L~~~~~~~~~~~~~~~~~~~~~~~~I~~~L~lSy~~L~~~~k~cfl~l  435 (862)
                      +..+.|....                 ...|..++.+||++||+++|+||.++
T Consensus       242 ~~~~~L~~~~-----------------~~~v~~il~~sY~~L~~~lk~c~~~l  277 (277)
T d2a5yb3         242 QLNNKLESRG-----------------LVGVECITPYSYKSLAMALQRCVEVL  277 (277)
T ss_dssp             HHHHHHHHHC-----------------SSTTCCCSSSSSSSHHHHHHHHHHTS
T ss_pred             HHHHHHhcCc-----------------HHHHHHHHHHHHhcccHHHHHHHHhC
Confidence            8888875421                 13688899999999999999999874
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure