Citrus Sinensis ID: 003090


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------85
MATETVASVTQPITERIVDVLFNATVRQFGYLCKYKHYIEALRTEAKKLTDRRNDLQAEIDAATRNREVIKDEVKSWIAEVNDIIPKAEKFLEDEVKVNKKCLGGLCVDLKSRYKLSREAEEKTLAMSALMAVGNFGKGVSRPAPPPAIISSSEGVYAFKSRESTMKDIMEAMKDENVSITGICGMGGVGKTTLVKEIQKQAKEMKMFDDVAMAVVSQTPSITKIQYEIAGWLDLTGISLMFNDIHEVPDELECPKLQALFLQENSPLAIPDRFFQGMKDLQVLDLGGIRRFSFSVRFPFLFPPLPSSPLFLLPSSLSFLINLRTLRLHDRRIQGDLSLIGELSGLEILDLSESDVSEIPVSFGRLSHLRLLDLTGCYILELIPRGVLSRLRKLEELYMSHSFRHWQFESESEEDSSSNAKFIELGALSRLTSLHIHIPEGKIMPSDMSFQNLTSFSIAIGDLEERPLSDFIGLFLQKFKKRCSRAMGLSQDMRISALHSWIKNLLLRSEILALAEVNYFENIVSDLANDGFNELMFLVIFRCNEMKYLLNSLERTLRVTLHKLEWLFIRENQNFVEICHGQLPAGCLSNVKRSDVVDCGSILKILLSHLVQSFQNLQRLRVYSCGLLVSVFEIERVNIAKEETELFSSLEKLTLWDLPRMTDIWKGDTQFVSLHNLKKVRVEECDELRQVFPANFGKKAAAEEMVLYRKRRDQIHIHATTSTSSPTPSLGNLVSITIRGCGKLRNLFTTSMVKSLVRLESLEVRSCPTLQEIIMDDEGEVGLQGASTKKITFPSLFGIKLCDLDSLACFCSTAHHFNFVFHLGQKIREKQAMESGISSETTSSYTEN
cHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccHHHHHHHHHHHHHccccEEEEEEEccccccHHHHHHHHHHHHHHcccccEEEEEEEccccccHHHHHHccccccccccccccccccccccccccHHHHHHccccccccccHHHHcccccccEEEcccccccccccccccccccccccccccccccccccccccEEEccccccccccHHHHHcccccEEEEcccccccccHHccccccccEEEEEccccccccccHHHcccccccEEEcccccccccccccccccccccccHHHHcccccccEEEEEcccccccccccHHccccccEEcccccccccccccHHHHHHHHHcccccccccccccccccHHHHHHHHHcccccHHcccccccccccccccccccccccEEEEEcccccEEEccccccccccccccccccccccccccEEcccccccccccccccEEEEcccccccccccHHHHcccccccEEEEccccccEEEEEcccccccHHcccccccccEEEccccccccccccccccccccccccEEEEEcccccccccccccccccHHHHHHHHHcccccccccccccccccccccccccEEEEEcccccccccccccccccccccEEEEEccccccccccccccccccccccccccccccccEEEEccccccccccccccccccccccEEEEEcccccccccccccccccccc
cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccEEcccccccccccccccccccccHHHHHHHHHHHHccccccEEEEEcccccccHHHHHHHHHHHHHHccccHEEEEEEcccccHHHcHHHHHHHccccEEEEccccHHHccccccccccEEEEEcccccccccHHHHHcccccEEEEcccccccccccccccccccccccccccccHHHHHHHcccEEEccccccccccccHHcccccEEEEcccccHHHccHHHHHHHcccEEEcccccccccccHHHHHHHHHccEEEEcccccEEEEcccccccccccccHHHHHccccccEEEEEccccccccccccHHHHcEEEEEEccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHcEEcHcccccccHccccccccccccccEEEEccccccEEcccccccccHcccccccEEEEcccHcHHHHccccccccccccccEEEEcccccccEcccHHHHHccccccEEEEcccHHHHHHHcccccccccccccHcccccEEEEcccHcHHHHcccccccccccccEEEEEcccHHHHHccHHHHHHHHcccEEEEEccccEEEEEcccccccccccccccccEEEEcccccHHHcccHHHHHHcHcccEEEEcccHHHHHHHcccccHcccccccccEEEcccccEEEEcccccccHccccccccccccccEEEEEEccccEEEEcccccccEEcc
MATETVASVTQPITERIVDVLFNATVRQFGYLCKYKHYIEALRTEAKKLTDRRNDLQAEIDAATRNREVIKDEVKSWIAEVNDIIPKAEKFLEDEVKVNKKCLGGLCVDLKSRYKLSREAEEKTLAMSALMAVgnfgkgvsrpapppaiisssegvyaFKSRESTMKDIMEAMKDENVSItgicgmggvgkTTLVKEIQKQAKEMKMFDDVAMAVVSQTPSITKIQYEIAGWLDltgislmfndihevpdelecpklqalflqensplaipdrFFQGMKDlqvldlggirrfsfsvrfpflfpplpssplfllpssLSFLINLRTLRLHDRRIQGDLSligelsgleildlsesdvseipvsfgrlshlrlldltgcyilelipRGVLSRLRKLEELYMShsfrhwqfeseseedsssnakFIELGALSRLTSlhihipegkimpsdmsfqnltSFSIaigdleerplsdFIGLFLQKFKKRCSRAMGLSQDMRISALHSWIKNLLLRSEILALAEVNYFENIVSDLANDGFNELMFLVIFRCNEMKYLLNSLERTLRVTLHKLEWLFIRENQNFVEIchgqlpagclsnvkrsdvvdcGSILKILLSHLVQSFQNLQRLRVYSCGLLVSVFEIERVNIAKEETELFSSLEkltlwdlprmtdiwkgdTQFVSLHNLKKVRVEECDELRQvfpanfgkkAAAEEMVLYRKRRDQihihattstssptpslgnlvsITIRGCGKLRNLFTTSMVKSLVRleslevrscptlqeiimddegevglqgastkkitfpslfgiklcdldslacfcstahhFNFVFHLGQKIREkqamesgissettssyten
matetvasvtqpiteriVDVLFNATVRQFGYLCKYKHYIEALRTEAKKLTDRRNDLQAeidaatrnrevikDEVKSWIAEVNDIIPKAEKFLEDEVKvnkkclgglcvdlksrYKLSREAEEKTLAMSALMAVGNFGKGVSRPAPPpaiisssegvyAFKSRESTMKDIMEAMKDENVSITGICGMGGVGKTTLVKEIQKQAKEMKMFDDVAMAVVSQTPSITKIQYEIAGWLDLTGISLMFNDIHEVPDELECPKLQALFLQENSPLAIPDRFFQGMKDLQVLDLGGIRRFSFSVRFPFLFPPLPSSPLFLLPSSLSFLINLRTLRLHDRRIQGDLSLIGELSGLEILDLSESDVSEIPVSFGRLSHLRLLDLTGCYILELIPRGVLSRLRKLEELYMSHSFRHWQfeseseedssSNAKFIELGALSRLTSLHIHIPEGKIMPSDMSFQNLTSFSIAIGDLEERPLSDFIGLFLQKFKKRCSRAMGLSQDMRISALHSWIKNLLLRSEILALAEVNYFENIVSDLANDGFNELMFLVIFRCNEMKYLLNSLERTLRVTLHKLEWLFIRENQNFVEICHGQLPAGCLSNVKRSDVVDCGSILKILLSHLVQSFQNLQRLRVYSCGLLVSVFEIERVNIAKEETELFSSLEKLTLWDLPRMTDIWKGDTQFVSLHNLKKVRVEECDELRqvfpanfgkkaaAEEMVLYRKRRDQIHIhattstssptpslgNLVSITIRGCGKLRNLFTTSMVKSLVRLESLEVRSCPTLQEIIMDDEGEVGLQGASTKKITFPSLFGIKLCDLDSLACFCSTAHHFNFVFHLGQKIREKQamesgissettssyten
MATETVASVTQPITERIVDVLFNATVRQFGYLCKYKHYIEALRTEAKKLTDRRNDLQAEIDAATRNREVIKDEVKSWIAEVNDIIPKAEKFLEDEVKVNKKCLGGLCVDLKSRYKLSREAEEKTLAMSALMAVGNFGKGVsrpapppaiisssEGVYAFKSRESTMKDIMEAMKDENVSITGICGMGGVGKTTLVKEIQKQAKEMKMFDDVAMAVVSQTPSITKIQYEIAGWLDLTGISLMFNDIHEVPDELECPKLQALFLQENSPLAIPDRFFQGMKDLQVLDLGGIrrfsfsvrfpflfpplpssplfllpsslsflINLRTLRLHDRRIQGDLSLIGELSGLEILDLSESDVSEIPVSFGRLSHLRLLDLTGCYILELIPRGVLSRLRKLEELYMSHSFRHWQFeseseedsssNAKFIELGALSRLTSLHIHIPEGKIMPSDMSFQNLTSFSIAIGDLEERPLSDFIGLFLQKFKKRCSRAMGLSQDMRISALHSWIKNLLLRSEILALAEVNYFENIVSDLANDGFNELMFLVIFRCNEMKYLLNSLERTLRVTLHKLEWLFIRENQNFVEICHGQLPAGCLSNVKRSDVVDCGSILKILLSHLVQSFQNLQRLRVYSCGLLVSVFEIERVNIAKEETELFSSLEKLTLWDLPRMTDIWKGDTQFVSLHNLKKVRVEECDELRQVFPANFGKKAAAEEMVLYRKRRDQIHIHAttstssptpsLGNLVSITIRGCGKLRNLFTTSMVKSLVRLESLEVRSCPTLQEIIMDDEGEVGLQGASTKKITFPSLFGIKLCDLDSLACFCSTAHHFNFVFHLGQKIREKQAMESGISSETTSSYTEN
*********TQPITERIVDVLFNATVRQFGYLCKYKHYIEALRTEAKKL*********EIDAATRNREVIKDEVKSWIAEVNDIIPKAEKFLEDEVKVNKKCLGGLCVDLKSRYKL************************************************************NVSITGICGMGGVGKTTLVKEIQKQAKEMKMFDDVAMAVVSQTPSITKIQYEIAGWLDLTGISLMFNDIHEVPDELECPKLQALFLQENSPLAIPDRFFQGMKDLQVLDLGGIRRFSFSVRFPFLFPPLPSSPLFLLPSSLSFLINLRTLRLHDRRIQGDLSLIGELSGLEILDLSESDVSEIPVSFGRLSHLRLLDLTGCYILELIPRGVLSRLRKLEELYMSHSFRHWQF*************FIELGALSRLTSLHIHIPEGKIMPSDMSFQNLTSFSIAIGDLEERPLSDFIGLFLQKFKKRCSRAMGLSQDMRISALHSWIKNLLLRSEILALAEVNYFENIVSDLANDGFNELMFLVIFRCNEMKYLLNSLERTLRVTLHKLEWLFIRENQNFVEICHGQLPAGCLSNVKRSDVVDCGSILKILLSHLVQSFQNLQRLRVYSCGLLVSVFEIERVNIAKEETELFSSLEKLTLWDLPRMTDIWKGDTQFVSLHNLKKVRVEECDELRQVFPANFGKKAAAEEMVLYRKRRDQIHIHA**********LGNLVSITIRGCGKLRNLFTTSMVKSLVRLESLEVRSCPTLQEIIMDDEGEVGLQGASTKKITFPSLFGIKLCDLDSLACFCSTAHHFNFVFHLGQKI*********************
MATETVASVTQPITERIVDVLFNATVRQFGYLCKYKHYIEALRTEAKKLTDRRNDLQAEIDAATRNREVIKDEVKSWIAEVNDIIPKAEKFLEDEVKVNKKCLGGLCVDLKSRYKLSREAEEKTLAMSALMAVG*****************************STMKDIMEAMKDENVSITGICGMGGVGKTTLVKEIQKQAKEMKMFDDVAMAVVSQTPSITKIQYEIAGWLDLTGISLMFNDIHEVPDELECPKLQALFLQENSPLAIPDRFFQGMKDLQVLDLGGIRRFSFSVRFPFLFPPLPSSPLFLLPSSLSFLINLRTLRLHDRRIQGDLSLIGELSGLEILDLSESDVSEIPVSFGRLSHLRLLDLTGCYILELIPRGVLSRLRKLEELYMSHSFRHWQFESESEEDSSSNAKFIELGALSRLTSLHIHIPEGKIMPSDMSFQNLTSFSIAIGDLEERPLSDFIGLFLQKFKKRCSRAMGLSQDMRISALHSWIKNLLLRSEILALAEVNYFENIVSDLANDGFNELMFLVIFRCNEMKYLLNSLERTLRVTLHKLEWLFIRENQNFVEICHGQLPAGCLSNVKRSDVVDCGSILKILLSHLVQSFQNLQRLRVYSCGLLVSV*****************SLEKLTLWDLPRMTDIWKGDTQFVSLHNLKKVRVEECDELRQVFPANF*********VLYRKRRDQIHIHATTSTSSPTPSLGNLVSITIRGCGKLRNLFTTSMVKSLVRLESLEVRSCPTLQEIIM***************ITFPSLFGIKLCDLDSLACFCSTAHHFNFVFHLGQKIREKQ*****************
*********TQPITERIVDVLFNATVRQFGYLCKYKHYIEALRTEAKKLTDRRNDLQAEIDAATRNREVIKDEVKSWIAEVNDIIPKAEKFLEDEVKVNKKCLGGLCVDLKSRYKLSREAEEKTLAMSALMAVGNFGKGVSRPAPPPAIISSSEGVYAFKSRESTMKDIMEAMKDENVSITGICGMGGVGKTTLVKEIQKQAKEMKMFDDVAMAVVSQTPSITKIQYEIAGWLDLTGISLMFNDIHEVPDELECPKLQALFLQENSPLAIPDRFFQGMKDLQVLDLGGIRRFSFSVRFPFLFPPLPSSPLFLLPSSLSFLINLRTLRLHDRRIQGDLSLIGELSGLEILDLSESDVSEIPVSFGRLSHLRLLDLTGCYILELIPRGVLSRLRKLEELYMSHSFRHW************NAKFIELGALSRLTSLHIHIPEGKIMPSDMSFQNLTSFSIAIGDLEERPLSDFIGLFLQKFKKRCSRAMGLSQDMRISALHSWIKNLLLRSEILALAEVNYFENIVSDLANDGFNELMFLVIFRCNEMKYLLNSLERTLRVTLHKLEWLFIRENQNFVEICHGQLPAGCLSNVKRSDVVDCGSILKILLSHLVQSFQNLQRLRVYSCGLLVSVFEIERVNIAKEETELFSSLEKLTLWDLPRMTDIWKGDTQFVSLHNLKKVRVEECDELRQVFPANFGKKAAAEEMVLYRKRRDQIHIHATTSTSSPTPSLGNLVSITIRGCGKLRNLFTTSMVKSLVRLESLEVRSCPTLQEIIMDDEGEVGLQGASTKKITFPSLFGIKLCDLDSLACFCSTAHHFNFVFHLGQKIREK******************
MATETVASVTQPITERIVDVLFNATVRQFGYLCKYKHYIEALRTEAKKLTDRRNDLQAEIDAATRNREVIKDEVKSWIAEVNDIIPKAEKFLEDEVKVNKKCLGGLCVDLKSRYKLSREAEEKTLAMSALMAVGNFGKGVSRPAPPPAIISSSEGVYAFKSRESTMKDIMEAMKDENVSITGICGMGGVGKTTLVKEIQKQAKEMKMFDDVAMAVVSQTPSITKIQYEIAGWLDLTGISLMFNDIHEVPDELECPKLQALFLQENSPLAIPDRFFQGMKDLQVLDLGGIRRFSFSVRFPFLFPPLPSSPLFLLPSSLSFLINLRTLRLHDRRIQGDLSLIGELSGLEILDLSESDVSEIPVSFGRLSHLRLLDLTGCYILELIPRGVLSRLRKLEELYMSHSFRHWQFESESEEDSSSNAKFIELGALSRLTSLHIHIPEGKIMPSDMSFQNLTSFSIAIGDLEERPLSDFIGLFLQKFKKRCSRAMGLSQDMRISALHSWIKNLLLRSEILALAEVNYFENIVSDLANDGFNELMFLVIFRCNEMKYLLNSLERTLRVTLHKLEWLFIRENQNFVEICHGQLPAGCLSNVKRSDVVDCGSILKILLSHLVQSFQNLQRLRVYSCGLLVSVFEIERVNIAKEETELFSSLEKLTLWDLPRMTDIWKGDTQFVSLHNLKKVRVEECDELRQVFPANFGKKAAAEEMVLYRKRRDQIHIHATTSTSSPTPSLGNLVSITIRGCGKLRNLFTTSMVKSLVRLESLEVRSCPTLQEIIMDDEG*V*LQGASTKKITFPSLFGIKLCDLDSLACFCSTAHHFNFVFHLGQKIREKQAMESGISSETTS*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATETVASVTQPITERIVDVLFNATVRQFGYLCKYKHYxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxVNDIIPKAEKFLEDEVKVNKKCLGGLCVDLKSRYKLSREAEEKTLAMSALMAVGNFGKGVSRPAPPPAIISSSEGVYAFKSRESTMKDIMEAMKDENVSITGICGMGGVGKTTLVKEIQKQAKEMKMFDDVAMAVVSQTPSITKIQYEIAGWLDLTGISLMFNDIHEVPDELECPKLQALFLQENSPLAIPDRFFQGMKDLQVLDLGGIRRFSFSVRFPFLFPPLPSSPLFLLPSSLSFLINLRTLRLHDRRIQGDLSLIGELSGLEILDLSESDVSEIPVSFGRLSHLRLLDLTGCYILELIPRGVLSRLRKLEELYMSHSFRHWQFESESEEDSSSNAKFIELGALSRLTSLHIHIPEGKIMPSDMSFQNLTSFSIAIGDLEERPLSDFIGLFLQKFKKRCSRAMGLSQDMRISALHSWIKNLLLRSEILALAEVNYFENIVSDLANDGFNELMFLVIFRCNEMKYLLNSLERTLRVTLHKLEWLFIRENQNFVEICHGQLPAGCLSNVKRSDVVDCGSILKILLSHLVQSFQNLQRLRVYSCGLLVSVFEIERVNIAKEETELFSSLEKLTLWDLPRMTDIWKGDTQFVSLHNLKKVRVEECDELRQVFPANFGKKAAAEEMVLYRKRRDQIHIHATTSTSSPTPSLGNLVSITIRGCGKLRNLFTTSMVKSLVRLESLEVRSCPTLQEIIMDDEGEVGLQGASTKKITFPSLFGIKLCDLDSLACFCSTAHHFNFVFHLGQKIREKQAMESGISSETTSSYTEN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query848 2.2.26 [Sep-21-2011]
Q42484909 Disease resistance protei yes no 0.392 0.366 0.252 8e-17
Q9FLB4874 Putative disease resistan no no 0.227 0.220 0.303 7e-14
Q9T048985 Disease resistance protei no no 0.242 0.209 0.318 1e-13
P60838894 Probable disease resistan no no 0.259 0.246 0.258 2e-13
O22727 967 Probable disease resistan no no 0.239 0.209 0.306 9e-13
O81825919 Probable disease resistan no no 0.489 0.451 0.261 1e-12
O64789925 Probable disease resistan no no 0.259 0.237 0.285 7e-12
Q940K0889 Probable disease resistan no no 0.255 0.244 0.285 2e-11
Q9LMP6851 Probable disease resistan no no 0.233 0.232 0.292 1e-09
Q8RXS5888 Probable disease resistan no no 0.234 0.224 0.275 2e-09
>sp|Q42484|RPS2_ARATH Disease resistance protein RPS2 OS=Arabidopsis thaliana GN=RPS2 PE=1 SV=1 Back     alignment and function desciption
 Score = 89.7 bits (221), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 110/436 (25%), Positives = 172/436 (39%), Gaps = 103/436 (23%)

Query: 231 GWLDLTGISLMFNDIHEVPDELECPKLQALFLQENSPL-AIPDRFFQGMKDLQVLDLGGI 289
            W     ISL+ N I  +P++L CPKL  L LQ+NS L  IP  FF  M  L+VLDL   
Sbjct: 509 NWRQALVISLLDNRIQTLPEKLICPKLTTLMLQQNSSLKKIPTGFFMHMPVLRVLDLS-- 566

Query: 290 RRFSFSVRFPFLFPPLPSSPLFLLPSSLSFLINLRTLRLHDRRIQGDLSLIGELSGLEIL 349
                       F  +   PL     S+ +L+ L                         L
Sbjct: 567 ------------FTSITEIPL-----SIKYLVELYH-----------------------L 586

Query: 350 DLSESDVSEIPVSFGRLSHLRLLDLTGCYILELIPRGVLSRLRKLEELYMSHSFRHWQFE 409
            +S + +S +P   G L  L+ LDL     L+ IPR  +  L KLE L + +S+  W+ +
Sbjct: 587 SMSGTKISVLPQELGNLRKLKHLDLQRTQFLQTIPRDAICWLSKLEVLNLYYSYAGWELQ 646

Query: 410 SESEEDSSSNAKFIELGALSRLTSLHIHIPEGKIMPSDMSF-QNLTSFSIAIGDLEERPL 468
           S  E+++       ELG                   +D+ + +NLT+  I +  LE    
Sbjct: 647 SFGEDEAE------ELGF------------------ADLEYLENLTTLGITVLSLE---- 678

Query: 469 SDFIGLFLQKFKKRCSRAMGLSQDMRISALHSWIKNLLLRSEILALAEVNYFENIVSDLA 528
                               L       ALH  I++L     +    E+ YF   +  L 
Sbjct: 679 -------------------TLKTLFEFGALHKHIQHL----HVEECNELLYFN--LPSLT 713

Query: 529 NDGFNELMFLVIFRCNEMKYLLNSLERTLRVTLHKLEWLFIRENQNFVEICHGQLPAGCL 588
           N G N L  L I  C++++YL+   +      L  LE L +    N   +    +   CL
Sbjct: 714 NHGRN-LRRLSIKSCHDLEYLVTPADFE-NDWLPSLEVLTLHSLHNLTRVWGNSVSQDCL 771

Query: 589 SNVKRSDVVDCGSILKILLSHLVQSFQNLQRLRVYSCGLLVSVFEIERVNIAKEETELFS 648
            N++  ++  C  +  +     VQ    L+ + ++ C  +  +   E  + + E+  LF 
Sbjct: 772 RNIRCINISHCNKLKNV---SWVQKLPKLEVIELFDCREIEELIS-EHESPSVEDPTLFP 827

Query: 649 SLEKLTLWDLPRMTDI 664
           SL+ L   DLP +  I
Sbjct: 828 SLKTLRTRDLPELNSI 843




Disease resistance (R) protein that specifically recognizes the AvrRpt2 type III effector avirulence protein from Pseudomonas syringae. Resistance proteins guard the plant against pathogens that contain an appropriate avirulence protein via an indirect interaction with this avirulence protein. That triggers a defense system including the hypersensitive response, which restricts the pathogen growth. Acts via its interaction with RIN4, and probably triggers the plant resistance when RIN4 is degraded by AvrRpt2.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9FLB4|DRL31_ARATH Putative disease resistance protein At5g05400 OS=Arabidopsis thaliana GN=At5g05400 PE=2 SV=1 Back     alignment and function description
>sp|Q9T048|DRL27_ARATH Disease resistance protein At4g27190 OS=Arabidopsis thaliana GN=At4g27190 PE=2 SV=1 Back     alignment and function description
>sp|P60838|DRL1_ARATH Probable disease resistance protein At1g12280 OS=Arabidopsis thaliana GN=At1g12280 PE=3 SV=1 Back     alignment and function description
>sp|O22727|DRL16_ARATH Probable disease resistance protein At1g61190 OS=Arabidopsis thaliana GN=At1g61190 PE=3 SV=1 Back     alignment and function description
>sp|O81825|DRL28_ARATH Probable disease resistance protein At4g27220 OS=Arabidopsis thaliana GN=At4g27220 PE=2 SV=1 Back     alignment and function description
>sp|O64789|DRL18_ARATH Probable disease resistance protein At1g61310 OS=Arabidopsis thaliana GN=At1g61310 PE=2 SV=1 Back     alignment and function description
>sp|Q940K0|DRL15_ARATH Probable disease resistance protein At1g61180 OS=Arabidopsis thaliana GN=At1g61180 PE=2 SV=2 Back     alignment and function description
>sp|Q9LMP6|DRL3_ARATH Probable disease resistance protein At1g15890 OS=Arabidopsis thaliana GN=At1g15890 PE=3 SV=2 Back     alignment and function description
>sp|Q8RXS5|DRL40_ARATH Probable disease resistance protein At5g63020 OS=Arabidopsis thaliana GN=At5g63020 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query848
224111296 1315 cc-nbs-lrr resistance protein [Populus t 0.669 0.431 0.320 1e-63
359494129 1144 PREDICTED: disease resistance protein At 0.714 0.529 0.308 2e-61
359488103 1530 PREDICTED: disease resistance protein At 0.604 0.335 0.306 4e-57
224143316 1337 cc-nbs-lrr resistance protein [Populus t 0.630 0.400 0.337 4e-57
224111284 1340 cc-nbs-lrr resistance protein [Populus t 0.669 0.423 0.324 7e-57
255542484 2460 phosphoprotein phosphatase, putative [Ri 0.627 0.216 0.320 9e-56
359488095 1347 PREDICTED: probable disease resistance p 0.602 0.379 0.304 1e-55
147865073 1694 hypothetical protein VITISV_021876 [Viti 0.586 0.293 0.305 2e-54
359488025 1781 PREDICTED: uncharacterized protein LOC10 0.608 0.289 0.297 8e-54
297735461 1063 unnamed protein product [Vitis vinifera] 0.623 0.497 0.315 1e-53
>gi|224111296|ref|XP_002332952.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222834264|gb|EEE72741.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  251 bits (641), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 203/634 (32%), Positives = 309/634 (48%), Gaps = 66/634 (10%)

Query: 205  MKMFDDV---AMAVVSQTPSITKIQYEIAGW------LDLTGISLMFNDIHEVPDELECP 255
            +KM D V   A++V  +   +  +  E   W         T ISL F  I ++P  LECP
Sbjct: 458  VKMHDVVHSFAISVALRDHHVLTVADEFKEWPANDVLQQYTAISLPFRKIPDLPAILECP 517

Query: 256  KLQALFLQENSP-LAIPDRFFQGMKDLQVLDLGGIRRFSFSVRFPFLFPPLPSSPLFLLP 314
             L +  L    P L IPD FF+ MK+L++LDL  +                  SPL   P
Sbjct: 518  NLNSFLLLNKDPSLQIPDSFFREMKELKILDLTEVNL----------------SPL---P 558

Query: 315  SSLSFLINLRTLRLHDRRIQGDLSLIGELSGLEILDLSESDVSEIPVSFGRLSHLRLLDL 374
            SSL FL NL+TL L D  +  D+S+IGEL+ L++L L  S++  +P   G+++ L+LLDL
Sbjct: 559  SSLQFLENLQTLCL-DHCVLEDISIIGELNKLKVLSLMSSNIVRLPREIGKVTRLQLLDL 617

Query: 375  TGCYILELIPRGVLSRLRKLEELYMSHSFRHWQFESESEEDSSSNAKFIELGALSRLTSL 434
            + C  LE+I    LS L +LE+LYM +SF  W+ E  S +   +NA   EL  LS L++L
Sbjct: 618  SNCERLEVISPNALSSLTRLEDLYMGNSFVKWETEGSSSQ--RNNACLSELKHLSNLSTL 675

Query: 435  HIHIPEGKIMPSDM--SFQNLTSFSIAIGDLEERPLSDFIGLFLQKFKKRCSRAMGLSQD 492
            H+ I +   MP D+  SFQNL  F I IGD  +  + D             SR + L  +
Sbjct: 676  HMQITDADNMPKDLFSSFQNLERFRIFIGDGWDWSVKD-----------ATSRTLKLKLN 724

Query: 493  MRISALHSWIKNLLLRSEILALAEVNYFENIVSDLANDGFNELMFLVIFRCNEMKYLLNS 552
              I  L   +  LL  +E L L E+N  ++I++DL  +GF +L  L +  C  ++Y++NS
Sbjct: 725  TVIQ-LEEGVNTLLKITEELHLQELNGVKSILNDLDGEGFPQLRHLHVQNCPGVQYIINS 783

Query: 553  LERTLRVTLHKLEWLFIRENQNFVEICHGQLPAGCLSNVKRSDVVDCGSILKILLSHLVQ 612
            +    R     L+ LF+    N  +ICHGQL A  L N++   V  C  +  +    + +
Sbjct: 784  IRMGPRTAFLNLDSLFLENLDNLEKICHGQLMAESLGNLRILKVESCHRLKNLFSVSMAR 843

Query: 613  SFQNLQRLRVYSCGLLVSVFEIERVNIAKEETEL--FSSLEKLTLWDLPRMTDIWKGDTQ 670
                L+ + +  C ++  V   E  N A +   +  F+ L +LTL  LP+ T       +
Sbjct: 844  RLVRLEEITIIDCKIMEEVVAEESENDAADGEPIIEFTQLRRLTLQCLPQFTSFHSNVEE 903

Query: 671  FVSLHNLKKVRVEECDELRQVFPANFGKKAA----------AEEMVLYRKRRDQIHIHAT 720
                   +K+   E      V     G   +           E++ L   + ++I  H  
Sbjct: 904  SSDSQRRQKLLASEARSKEIVAGNELGTSMSLFNTKILFPNLEDLKLSSIKVEKIW-HDQ 962

Query: 721  TSTSSPTPSLGNLVSITIRGCGKLRNLFTTSMVKSLVRLESLEVRSCPTLQEIIM-DDEG 779
             S  SP   + NL SI +  C  L  L T+SMV+SL +L+ LE+ +C +++EI++ +D G
Sbjct: 963  PSVQSPC--VKNLASIAVENCRNLNYLLTSSMVESLAQLKKLEICNCKSMEEIVVPEDIG 1020

Query: 780  EVGLQGASTKKITFPSLFGIKLCDLDSLACFCST 813
            E    G    K+ FP L  + L  L  L  FC++
Sbjct: 1021 E----GKMMSKMLFPKLLILSLIRLPKLTRFCTS 1050




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359494129|ref|XP_002278428.2| PREDICTED: disease resistance protein At4g27190-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359488103|ref|XP_002263579.2| PREDICTED: disease resistance protein At4g27190-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224143316|ref|XP_002336027.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222838884|gb|EEE77235.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224111284|ref|XP_002332949.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222834261|gb|EEE72738.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255542484|ref|XP_002512305.1| phosphoprotein phosphatase, putative [Ricinus communis] gi|223548266|gb|EEF49757.1| phosphoprotein phosphatase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|359488095|ref|XP_002270726.2| PREDICTED: probable disease resistance protein At4g27220-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147865073|emb|CAN83232.1| hypothetical protein VITISV_021876 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359488025|ref|XP_003633688.1| PREDICTED: uncharacterized protein LOC100852821 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297735461|emb|CBI17901.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query848
TAIR|locus:2034770894 SUMM2 "AT1G12280" [Arabidopsis 0.259 0.246 0.245 7.4e-25
TAIR|locus:2201996889 RPS5 "AT1G12220" [Arabidopsis 0.268 0.256 0.246 7.6e-22
TAIR|locus:2008510 967 AT1G61190 "AT1G61190" [Arabido 0.239 0.209 0.282 1.5e-20
TAIR|locus:2008440899 AT1G61180 [Arabidopsis thalian 0.255 0.241 0.263 9.3e-20
TAIR|locus:2136447 985 AT4G27190 [Arabidopsis thalian 0.253 0.218 0.228 1.3e-19
TAIR|locus:2153474874 AT5G05400 [Arabidopsis thalian 0.226 0.219 0.297 2e-19
TAIR|locus:2166320888 AT5G63020 [Arabidopsis thalian 0.234 0.224 0.280 4.1e-17
TAIR|locus:2034765884 AT1G12290 [Arabidopsis thalian 0.253 0.243 0.226 1.2e-16
TAIR|locus:2201986885 RFL1 "AT1G12210" [Arabidopsis 0.246 0.236 0.253 1.2e-15
TAIR|locus:2131689919 AT4G27220 [Arabidopsis thalian 0.412 0.380 0.262 1.5e-13
TAIR|locus:2034770 SUMM2 "AT1G12280" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 203 (76.5 bits), Expect = 7.4e-25, Sum P(4) = 7.4e-25
 Identities = 56/228 (24%), Positives = 109/228 (47%)

Query:    15 ERIVDVLFNATVRQFGYLCKYKHYIEALRTEAKKLTDRRNDLQAEIDAA--TRNREVIKD 72
             + +V+ +        GY+C+    + A++ + + L  +R+D++  +D    TR RE +  
Sbjct:    12 DEVVNQISQGLCINVGYICELSKNVVAMKKDMEVLKKKRDDVKRRVDIEEFTRRRERLS- 70

Query:    73 EVKSWIAEVNDIIPKAEKFLE-DEVKVNKKCLGGLCV-DLKSRYKLSREAEEKTLAMSAL 130
             +V+ W+  V+ +  K  + L  ++ ++ + CL G C  ++K  Y   +        + +L
Sbjct:    71 QVQGWLTNVSTVENKFNELLTTNDAELQRLCLFGFCSKNVKMSYLYGKRVVLMLKEIESL 130

Query:   131 MAVGNFGKGVXXXXXXXXXXXXXEGVYAFKSRESTMKDIMEAMKDENVSITGICGMGGVG 190
              + G+F                 +       +E+ ++ +   + ++   I G+ GMGGVG
Sbjct:   131 SSQGDFDTVTLATPIARIEEMPIQPTIV--GQETMLERVWTRLTEDGDEIVGLYGMGGVG 188

Query:   191 KTTLVKEIQ-KQAKEMKMFDDVAMAVVSQTPSITKIQYEIAGWLDLTG 237
             KTTL+  I  K +++   F  V   VVS++P I +IQ +I   LDL G
Sbjct:   189 KTTLLTRINNKFSEKCSGFGVVIWVVVSKSPDIHRIQGDIGKRLDLGG 236


GO:0006952 "defense response" evidence=IGI;ISS
GO:0043531 "ADP binding" evidence=IEA
TAIR|locus:2201996 RPS5 "AT1G12220" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2008510 AT1G61190 "AT1G61190" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2008440 AT1G61180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2136447 AT4G27190 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2153474 AT5G05400 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2166320 AT5G63020 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2034765 AT1G12290 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2201986 RFL1 "AT1G12210" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2131689 AT4G27220 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00027341001
SubName- Full=Chromosome chr19 scaffold_4, whole genome shotgun sequence; (963 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query848
pfam00931285 pfam00931, NB-ARC, NB-ARC domain 3e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 5e-07
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 9e-07
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 4e-06
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-04
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 9e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.003
>gnl|CDD|216202 pfam00931, NB-ARC, NB-ARC domain Back     alignment and domain information
 Score = 55.8 bits (135), Expect = 3e-08
 Identities = 31/92 (33%), Positives = 50/92 (54%), Gaps = 6/92 (6%)

Query: 167 KDIMEAMKD------ENVSITGICGMGGVGKTTLVKEIQKQAKEMKMFDDVAMAVVSQTP 220
           +D++EA+ +      +N+ + GI GMGGVGKTTL K+I         FD VA  VVS+T 
Sbjct: 2   EDMIEALIEKLLEMSDNLGVVGIVGMGGVGKTTLAKQIYNDDSVGGHFDSVAWVVVSKTY 61

Query: 221 SITKIQYEIAGWLDLTGISLMFNDIHEVPDEL 252
           +  ++Q +I   L L     +  +  E+  ++
Sbjct: 62  TEFRLQKDILQELGLDDSDWVEKNESELAVKI 93


Length = 285

>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 848
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 100.0
PLN03210 1153 Resistant to P. syringae 6; Provisional 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.97
PLN032101153 Resistant to P. syringae 6; Provisional 99.9
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.87
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.86
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.86
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.86
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.86
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.83
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.82
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.74
KOG0617264 consensus Ras suppressor protein (contains leucine 99.61
KOG0617264 consensus Ras suppressor protein (contains leucine 99.57
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.44
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.43
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.4
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.37
KOG4237498 consensus Extracellular matrix protein slit, conta 99.29
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.22
KOG4237498 consensus Extracellular matrix protein slit, conta 99.18
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.16
KOG4341483 consensus F-box protein containing LRR [General fu 99.14
KOG0532722 consensus Leucine-rich repeat (LRR) protein, conta 99.07
KOG0532722 consensus Leucine-rich repeat (LRR) protein, conta 99.05
KOG4341483 consensus F-box protein containing LRR [General fu 99.02
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.96
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 98.9
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.86
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.81
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.74
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.7
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.7
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.66
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.65
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.64
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.47
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.45
PLN03150623 hypothetical protein; Provisional 98.36
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.32
PRK15386 426 type III secretion protein GogB; Provisional 98.27
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.23
PLN03150623 hypothetical protein; Provisional 98.23
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.13
PRK15386 426 type III secretion protein GogB; Provisional 98.11
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.02
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.95
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.88
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 97.87
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.8
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.76
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.74
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.72
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.68
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 97.67
PRK09376416 rho transcription termination factor Rho; Provisio 97.52
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.52
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.52
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.47
PF05659147 RPW8: Arabidopsis broad-spectrum mildew resistance 97.46
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.4
cd01128249 rho_factor Transcription termination factor rho is 97.39
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.32
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.22
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.16
PTZ00202550 tuzin; Provisional 97.0
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.98
PRK11331459 5-methylcytosine-specific restriction enzyme subun 96.93
KOG2982418 consensus Uncharacterized conserved protein [Funct 96.91
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 96.85
PRK08118167 topology modulation protein; Reviewed 96.67
TIGR00767415 rho transcription termination factor Rho. Members 96.52
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 96.52
PRK00411394 cdc6 cell division control protein 6; Reviewed 96.4
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 96.2
TIGR02928365 orc1/cdc6 family replication initiation protein. M 96.1
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 95.9
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 95.87
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 95.31
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.29
KOG3864221 consensus Uncharacterized conserved protein [Funct 95.24
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 95.14
TIGR02903615 spore_lon_C ATP-dependent protease, Lon family. Me 95.09
COG0466782 Lon ATP-dependent Lon protease, bacterial type [Po 95.07
KOG2123388 consensus Uncharacterized conserved protein [Funct 94.98
PRK07261171 topology modulation protein; Provisional 94.65
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 94.64
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 94.6
KOG3864221 consensus Uncharacterized conserved protein [Funct 94.57
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 94.51
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 94.43
PRK06696223 uridine kinase; Validated 94.03
KOG2028554 consensus ATPase related to the helicase subunit o 94.02
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 93.89
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 93.62
PRK04195482 replication factor C large subunit; Provisional 93.61
PRK13342413 recombination factor protein RarA; Reviewed 93.43
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 93.43
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 93.33
PRK15455644 PrkA family serine protein kinase; Provisional 93.32
PRK07667193 uridine kinase; Provisional 93.16
PRK00440319 rfc replication factor C small subunit; Reviewed 93.07
PRK09270229 nucleoside triphosphate hydrolase domain-containin 92.96
PLN03025319 replication factor C subunit; Provisional 92.94
KOG2004906 consensus Mitochondrial ATP-dependent protease PIM 92.93
CHL00095821 clpC Clp protease ATP binding subunit 92.85
COG0542786 clpA ATP-binding subunits of Clp protease and DnaK 92.84
KOG0991333 consensus Replication factor C, subunit RFC2 [Repl 92.8
PF00485194 PRK: Phosphoribulokinase / Uridine kinase family; 92.66
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 92.55
PRK12402337 replication factor C small subunit 2; Reviewed 92.54
PRK06547172 hypothetical protein; Provisional 92.27
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 92.19
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 92.11
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 92.07
PF12061402 DUF3542: Protein of unknown function (DUF3542); In 91.96
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 91.87
PTZ00301210 uridine kinase; Provisional 91.85
TIGR00763775 lon ATP-dependent protease La. This protein is ind 91.75
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 91.75
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 91.71
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 91.69
PRK05480209 uridine/cytidine kinase; Provisional 91.66
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 91.58
PHA02544316 44 clamp loader, small subunit; Provisional 91.57
CHL00181287 cbbX CbbX; Provisional 91.46
PF13173128 AAA_14: AAA domain 91.45
PF05729166 NACHT: NACHT domain 91.36
TIGR00235207 udk uridine kinase. Model contains a number of lon 91.36
PRK10865857 protein disaggregation chaperone; Provisional 91.31
PRK14963504 DNA polymerase III subunits gamma and tau; Provisi 91.21
PHA00729226 NTP-binding motif containing protein 91.18
COG1618179 Predicted nucleotide kinase [Nucleotide transport 91.07
PTZ001121164 origin recognition complex 1 protein; Provisional 90.98
) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309127 Torsin: Torsin; InterPro: IPR010448 This family co 90.88
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 90.87
PRK13341725 recombination factor protein RarA/unknown domain f 90.83
COG2256436 MGS1 ATPase related to the helicase subunit of the 90.81
PRK08233182 hypothetical protein; Provisional 90.8
KOG0473326 consensus Leucine-rich repeat protein [Function un 90.48
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 90.38
PRK06762166 hypothetical protein; Provisional 90.35
PF03205140 MobB: Molybdopterin guanine dinucleotide synthesis 90.27
COG2255332 RuvB Holliday junction resolvasome, helicase subun 90.19
PF00158168 Sigma54_activat: Sigma-54 interaction domain; Inte 89.99
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 89.79
COG1763161 MobB Molybdopterin-guanine dinucleotide biosynthes 89.71
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 89.69
KOG2543438 consensus Origin recognition complex, subunit 5 [R 89.65
PRK10865857 protein disaggregation chaperone; Provisional 89.63
COG1428216 Deoxynucleoside kinases [Nucleotide transport and 89.51
cd02025220 PanK Pantothenate kinase (PanK) catalyzes the phos 89.31
COG0572218 Udk Uridine kinase [Nucleotide transport and metab 89.23
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 89.22
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 89.2
KOG1532366 consensus GTPase XAB1, interacts with DNA repair p 89.14
PRK14962472 DNA polymerase III subunits gamma and tau; Provisi 88.99
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 88.95
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 88.87
PRK03992389 proteasome-activating nucleotidase; Provisional 88.86
cd02024187 NRK1 Nicotinamide riboside kinase (NRK) is an enzy 88.85
TIGR00554290 panK_bact pantothenate kinase, bacterial type. Sho 88.75
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 88.71
KOG0473326 consensus Leucine-rich repeat protein [Function un 88.57
PRK03839180 putative kinase; Provisional 88.54
COG1084346 Predicted GTPase [General function prediction only 88.53
TIGR01360188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 88.52
PRK10751173 molybdopterin-guanine dinucleotide biosynthesis pr 88.49
PRK05541176 adenylylsulfate kinase; Provisional 88.43
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, c 88.4
PRK00771437 signal recognition particle protein Srp54; Provisi 88.34
cd01878204 HflX HflX subfamily. A distinct conserved domain w 88.2
PRK14956484 DNA polymerase III subunits gamma and tau; Provisi 88.19
COG1223368 Predicted ATPase (AAA+ superfamily) [General funct 88.08
PRK08903227 DnaA regulatory inactivator Hda; Validated 88.03
TIGR00150133 HI0065_YjeE ATPase, YjeE family. Members of this f 88.0
PRK05564313 DNA polymerase III subunit delta'; Validated 87.94
TIGR00176155 mobB molybdopterin-guanine dinucleotide biosynthes 87.89
PRK10463290 hydrogenase nickel incorporation protein HypB; Pro 87.79
PRK14957546 DNA polymerase III subunits gamma and tau; Provisi 87.75
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 87.7
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 87.66
TIGR02030337 BchI-ChlI magnesium chelatase ATPase subunit I. Th 87.56
PRK04040188 adenylate kinase; Provisional 87.54
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 87.49
KOG1969877 consensus DNA replication checkpoint protein CHL12 87.47
PRK00889175 adenylylsulfate kinase; Provisional 87.45
CHL00081350 chlI Mg-protoporyphyrin IX chelatase 87.44
PRK10536262 hypothetical protein; Provisional 87.4
cd02028179 UMPK_like Uridine monophosphate kinase_like (UMPK_ 87.39
PRK05896605 DNA polymerase III subunits gamma and tau; Validat 87.37
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 87.34
smart0037026 LRR Leucine-rich repeats, outliers. 87.34
COG3640255 CooC CO dehydrogenase maturation factor [Cell divi 87.29
PRK00625173 shikimate kinase; Provisional 87.13
PRK08084235 DNA replication initiation factor; Provisional 87.09
PRK10787784 DNA-binding ATP-dependent protease La; Provisional 87.02
TIGR02322179 phosphon_PhnN phosphonate metabolism protein/1,5-b 86.83
TIGR00073207 hypB hydrogenase accessory protein HypB. HypB is i 86.37
PRK10867433 signal recognition particle protein; Provisional 86.21
PRK03846198 adenylylsulfate kinase; Provisional 86.18
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 86.18
TIGR03263180 guanyl_kin guanylate kinase. Members of this famil 86.17
PRK14960702 DNA polymerase III subunits gamma and tau; Provisi 86.14
PF08298358 AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 Thi 86.04
PRK06217183 hypothetical protein; Validated 86.0
PF01583156 APS_kinase: Adenylylsulphate kinase; InterPro: IPR 85.96
TIGR02902531 spore_lonB ATP-dependent protease LonB. Members of 85.85
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 85.67
PRK00131175 aroK shikimate kinase; Reviewed 85.63
cd02020147 CMPK Cytidine monophosphate kinase (CMPK) catalyze 85.62
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 85.61
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 85.51
PRK13531498 regulatory ATPase RavA; Provisional 85.47
PRK14964491 DNA polymerase III subunits gamma and tau; Provisi 85.35
PRK13949169 shikimate kinase; Provisional 85.32
PRK08727233 hypothetical protein; Validated 84.93
PRK10078186 ribose 1,5-bisphosphokinase; Provisional 84.83
smart00382148 AAA ATPases associated with a variety of cellular 84.77
PRK09087226 hypothetical protein; Validated 84.75
PRK12323700 DNA polymerase III subunits gamma and tau; Provisi 84.71
PRK06893229 DNA replication initiation factor; Validated 84.69
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 84.65
PRK08691709 DNA polymerase III subunits gamma and tau; Validat 84.65
TIGR00602637 rad24 checkpoint protein rad24. This family is bas 84.64
PRK00300205 gmk guanylate kinase; Provisional 84.63
PRK13695174 putative NTPase; Provisional 84.56
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 84.53
PRK14958509 DNA polymerase III subunits gamma and tau; Provisi 84.5
PF00005137 ABC_tran: ABC transporter This structure is on hol 84.44
PRK05057172 aroK shikimate kinase I; Reviewed 84.44
PRK13975196 thymidylate kinase; Provisional 84.43
COG0194191 Gmk Guanylate kinase [Nucleotide transport and met 84.37
PRK14970367 DNA polymerase III subunits gamma and tau; Provisi 84.34
PRK06620214 hypothetical protein; Validated 84.31
PF00910107 RNA_helicase: RNA helicase; InterPro: IPR000605 He 84.25
PRK14493274 putative bifunctional molybdopterin-guanine dinucl 84.17
cd00464154 SK Shikimate kinase (SK) is the fifth enzyme in th 84.07
PF08477119 Miro: Miro-like protein; InterPro: IPR013684 Mitoc 84.06
cd00820107 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC 84.04
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 84.03
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. 84.01
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phospho 84.0
TIGR01359183 UMP_CMP_kin_fam UMP-CMP kinase family. This subfam 83.95
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) cat 83.92
PF00004132 AAA: ATPase family associated with various cellula 83.92
PF05673249 DUF815: Protein of unknown function (DUF815); Inte 83.81
cd03116159 MobB Molybdenum is an essential trace element in t 83.79
TIGR02237209 recomb_radB DNA repair and recombination protein R 83.74
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). 83.69
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 83.5
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 83.43
COG2019189 AdkA Archaeal adenylate kinase [Nucleotide transpo 83.25
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r 83.22
PRK13947171 shikimate kinase; Provisional 83.15
CHL00095821 clpC Clp protease ATP binding subunit 83.1
TIGR01287275 nifH nitrogenase iron protein. This model describe 82.96
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 82.95
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 82.95
PRK08154309 anaerobic benzoate catabolism transcriptional regu 82.94
PRK09111598 DNA polymerase III subunits gamma and tau; Validat 82.88
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 82.85
PRK14954620 DNA polymerase III subunits gamma and tau; Provisi 82.81
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 82.8
COG1126240 GlnQ ABC-type polar amino acid transport system, A 82.8
cd01672200 TMPK Thymidine monophosphate kinase (TMPK), also k 82.77
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 82.57
PF03193161 DUF258: Protein of unknown function, DUF258; Inter 82.54
COG1936180 Predicted nucleotide kinase (related to CMP and AM 82.48
PRK09825176 idnK D-gluconate kinase; Provisional 82.38
PRK14951618 DNA polymerase III subunits gamma and tau; Provisi 82.36
PLN02796347 D-glycerate 3-kinase 82.28
PRK09112351 DNA polymerase III subunit delta'; Validated 82.13
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 82.12
PRK13946184 shikimate kinase; Provisional 81.96
COG0563178 Adk Adenylate kinase and related kinases [Nucleoti 81.91
PRK14490369 putative bifunctional molybdopterin-guanine dinucl 81.89
smart0037026 LRR Leucine-rich repeats, outliers. 81.77
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 81.77
PRK13236296 nitrogenase reductase; Reviewed 81.75
TIGR00959428 ffh signal recognition particle protein. This mode 81.72
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 81.69
PF10662143 PduV-EutP: Ethanolamine utilisation - propanediol 81.64
KOG0781587 consensus Signal recognition particle receptor, al 81.63
KOG0727408 consensus 26S proteasome regulatory complex, ATPas 81.59
PRK06645507 DNA polymerase III subunits gamma and tau; Validat 81.57
PRK13232273 nifH nitrogenase reductase; Reviewed 81.57
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 81.52
PRK12339197 2-phosphoglycerate kinase; Provisional 81.49
PF06564243 YhjQ: YhjQ protein; InterPro: IPR017746 The YhjQ p 81.48
PRK04182180 cytidylate kinase; Provisional 81.41
PRK14723767 flhF flagellar biosynthesis regulator FlhF; Provis 81.39
PRK14969527 DNA polymerase III subunits gamma and tau; Provisi 81.39
PRK14530215 adenylate kinase; Provisional 81.38
PRK13230279 nitrogenase reductase-like protein; Reviewed 81.38
PRK13407334 bchI magnesium chelatase subunit I; Provisional 81.35
PLN02348395 phosphoribulokinase 81.32
cd02117212 NifH_like This family contains the NifH (iron prot 81.31
PLN02318656 phosphoribulokinase/uridine kinase 81.29
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 81.26
cd0198399 Fer4_NifH The Fer4_NifH superfamily contains a var 81.21
PRK14952584 DNA polymerase III subunits gamma and tau; Provisi 81.21
COG1100219 GTPase SAR1 and related small G proteins [General 81.0
PF01926116 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I 80.91
TIGR01166190 cbiO cobalt transport protein ATP-binding subunit. 80.9
cd04139164 RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) 80.89
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 80.89
PRK15453290 phosphoribulokinase; Provisional 80.87
PRK05439311 pantothenate kinase; Provisional 80.87
TIGR01313163 therm_gnt_kin carbohydrate kinase, thermoresistant 80.73
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 80.72
PRK05201443 hslU ATP-dependent protease ATP-binding subunit Hs 80.65
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 80.6
PRK13948182 shikimate kinase; Provisional 80.56
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 80.5
PRK07994647 DNA polymerase III subunits gamma and tau; Validat 80.46
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 80.46
PRK07471365 DNA polymerase III subunit delta'; Validated 80.44
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 80.41
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 80.41
PRK06761282 hypothetical protein; Provisional 80.32
TIGR00390441 hslU ATP-dependent protease HslVU, ATPase subunit. 80.26
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 80.23
PRK05642234 DNA replication initiation factor; Validated 80.18
cd02040270 NifH NifH gene encodes component II (iron protein) 80.09
PRK08939306 primosomal protein DnaI; Reviewed 80.03
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
Probab=100.00  E-value=2.7e-39  Score=372.60  Aligned_cols=365  Identities=26%  Similarity=0.333  Sum_probs=271.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHhccccchHHHHHHHHHHHHHHHHHHHHHHHHHH-----------------hhccc
Q 003090           40 EALRTEAKKLTDRRNDLQAEIDAATRNREVIKDEVKSWIAEVNDIIPKAEKFLEDEVK-----------------VNKKC  102 (848)
Q Consensus        40 ~~~~~~l~~L~~~l~~i~~~l~~a~~~~~~~~~~v~~wl~~lk~~~~d~eD~lde~~~-----------------~~~~~  102 (848)
                      .+.++.+..|++.+..++.++++|+++ +.....+..|.+.+++++|++||+++.+..                 .+.-|
T Consensus        24 ~~~~~~i~~Lk~~L~~l~~~l~d~~a~-~~~~~~~~~~~e~~~~~~~~~e~~~~~~~v~~~~~~~~~~l~~~~~~~~~~c  102 (889)
T KOG4658|consen   24 DGKDNYILELKENLKALQSALEDLDAK-RDDLERRVNWEEDVGDLVYLAEDIIWLFLVEEIERKANDLLSTRSVERQRLC  102 (889)
T ss_pred             hchHHHHHHHHHHHHHHHHHHHHHHhh-cchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHhhhhHHHHHHHh
Confidence            377889999999999999999999998 788999999999999999999999998821                 12233


Q ss_pred             cCCccc-chhhHhHHhHHHHHHHHHHHHHHHcCCCCCcccc-CCCCCCcccCCc-ccccccchhHHHHHHHHHHhcCCcc
Q 003090          103 LGGLCV-DLKSRYKLSREAEEKTLAMSALMAVGNFGKGVSR-PAPPPAIISSSE-GVYAFKSRESTMKDIMEAMKDENVS  179 (848)
Q Consensus       103 ~~~~~~-~~~~~~~~~~~i~~~~~~v~~~~~~~~~~~~~~~-~~~~~~~~~~~~-~~~~~vG~~~~~~~i~~~L~~~~~~  179 (848)
                      +.+++. .....+.+++++.++.+.++.+..++.|+. +.. ..++......+. .+.. ||.++.++++++.|.+++..
T Consensus       103 ~~~~~~~~~~~~~~~~~rv~~~l~~ve~l~~~~~~~~-~~~~~~~~~~~e~~~~~~~~~-VG~e~~~~kl~~~L~~d~~~  180 (889)
T KOG4658|consen  103 LCGFCSKNVSDSYKYGKRVSKVLREVESLGSKGVFEV-VGESLDPREKVETRPIQSESD-VGLETMLEKLWNRLMEDDVG  180 (889)
T ss_pred             hhhhHhHhhhhhHhHHHHHHHHHHHHHHhccccceec-ccccccchhhcccCCCCcccc-ccHHHHHHHHHHHhccCCCC
Confidence            334442 345566778888888888888877776766 332 223333333333 2223 99999999999999988889


Q ss_pred             EEEEEeCCCCchhHHHHHHHHHHh-hccccCcEEEEEeccCCchhHHHHHHHhccCCCc---------------------
Q 003090          180 ITGICGMGGVGKTTLVKEIQKQAK-EMKMFDDVAMAVVSQTPSITKIQYEIAGWLDLTG---------------------  237 (848)
Q Consensus       180 vi~i~G~gG~GKTtla~~v~~~~~-~~~~F~~~~wv~vs~~~~~~~l~~~i~~~~~l~~---------------------  237 (848)
                      +++|+||||+||||||+.|||+.. ++.+||.++||+||++|+...++++|++.+....                     
T Consensus       181 iv~i~GMGGvGKTTL~~qi~N~~~~v~~~Fd~~iWV~VSk~f~~~~iq~~Il~~l~~~~~~~~~~~~~~~~~~i~~~L~~  260 (889)
T KOG4658|consen  181 IVGIYGMGGVGKTTLARQIFNKFDEVGNHFDGVIWVVVSKEFTTRKIQQTILERLGLLDEEWEDKEEDELASKLLNLLEG  260 (889)
T ss_pred             EEEEECCCcccHHHHHHHHhcccchhcccCceEEEEEEcccccHHhHHHHHHHHhccCCcccchhhHHHHHHHHHHHhcc
Confidence            999999999999999999999998 9999999999999999999999999999665411                     


Q ss_pred             --------------------------------------------------------------------------------
Q 003090          238 --------------------------------------------------------------------------------  237 (848)
Q Consensus       238 --------------------------------------------------------------------------------  237 (848)
                                                                                                      
T Consensus       261 krfllvLDDIW~~~dw~~I~~~~p~~~~g~KvvlTTRs~~V~~~~m~~~~~~~v~~L~~~eaW~LF~~~v~~~~~~~~~~  340 (889)
T KOG4658|consen  261 KRFLLVLDDIWEEVDWDKIGVPFPSRENGSKVVLTTRSEEVCGRAMGVDYPIEVECLTPEEAWDLFQKKVGPNTLGSHPD  340 (889)
T ss_pred             CceEEEEecccccccHHhcCCCCCCccCCeEEEEEeccHhhhhccccCCccccccccCccccHHHHHHhhcccccccccc
Confidence                                                                                            


Q ss_pred             ------------------------------------------------------------eeeecC--------------
Q 003090          238 ------------------------------------------------------------ISLMFN--------------  243 (848)
Q Consensus       238 ------------------------------------------------------------l~l~~n--------------  243 (848)
                                                                                  +.+|+.              
T Consensus       341 i~~lak~v~~kC~GLPLAl~viG~~ma~K~t~~eW~~~~~~l~s~~~~~~~~~~~~i~~iLklSyd~L~~~lK~CFLyca  420 (889)
T KOG4658|consen  341 IEELAKEVAEKCGGLPLALNVLGGLLACKKTVQEWRRALNVLKSSLAADFSGMEESILPILKLSYDNLPEELKSCFLYCA  420 (889)
T ss_pred             HHHHHHHHHHHhCChHHHHHHHHHHhcCCCcHHHHHHHHccccccccCCCCchhhhhHHhhhccHhhhhHHHHHHHHhhc
Confidence                                                                        000000              


Q ss_pred             --------------------------------------------------------------------------------
Q 003090          244 --------------------------------------------------------------------------------  243 (848)
Q Consensus       244 --------------------------------------------------------------------------------  243 (848)
                                                                                                      
T Consensus       421 lFPED~~I~~e~Li~yWiaEGfi~~~~~~~~~~d~G~~~i~~LV~~~Ll~~~~~~~~~~~~kmHDvvRe~al~ias~~~~  500 (889)
T KOG4658|consen  421 LFPEDYEIKKEKLIEYWIAEGFIDPLDGGETAEDVGYDYIEELVRASLLIEERDEGRKETVKMHDVVREMALWIASDFGK  500 (889)
T ss_pred             cCCcccccchHHHHHHHHhccCcCccccccchhcchHHHHHHHHHHHHHhhcccccceeEEEeeHHHHHHHHHHhccccc
Confidence                                                                                            


Q ss_pred             -----------CCcccCCcccccccceeecccCcCcccChHHHccCCceeEEEccCcccccccccCCCCCCC--CCCCCC
Q 003090          244 -----------DIHEVPDELECPKLQALFLQENSPLAIPDRFFQGMKDLQVLDLGGIRRFSFSVRFPFLFPP--LPSSPL  310 (848)
Q Consensus       244 -----------~l~~lp~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~Lr~L~l~~~~~~~~~~~~~~~~~~--l~~~~~  310 (848)
                                 ...+.|+.......|...+-+|.+..++.+  ...+.|++|-+.+              +.  +...  
T Consensus       501 ~~e~~iv~~~~~~~~~~~~~~~~~~rr~s~~~~~~~~~~~~--~~~~~L~tLll~~--------------n~~~l~~i--  562 (889)
T KOG4658|consen  501 QEENQIVSDGVGLSEIPQVKSWNSVRRMSLMNNKIEHIAGS--SENPKLRTLLLQR--------------NSDWLLEI--  562 (889)
T ss_pred             cccceEEECCcCccccccccchhheeEEEEeccchhhccCC--CCCCccceEEEee--------------cchhhhhc--
Confidence                       111122222334445555555555555554  3566788888888              43  4441  


Q ss_pred             CCCCchhhhcccCcEEEccCcccc-CCchhhccccCCCEEEccCCCCcccChhhccCCcccEEeccCCccccccChhhhh
Q 003090          311 FLLPSSLSFLINLRTLRLHDRRIQ-GDLSLIGELSGLEILDLSESDVSEIPVSFGRLSHLRLLDLTGCYILELIPRGVLS  389 (848)
Q Consensus       311 ~~lp~~~~~l~~L~~L~L~~~~~~-~~~~~i~~l~~L~~L~l~~~~l~~lp~~i~~L~~L~~L~l~~~~~~~~~p~~~l~  389 (848)
                        -+..|..+++|++|||++|.-. ..|..|++|.+||+|+++++.++.+|.++++|.+|.+|++..+.....+|.. ..
T Consensus       563 --s~~ff~~m~~LrVLDLs~~~~l~~LP~~I~~Li~LryL~L~~t~I~~LP~~l~~Lk~L~~Lnl~~~~~l~~~~~i-~~  639 (889)
T KOG4658|consen  563 --SGEFFRSLPLLRVLDLSGNSSLSKLPSSIGELVHLRYLDLSDTGISHLPSGLGNLKKLIYLNLEVTGRLESIPGI-LL  639 (889)
T ss_pred             --CHHHHhhCcceEEEECCCCCccCcCChHHhhhhhhhcccccCCCccccchHHHHHHhhheeccccccccccccch-hh
Confidence              2234778999999999987554 4568999999999999999999999999999999999999987776666553 67


Q ss_pred             ccccccEEeccccccccccccccccccCcccchhhhcccCCCcEEEeecc
Q 003090          390 RLRKLEELYMSHSFRHWQFESESEEDSSSNAKFIELGALSRLTSLHIHIP  439 (848)
Q Consensus       390 ~l~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~~~~L~~l~~L~~L~l~~~  439 (848)
                      .|.+|++|.+......           .......++.++.+|+.+.+...
T Consensus       640 ~L~~Lr~L~l~~s~~~-----------~~~~~l~el~~Le~L~~ls~~~~  678 (889)
T KOG4658|consen  640 ELQSLRVLRLPRSALS-----------NDKLLLKELENLEHLENLSITIS  678 (889)
T ss_pred             hcccccEEEeeccccc-----------cchhhHHhhhcccchhhheeecc
Confidence            7999999998766421           22335666777777777766443



>PLN03210 Resistant to P Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PRK09376 rho transcription termination factor Rho; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF05659 RPW8: Arabidopsis broad-spectrum mildew resistance protein RPW8; InterPro: IPR008808 This entry represents the RPW8 domain found in several broad-spectrum mildew resistance proteins from Arabidopsis thaliana and other dicots Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PTZ00202 tuzin; Provisional Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>TIGR00767 rho transcription termination factor Rho Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>PRK06696 uridine kinase; Validated Back     alignment and domain information
>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PRK15455 PrkA family serine protein kinase; Provisional Back     alignment and domain information
>PRK07667 uridine kinase; Provisional Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] Back     alignment and domain information
>PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PRK06547 hypothetical protein; Provisional Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>PF12061 DUF3542: Protein of unknown function (DUF3542); InterPro: IPR021929 R1 is a gene for resistance to late blight, the most destructive disease in potato cultivation worldwide Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>PTZ00301 uridine kinase; Provisional Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>PRK05480 uridine/cytidine kinase; Provisional Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>PRK06762 hypothetical protein; Provisional Back     alignment and domain information
>PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>COG1763 MobB Molybdopterin-guanine dinucleotide biosynthesis protein [Coenzyme metabolism] Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>KOG2543 consensus Origin recognition complex, subunit 5 [Replication, recombination and repair] Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>COG1428 Deoxynucleoside kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway Back     alignment and domain information
>COG0572 Udk Uridine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG1532 consensus GTPase XAB1, interacts with DNA repair protein XPA [Replication, recombination and repair] Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+) Back     alignment and domain information
>TIGR00554 panK_bact pantothenate kinase, bacterial type Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PRK03839 putative kinase; Provisional Back     alignment and domain information
>COG1084 Predicted GTPase [General function prediction only] Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>cd01878 HflX HflX subfamily Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>TIGR00150 HI0065_YjeE ATPase, YjeE family Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB Back     alignment and domain information
>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I Back     alignment and domain information
>PRK04040 adenylate kinase; Provisional Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>PRK00889 adenylylsulfate kinase; Provisional Back     alignment and domain information
>CHL00081 chlI Mg-protoporyphyrin IX chelatase Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>COG3640 CooC CO dehydrogenase maturation factor [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK00625 shikimate kinase; Provisional Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>TIGR00073 hypB hydrogenase accessory protein HypB Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>PRK03846 adenylylsulfate kinase; Provisional Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF08298 AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 This is entry is found at the N terminus of PrkA proteins - bacterial and archaeal serine kinases approximately 630 residues in length Back     alignment and domain information
>PRK06217 hypothetical protein; Validated Back     alignment and domain information
>PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>TIGR02902 spore_lonB ATP-dependent protease LonB Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK13949 shikimate kinase; Provisional Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>PRK13695 putative NTPase; Provisional Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>PRK05057 aroK shikimate kinase I; Reviewed Back     alignment and domain information
>PRK13975 thymidylate kinase; Provisional Back     alignment and domain information
>COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) Back     alignment and domain information
>PRK14493 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MoaE; Provisional Back     alignment and domain information
>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants Back     alignment and domain information
>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases Back     alignment and domain information
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family Back     alignment and domain information
>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>cd03116 MobB Molybdenum is an essential trace element in the form of molybdenum cofactor (Moco) which is associated with the metabolism of nitrogen, carbon and sulfur by redox active enzymes Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>COG2019 AdkA Archaeal adenylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B Back     alignment and domain information
>PRK13947 shikimate kinase; Provisional Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>TIGR01287 nifH nitrogenase iron protein Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis Back     alignment and domain information
>COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK09825 idnK D-gluconate kinase; Provisional Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PLN02796 D-glycerate 3-kinase Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>PRK13946 shikimate kinase; Provisional Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK14490 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MobA; Provisional Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>PRK13236 nitrogenase reductase; Reviewed Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways Back     alignment and domain information
>KOG0781 consensus Signal recognition particle receptor, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK13232 nifH nitrogenase reductase; Reviewed Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>PRK12339 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>PF06564 YhjQ: YhjQ protein; InterPro: IPR017746 The YhjQ protein is encoded immediately upstream of bacterial cellulose synthase (bcs) genes in a broad range of bacteria, including both copies of the bcs locus in Klebsiella pneumoniae, and in several species is clearly part of the bcs operon Back     alignment and domain information
>PRK04182 cytidylate kinase; Provisional Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14530 adenylate kinase; Provisional Back     alignment and domain information
>PRK13230 nitrogenase reductase-like protein; Reviewed Back     alignment and domain information
>PRK13407 bchI magnesium chelatase subunit I; Provisional Back     alignment and domain information
>PLN02348 phosphoribulokinase Back     alignment and domain information
>cd02117 NifH_like This family contains the NifH (iron protein) of nitrogenase, L subunit (BchL/ChlL) of the protochlorophyllide reductase and the BchX subunit of the Chlorophyllide reductase Back     alignment and domain information
>PLN02318 phosphoribulokinase/uridine kinase Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1100 GTPase SAR1 and related small G proteins [General function prediction only] Back     alignment and domain information
>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse Back     alignment and domain information
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit Back     alignment and domain information
>cd04139 RalA_RalB RalA/RalB subfamily Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK15453 phosphoribulokinase; Provisional Back     alignment and domain information
>PRK05439 pantothenate kinase; Provisional Back     alignment and domain information
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>PRK13948 shikimate kinase; Provisional Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>PRK06761 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>cd02040 NifH NifH gene encodes component II (iron protein) of nitrogenase Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query848
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-23
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-19
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-13
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 6e-19
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-17
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-15
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-15
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 6e-13
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 7e-13
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 8e-08
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-05
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-18
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-17
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-15
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-10
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-18
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-14
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-18
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-13
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-11
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-11
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-18
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 6e-18
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 6e-14
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-13
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-08
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-04
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-18
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-16
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-12
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-11
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-18
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-18
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-15
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-14
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-12
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-18
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-14
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-11
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-11
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 6e-18
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-15
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-12
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-11
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-10
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-08
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-17
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-14
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 6e-12
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-10
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-08
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-17
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 6e-16
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-05
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-17
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 7e-15
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-04
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-17
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-15
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-14
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-04
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 7e-17
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-14
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 7e-12
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-07
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-15
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-15
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 9e-13
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-15
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-14
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-14
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-14
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-15
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 7e-14
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-13
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-11
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 4e-15
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 6e-14
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-13
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 5e-13
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-11
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 6e-11
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 5e-10
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 6e-09
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-15
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-14
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-10
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 8e-10
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-14
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-14
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-12
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-12
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-12
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-10
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-10
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-14
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-14
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 8e-12
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-10
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-14
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-13
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-10
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-06
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-13
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-12
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-11
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-11
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-11
1o6v_A466 Internalin A; bacterial infection, extracellular r 7e-09
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-13
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-08
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 8e-13
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-12
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-12
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-11
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-10
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 2e-12
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 4e-12
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 1e-10
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 1e-05
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 9e-12
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-11
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-10
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 7e-05
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-11
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-11
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 6e-10
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-06
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 4e-11
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 4e-11
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 5e-11
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 7e-06
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 5e-11
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 6e-11
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-08
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-10
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-08
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-08
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-06
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-10
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 6e-09
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 9e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-04
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-10
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-09
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 6e-07
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-10
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 9e-06
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-04
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 5e-10
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-09
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-09
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-09
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-09
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-09
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-09
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 7e-08
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-09
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-08
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-09
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 8e-09
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-08
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-04
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 2e-08
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-08
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-06
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 8e-04
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 7e-08
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-04
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 4e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 8e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 7e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 4e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-05
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-05
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-05
3m19_A251 Variable lymphocyte receptor A diversity region; a 4e-05
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 6e-05
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-04
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 2e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-04
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 4e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score =  104 bits (259), Expect = 8e-23
 Identities = 114/807 (14%), Positives = 213/807 (26%), Gaps = 260/807 (32%)

Query: 1   MATETVASVTQPITERIVDVLFNATVRQFGYLCKYKHYIEALRTEAKKLTDRR-NDLQAE 59
           M  ET     Q   + I+ V  +A V  F   CK    ++ +      L+    + +   
Sbjct: 7   MDFET--GEHQYQYKDILSVFEDAFVDNFD--CKD---VQDMPKSI--LSKEEIDHIIMS 57

Query: 60  IDAATRNREVIKDEVKSWIAEVNDIIPK--AEKFLEDEVKVNKKCLGGLCVDLKSRYKLS 117
            DA +    +       W         +   +KF+E+ +++N K L        S  K  
Sbjct: 58  KDAVSGTLRLF------WTLLSK---QEEMVQKFVEEVLRINYKFL-------MSPIK-- 99

Query: 118 REAEEKTLAMSALMAVGNFGKGVSRPAPPPAIISSSEGVYAFKSRESTMKDIMEA-MKDE 176
            E  + ++     +   +     ++      +           SR      + +A ++  
Sbjct: 100 TEQRQPSMMTRMYIEQRDRLYNDNQVFAKYNV-----------SRLQPYLKLRQALLELR 148

Query: 177 NVSITGICGMGGVGKTTLVKEIQKQAKEMKMFDDVAMAVVSQTPSITKIQYEIAGWLDLT 236
                 I G+ G GKT +  ++    K     D              KI +    WL+  
Sbjct: 149 PAKNVLIDGVLGSGKTWVALDVCLSYKVQCKMDF-------------KI-F----WLN-- 188

Query: 237 GISLMFNDIHEVPDELECPKLQALFLQENSPL-AIPDRFFQGMKDLQVLDLGGIRRFSFS 295
                  + +     LE   LQ L  Q +    +  D        +  +    +RR    
Sbjct: 189 -----LKNCNSPETVLE--MLQKLLYQIDPNWTSRSDHSSNIKLRIHSIQ-AELRRL--- 237

Query: 296 VRFPFLFPPLPSSPLFLLPSSLSFLINLRTLRLHDRRIQGDLSLIGELSGLEILDLSESD 355
                   P  +    LL                                  +L     +
Sbjct: 238 ----LKSKPYENC---LL----------------------------------VLL----N 252

Query: 356 VSEIPVSFGRLSHLRLLDLTGCYILELIPR--GVLSRLRKLEELYMSHSFRHWQF-ESES 412
           V                +L  C IL L  R   V   L      ++S           E 
Sbjct: 253 VQN-------AKAWNAFNL-SCKIL-LTTRFKQVTDFLSAATTTHISLDHHSMTLTPDEV 303

Query: 413 EEDSSSNAKFIELGALSRLTSLHIHIPE--GKIMPSDMSFQNLTSFSIAIGDLEERPLSD 470
           +       K+++     R   L    P       P            ++I          
Sbjct: 304 KSLL---LKYLDC----RPQDL----PREVLTTNP----------RRLSI---------- 332

Query: 471 FIGLFLQKFKKRCSRAMGLSQDMRISALHSWIKNLLLRSEILALAEV-NYFENIVSDLAN 529
            I   ++             + +    L + I++ L    +L  AE    F+        
Sbjct: 333 -IAESIRDGLATWDN----WKHVNCDKLTTIIESSL---NVLEPAEYRKMFDR------- 377

Query: 530 DGFNELMFLVIFRCNEMKYLLNSLERTLRVTLHKLE--WLFI--RENQNFVEICHGQLPA 585
                   L +F  +              +    L   W  +   +    V   H     
Sbjct: 378 --------LSVFPPS------------AHIPTILLSLIWFDVIKSDVMVVVNKLH----- 412

Query: 586 GCLSNVKRSDVVDCGSILKILLSHLVQSFQNLQRLRVYSCGLLVSVFEIERVNIAKEETE 645
                 K S               LV+       + + S  L + V       + +   +
Sbjct: 413 ------KYS---------------LVEKQPKESTISIPSIYLELKVKLENEYALHRSIVD 451

Query: 646 LFSSLEKLTLWDLPRMTDIWKGDT---QFVSLHNLKKVR-VEECDELRQVFPANFGKKAA 701
            ++  +     DL         D      +  H LK +   E     R VF  +F     
Sbjct: 452 HYNIPKTFDSDDLIPPYL----DQYFYSHIGHH-LKNIEHPERMTLFRMVF-LDFR---- 501

Query: 702 AEEMVLYRKRRDQIHIHATTSTSSPTPSLGNLVSIT-----IRGCGKLRNLFTTSMVKSL 756
                L +K R     H +T+ ++    L  L  +      I            +++  L
Sbjct: 502 ----FLEQKIR-----HDSTAWNASGSILNTLQQLKFYKPYICDNDPKYERLVNAILDFL 552

Query: 757 VRLESLEVRS--CPTLQEIIMDDEGEV 781
            ++E   + S     L+  +M ++  +
Sbjct: 553 PKIEENLICSKYTDLLRIALMAEDEAI 579


>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query848
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.98
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.97
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.97
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.97
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.97
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.97
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.97
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.97
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.97
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.96
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.96
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.96
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.96
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.95
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.95
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.95
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.95
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.94
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.94
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.93
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.93
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.93
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.93
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.92
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.92
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.91
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.91
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.9
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.9
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.9
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.89
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.89
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.89
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.89
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.89
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.88
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.87
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.86
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.84
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.84
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.83
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.83
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.83
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.83
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.82
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.82
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.82
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.81
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.8
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.79
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.79
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.78
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.78
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.78
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.78
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.76
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.76
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.75
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.75
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.74
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.73
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.73
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.73
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.72
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.71
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.7
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.7
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.7
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.69
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.68
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.68
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.67
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.67
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.67
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.67
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.66
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.66
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.66
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.64
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.64
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.61
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.61
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.6
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.59
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.58
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.58
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.57
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.57
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.56
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.56
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.56
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.55
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.54
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.54
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.54
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.54
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.54
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.53
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.53
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.53
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.52
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.5
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.5
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.49
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.49
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.49
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.49
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.48
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.47
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.45
3qfl_A115 MLA10; coiled-coil, (CC) domain, NLRS, nucleotide- 99.44
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.43
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.42
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.39
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.38
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.37
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.37
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.33
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.31
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.29
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.29
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.27
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.27
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.27
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.26
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.26
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.22
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.22
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.22
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.2
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.14
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 99.13
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.13
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.12
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.03
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.0
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.96
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.95
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.91
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.79
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 98.75
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.6
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.55
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.53
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 98.49
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 98.46
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.44
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.4
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.38
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.29
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.24
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.13
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.1
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.06
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.83
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.77
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.64
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.57
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.52
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.52
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 96.7
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 96.63
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 96.53
2chg_A226 Replication factor C small subunit; DNA-binding pr 96.45
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 96.44
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 96.43
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 96.4
2fna_A357 Conserved hypothetical protein; structural genomic 96.35
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 96.1
2v1u_A387 Cell division control protein 6 homolog; DNA repli 95.82
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 95.81
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 95.71
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 95.39
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 94.83
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 94.63
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 94.58
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 94.26
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 93.96
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 93.82
3pxg_A468 Negative regulator of genetic competence CLPC/MEC; 93.68
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 93.55
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 93.48
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 93.47
2chq_A319 Replication factor C small subunit; DNA-binding pr 93.2
1sxj_A516 Activator 1 95 kDa subunit; clamp loader, processi 93.12
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 92.89
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 92.78
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 92.67
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 92.55
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 92.45
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 92.43
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 92.33
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 92.16
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 91.91
3pvs_A447 Replication-associated recombination protein A; ma 91.85
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 91.82
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 91.8
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 91.76
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 91.7
3bos_A242 Putative DNA replication factor; P-loop containing 91.65
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 91.64
3co5_A143 Putative two-component system transcriptional RES 91.56
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 91.19
1qvr_A854 CLPB protein; coiled coil, AAA ATPase, chaperone; 91.11
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 91.06
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 90.87
2ga8_A359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 90.78
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 90.77
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 90.66
2kjq_A149 DNAA-related protein; solution structure, NESG, st 90.61
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 90.57
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 90.42
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 90.34
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 90.31
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 90.05
2hf9_A226 Probable hydrogenase nickel incorporation protein 90.04
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 90.03
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 89.98
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 89.89
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 89.88
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 89.84
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 89.76
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 89.36
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 89.32
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 89.28
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 88.94
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 88.89
3vaa_A199 Shikimate kinase, SK; structural genomics, center 88.86
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 88.79
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 88.78
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 88.77
1xjc_A169 MOBB protein homolog; structural genomics, midwest 88.6
1ojl_A304 Transcriptional regulatory protein ZRAR; response 88.44
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 88.32
2xxa_A433 Signal recognition particle protein; protein trans 88.29
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 88.13
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 88.1
1kag_A173 SKI, shikimate kinase I; transferase, structural g 88.1
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 87.68
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 87.66
2r62_A268 Cell division protease FTSH homolog; ATPase domain 87.65
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 87.64
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 87.63
1odf_A290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 87.55
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 87.45
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 87.4
3fwy_A314 Light-independent protochlorophyllide reductase I 87.36
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 87.29
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 87.29
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 87.07
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 86.97
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 86.97
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 86.95
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 86.88
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 86.83
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 86.63
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 86.51
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 86.47
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 86.34
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 86.32
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 86.28
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 86.17
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 86.08
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 86.04
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 85.75
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 85.68
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 85.6
1g8p_A350 Magnesium-chelatase 38 kDa subunit; parallel beta 85.56
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 85.47
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 85.46
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 85.39
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 85.37
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 85.31
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 85.29
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 85.29
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 85.18
1via_A175 Shikimate kinase; structural genomics, transferase 85.13
3hws_A363 ATP-dependent CLP protease ATP-binding subunit CL; 85.02
1um8_A376 ATP-dependent CLP protease ATP-binding subunit CL; 84.9
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 84.87
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 84.79
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 84.7
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 84.69
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 84.62
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 84.56
2c9o_A456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 84.56
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 84.45
2ce7_A476 Cell division protein FTSH; metalloprotease; HET: 84.33
2r44_A331 Uncharacterized protein; putative ATPase, structur 84.32
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 84.26
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 84.18
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 84.14
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 84.1
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 83.99
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 83.91
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 83.87
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 83.81
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 83.69
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 83.62
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 83.61
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 83.61
2e87_A357 Hypothetical protein PH1320; GTP-binding, GTPase, 83.6
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 83.59
1qvr_A854 CLPB protein; coiled coil, AAA ATPase, chaperone; 83.58
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 83.58
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 83.51
2grj_A192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 83.48
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 83.44
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 83.43
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 83.31
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 83.29
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 83.28
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 83.21
2dhr_A499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 83.18
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 83.17
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 83.16
2vli_A183 Antibiotic resistance protein; transferase, tunica 83.12
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 83.06
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 83.03
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 83.0
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 82.91
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 82.88
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 82.85
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 82.62
2cvh_A220 DNA repair and recombination protein RADB; filamen 82.61
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 82.58
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 82.58
3m6a_A543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 82.35
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 82.32
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 82.24
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 82.18
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 82.17
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 82.11
1b0u_A262 Histidine permease; ABC transporter, transport pro 81.98
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 81.9
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 81.75
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics 81.64
3nbx_X500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 81.62
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 81.6
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 81.56
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 81.49
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 81.45
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 81.43
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 81.39
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 81.35
1ji0_A240 ABC transporter; ATP binding protein, structural g 81.33
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 81.31
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 81.28
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 81.24
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 81.23
1sgw_A214 Putative ABC transporter; structural genomics, P p 81.19
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 81.15
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 81.13
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 81.12
1g6h_A257 High-affinity branched-chain amino acid transport 81.08
3tlx_A243 Adenylate kinase 2; structural genomics, structura 81.0
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 80.98
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 80.94
1g41_A444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 80.86
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 80.85
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 80.83
4a74_A231 DNA repair and recombination protein RADA; hydrola 80.81
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 80.55
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 80.52
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 80.38
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 80.33
2f6r_A281 COA synthase, bifunctional coenzyme A synthase; 18 80.32
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 80.28
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 80.25
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 80.17
2ghi_A260 Transport protein; multidrug resistance protein, M 80.05
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
Probab=100.00  E-value=4.3e-33  Score=324.27  Aligned_cols=477  Identities=19%  Similarity=0.184  Sum_probs=230.4

Q ss_pred             CCceeeecCCCcccCCc-c-cccccceeecccCcCcccChHHHccCCceeEEEccCcccccccccCCCCCCCCCCCCCCC
Q 003090          235 LTGISLMFNDIHEVPDE-L-ECPKLQALFLQENSPLAIPDRFFQGMKDLQVLDLGGIRRFSFSVRFPFLFPPLPSSPLFL  312 (848)
Q Consensus       235 l~~l~l~~n~l~~lp~~-~-~~~~L~~L~l~~~~~~~~~~~~~~~~~~Lr~L~l~~~~~~~~~~~~~~~~~~l~~~~~~~  312 (848)
                      ++.|++++|.+..++.. + ++++|++|++++|.+..+++..|.++++|++|++++              +.+...    
T Consensus        34 l~~L~Ls~n~l~~~~~~~~~~l~~L~~L~Ls~n~l~~i~~~~~~~l~~L~~L~Ls~--------------n~l~~~----   95 (606)
T 3vq2_A           34 TKNIDLSFNPLKILKSYSFSNFSELQWLDLSRCEIETIEDKAWHGLHHLSNLILTG--------------NPIQSF----   95 (606)
T ss_dssp             CCEEECTTSCCCEECTTTTTTCTTCCEEECTTCCCCEECTTTTTTCTTCCEEECTT--------------CCCCCC----
T ss_pred             cCEEECCCCCcCEeChhhccCCccCcEEeCCCCcccccCHHHhhchhhcCEeECCC--------------Cccccc----
Confidence            44555555555544442 2 455555555555555554444445555555555555              444442    


Q ss_pred             CCchhhhcccCcEEEccCccccCCc-hhhccccCCCEEEccCCCCc--ccChhhccCCcccEEeccCCccccccChhhhh
Q 003090          313 LPSSLSFLINLRTLRLHDRRIQGDL-SLIGELSGLEILDLSESDVS--EIPVSFGRLSHLRLLDLTGCYILELIPRGVLS  389 (848)
Q Consensus       313 lp~~~~~l~~L~~L~L~~~~~~~~~-~~i~~l~~L~~L~l~~~~l~--~lp~~i~~L~~L~~L~l~~~~~~~~~p~~~l~  389 (848)
                      .|..++++++|++|++++|.+...+ ..++++++|++|++++|.+.  .+|..++++++|++|++++|...+..|.. ++
T Consensus        96 ~p~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~lp~~~~~l~~L~~L~Ls~n~l~~~~~~~-~~  174 (606)
T 3vq2_A           96 SPGSFSGLTSLENLVAVETKLASLESFPIGQLITLKKLNVAHNFIHSCKLPAYFSNLTNLVHVDLSYNYIQTITVND-LQ  174 (606)
T ss_dssp             CTTSSTTCTTCCEEECTTSCCCCSSSSCCTTCTTCCEEECCSSCCCCCCCCGGGGTCTTCCEEECCSSCCCEECTTT-TH
T ss_pred             ChhhcCCcccCCEEEccCCccccccccccCCCCCCCEEeCCCCcccceechHhHhhcCCCCEEEccCCcceecChhh-hh
Confidence            2445555555555555555444443 34555555555555555554  34555555555555555554443322222 44


Q ss_pred             cccccc----EEeccccccccccccccccccCcccchhhhcccCCCcEEEeeccCCC--CCCCCC-ccCCCCeEEEEeCC
Q 003090          390 RLRKLE----ELYMSHSFRHWQFESESEEDSSSNAKFIELGALSRLTSLHIHIPEGK--IMPSDM-SFQNLTSFSIAIGD  462 (848)
Q Consensus       390 ~l~~L~----~L~l~~~~~~~~~~~~~~~~~~~~~~~~~L~~l~~L~~L~l~~~~~~--~~~~~~-~~~~L~~L~l~~~~  462 (848)
                      .+++|+    +|++++|.+...              +.......+|+.|++++|.+.  ..+..+ .+++|+.+.+..+.
T Consensus       175 ~l~~L~~~l~~L~l~~n~l~~~--------------~~~~~~~~~L~~L~L~~n~~~~~~~~~~~~~l~~L~~l~l~~~~  240 (606)
T 3vq2_A          175 FLRENPQVNLSLDMSLNPIDFI--------------QDQAFQGIKLHELTLRGNFNSSNIMKTCLQNLAGLHVHRLILGE  240 (606)
T ss_dssp             HHHHCTTCCCEEECTTCCCCEE--------------CTTTTTTCEEEEEEEESCCSCHHHHHHHHHTTTTCEEEEEEEEC
T ss_pred             hhhccccccceeeccCCCccee--------------CcccccCceeeeeeccCCccchhHHHHHhccccccccccccccc
Confidence            444433    455555544332              111112224555555555432  112222 34444444443222


Q ss_pred             CCC---------CCCCcccceEEecccc-cccccccCccccchhhHHHHHHHHHhhcceeeeccccccccccccccccCC
Q 003090          463 LEE---------RPLSDFIGLFLQKFKK-RCSRAMGLSQDMRISALHSWIKNLLLRSEILALAEVNYFENIVSDLANDGF  532 (848)
Q Consensus       463 ~~~---------~~~~~l~~l~l~~~~~-~c~~~~~l~~~~~l~~l~~~~~~~~~~L~~L~l~~~~~~~~~~~~l~~~~l  532 (848)
                      ...         .....+..+.+....- .+..+.        ..+|.  ...+++|+.|.+.++... .++ .+  ..+
T Consensus       241 ~~~~~~l~~~~~~~~~~l~~l~l~~l~l~~~~~~~--------~~~~~--~~~l~~L~~L~l~~~~~~-~l~-~l--~~~  306 (606)
T 3vq2_A          241 FKDERNLEIFEPSIMEGLCDVTIDEFRLTYTNDFS--------DDIVK--FHCLANVSAMSLAGVSIK-YLE-DV--PKH  306 (606)
T ss_dssp             CTTSCCCSCCCGGGGTTGGGSEEEEEEECCCTTCC--------GGGGS--CGGGTTCSEEEEESCCCC-CCC-CC--CTT
T ss_pred             cccCCcccccChHHhhhhhhccHhheecccccccc--------ccccc--cccCCCCCEEEecCccch-hhh-hc--ccc
Confidence            100         0001111111111110 000010        01111  122578888888877653 333 22  567


Q ss_pred             CCCcEEEEecCCCceeecccccccccccCCCccEEecccccccccccccccccccCCCcceEEEecCchhhHhh---hHH
Q 003090          533 NELMFLVIFRCNEMKYLLNSLERTLRVTLHKLEWLFIRENQNFVEICHGQLPAGCLSNVKRSDVVDCGSILKIL---LSH  609 (848)
Q Consensus       533 ~~L~~L~l~~~~~l~~l~~~~~~~~~~~~p~L~~L~l~~~~~L~~~~~~~~~~~~l~~L~~L~l~~c~~l~~~l---~~~  609 (848)
                      ++|++|++.+|.. +.++      .. .+++|++|+++++..+..     .+.+.+++|+.|++++|. + ..+   |. 
T Consensus       307 ~~L~~L~l~~n~l-~~lp------~~-~l~~L~~L~l~~n~~~~~-----~~~~~l~~L~~L~ls~n~-l-~~~~~~~~-  370 (606)
T 3vq2_A          307 FKWQSLSIIRCQL-KQFP------TL-DLPFLKSLTLTMNKGSIS-----FKKVALPSLSYLDLSRNA-L-SFSGCCSY-  370 (606)
T ss_dssp             CCCSEEEEESCCC-SSCC------CC-CCSSCCEEEEESCSSCEE-----CCCCCCTTCCEEECCSSC-E-EEEEECCH-
T ss_pred             ccCCEEEcccccC-cccc------cC-CCCccceeeccCCcCccc-----hhhccCCCCCEEECcCCc-c-CCCcchhh-
Confidence            8899999998865 4432      22 688888888888865443     244568888888888864 3 333   33 


Q ss_pred             HHHhhccCcEEEEeccCCceeeeeccccccccccccccCCcCEEecCCCccccccccCCCccccccCccEEEeecCcccc
Q 003090          610 LVQSFQNLQRLRVYSCGLLVSVFEIERVNIAKEETELFSSLEKLTLWDLPRMTDIWKGDTQFVSLHNLKKVRVEECDELR  689 (848)
Q Consensus       610 ~~~~l~~L~~L~l~~c~~l~~~~~~~~~~~~~~~~~~l~~L~~L~l~~c~~L~~l~~~~~~l~~l~~L~~L~i~~C~~L~  689 (848)
                      ....+++|++|++++|. ++.++         ..+..+++|++|+++++.-....+..  .+..+++|+.|++++|. ++
T Consensus       371 ~~~~~~~L~~L~L~~n~-l~~~~---------~~~~~l~~L~~L~l~~n~l~~~~~~~--~~~~l~~L~~L~l~~n~-l~  437 (606)
T 3vq2_A          371 SDLGTNSLRHLDLSFNG-AIIMS---------ANFMGLEELQHLDFQHSTLKRVTEFS--AFLSLEKLLYLDISYTN-TK  437 (606)
T ss_dssp             HHHCCSCCCEEECCSCS-EEEEC---------CCCTTCTTCCEEECTTSEEESTTTTT--TTTTCTTCCEEECTTSC-CE
T ss_pred             hhccCCcccEeECCCCc-cccch---------hhccCCCCCCeeECCCCccCCccChh--hhhccccCCEEECcCCC-CC
Confidence            33778888888888876 44443         23445566666666655322221111  13445555555555543 22


Q ss_pred             ccccCccccccccceee-----------------eccccccceeeeecC---CCCCCCCCCCCccEEEEecCCCCceecc
Q 003090          690 QVFPANFGKKAAAEEMV-----------------LYRKRRDQIHIHATT---STSSPTPSLGNLVSITIRGCGKLRNLFT  749 (848)
Q Consensus       690 ~~~p~~~~~~~~~~~l~-----------------l~~l~~~~l~i~~c~---~~~~~~~~l~~L~~L~i~~C~~L~~l~~  749 (848)
                      ...|..+......+.+.                 +++|  +.+++.+|.   ..+..+..+++|++|++++| +++.+++
T Consensus       438 ~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~~l~~L--~~L~Ls~n~l~~~~~~~~~~l~~L~~L~Ls~N-~l~~~~~  514 (606)
T 3vq2_A          438 IDFDGIFLGLTSLNTLKMAGNSFKDNTLSNVFANTTNL--TFLDLSKCQLEQISWGVFDTLHRLQLLNMSHN-NLLFLDS  514 (606)
T ss_dssp             ECCTTTTTTCTTCCEEECTTCEEGGGEECSCCTTCTTC--CEEECTTSCCCEECTTTTTTCTTCCEEECCSS-CCSCEEG
T ss_pred             ccchhhhcCCCCCCEEECCCCcCCCcchHHhhccCCCC--CEEECCCCcCCccChhhhcccccCCEEECCCC-cCCCcCH
Confidence            22232222110001111                 2223  333343331   12334555666666666665 4444433


Q ss_pred             cchhhccccccEEEEecccccceeecCCcccccccCCCccceecc-ccccccccccc
Q 003090          750 TSMVKSLVRLESLEVRSCPTLQEIIMDDEGEVGLQGASTKKITFP-SLFGIKLCDLD  805 (848)
Q Consensus       750 ~~~~~~l~~L~~L~i~~C~~L~~l~~~~~~~~~l~~~~~~~~~~~-sL~~L~i~~cp  805 (848)
                       ..+.++++|++|++++|. ++.++..      +..       ++ +|++|++.++|
T Consensus       515 -~~~~~l~~L~~L~l~~N~-l~~~p~~------~~~-------l~~~L~~l~l~~N~  556 (606)
T 3vq2_A          515 -SHYNQLYSLSTLDCSFNR-IETSKGI------LQH-------FPKSLAFFNLTNNS  556 (606)
T ss_dssp             -GGTTTCTTCCEEECTTSC-CCCEESC------GGG-------SCTTCCEEECCSCC
T ss_pred             -HHccCCCcCCEEECCCCc-CcccCHh------Hhh-------hcccCcEEEccCCC
Confidence             345566666666666664 4444221      111       33 57777777766



>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3qfl_A MLA10; coiled-coil, (CC) domain, NLRS, nucleotide-binding domain, L rich repeat containing receptors, protein binding; 2.00A {Hordeum vulgare} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>3fwy_A Light-independent protochlorophyllide reductase I ATP-binding protein; BCHL, electron donor, DPOR, Fe protein, nitrogenase; HET: ADP; 1.63A {Rhodobacter sphaeroides 2} Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 848
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-14
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-06
d2a5yb3277 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenor 3e-07
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 5e-07
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 8e-06
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 3e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 5e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.003
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 7e-04
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 0.002
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.001
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.002
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 0.003
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.004
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
 Score = 74.7 bits (182), Expect = 1e-14
 Identities = 37/172 (21%), Positives = 66/172 (38%), Gaps = 9/172 (5%)

Query: 232 WLDLTGISLMFNDIHEVPDELECPKLQALFLQENSPLAIPDRFFQGMKDLQVLDLGGIRR 291
             +L  +SL  N + ++        L  L L  N    +      G+  L  L LG  + 
Sbjct: 218 LTNLDELSLNGNQLKDIGTLASLTNLTDLDLANNQISNLAP--LSGLTKLTELKLGANQI 275

Query: 292 FSFSVRFPFLFPPLPSSPL--FLLPSSLSFLINLRTLRLHDRRIQGDLSLIGELSGLEIL 349
            + S                     S +S L NL  L L+   I   +S +  L+ L+ L
Sbjct: 276 SNISPLAGLTALTNLELNENQLEDISPISNLKNLTYLTLYFNNISD-ISPVSSLTKLQRL 334

Query: 350 DLSESDVSEIPVSFGRLSHLRLLDLTGCYILELIPRGVLSRLRKLEELYMSH 401
             + + VS++  S   L+++  L      I +L P   L+ L ++ +L ++ 
Sbjct: 335 FFANNKVSDVS-SLANLTNINWLSAGHNQISDLTP---LANLTRITQLGLND 382


>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query848
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.78
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.76
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.68
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.65
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.64
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.63
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.61
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.58
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.58
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.57
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.54
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.54
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.51
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.51
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.5
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.49
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.48
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.47
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.43
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.43
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.33
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.3
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.3
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.28
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 99.27
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.26
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.25
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.18
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.1
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.08
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.05
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.99
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.84
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.75
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.64
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.64
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.64
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.7
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.39
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.79
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.59
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 96.53
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 96.3
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 96.21
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 96.19
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 96.05
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 96.03
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 96.03
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 95.98
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 95.79
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 95.76
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 95.34
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 95.29
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 95.29
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 95.17
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 95.14
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 94.91
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 94.36
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 93.44
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 93.05
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 93.03
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 92.98
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 92.88
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 92.73
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 92.54
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 91.96
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 91.95
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 91.75
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 91.4
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 90.8
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 90.8
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 90.65
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 90.58
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 90.56
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 90.52
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 90.5
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 90.41
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 89.99
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 89.98
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 89.93
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 89.76
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 89.71
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 89.6
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 89.57
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 88.92
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 88.89
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 88.72
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 88.3
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 88.14
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 88.09
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 87.94
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 87.71
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 87.42
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 87.16
d1cp2a_269 Nitrogenase iron protein {Clostridium pasteurianum 87.13
d1ihua2279 Arsenite-translocating ATPase ArsA {Escherichia co 86.48
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 85.71
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 85.46
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 85.42
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 84.97
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 84.79
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 84.77
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 84.71
d1g2912240 Maltose transport protein MalK, N-terminal domain 84.67
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 84.39
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 84.04
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 84.02
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 83.78
d2awna2232 Maltose transport protein MalK, N-terminal domain 83.76
d2afhe1289 Nitrogenase iron protein {Azotobacter vinelandii [ 83.65
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 83.52
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 83.38
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 83.23
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 83.07
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 83.06
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 83.02
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 82.96
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 82.94
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 82.85
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 82.76
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 82.66
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 82.64
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 82.54
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 82.53
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 82.38
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 82.22
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 82.15
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 82.12
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 82.05
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 81.48
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 81.33
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 81.12
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 80.84
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 80.77
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 80.52
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 80.52
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 80.49
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 80.48
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 80.42
d1ls1a2207 GTPase domain of the signal sequence recognition p 80.28
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 80.22
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 80.21
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 80.02
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
Probab=99.78  E-value=5.5e-18  Score=182.31  Aligned_cols=323  Identities=19%  Similarity=0.208  Sum_probs=188.3

Q ss_pred             cccccceeecccCcCcccChHHHccCCceeEEEccCcccccccccCCCCCCCCCCCCCCCCCchhhhcccCcEEEccCcc
Q 003090          253 ECPKLQALFLQENSPLAIPDRFFQGMKDLQVLDLGGIRRFSFSVRFPFLFPPLPSSPLFLLPSSLSFLINLRTLRLHDRR  332 (848)
Q Consensus       253 ~~~~L~~L~l~~~~~~~~~~~~~~~~~~Lr~L~l~~~~~~~~~~~~~~~~~~l~~~~~~~lp~~~~~l~~L~~L~L~~~~  332 (848)
                      .+.+|++|+++++.+..+..  ++.+++|++|++++              +.+++     +|. ++++++|++|++++|.
T Consensus        42 ~l~~l~~L~l~~~~I~~l~g--l~~L~nL~~L~Ls~--------------N~l~~-----l~~-l~~L~~L~~L~L~~n~   99 (384)
T d2omza2          42 DLDQVTTLQADRLGIKSIDG--VEYLNNLTQINFSN--------------NQLTD-----ITP-LKNLTKLVDILMNNNQ   99 (384)
T ss_dssp             HHTTCCEEECCSSCCCCCTT--GGGCTTCCEEECCS--------------SCCCC-----CGG-GTTCTTCCEEECCSSC
T ss_pred             HhCCCCEEECCCCCCCCccc--cccCCCCCEEeCcC--------------CcCCC-----Ccc-ccCCcccccccccccc
Confidence            45667777777777666642  46677777777777              66766     553 7777777777777775


Q ss_pred             ccCCchhhccccCCCEEEccCCCCcccChhhccCCcccEEeccCCccccccChh------------------hhhccccc
Q 003090          333 IQGDLSLIGELSGLEILDLSESDVSEIPVSFGRLSHLRLLDLTGCYILELIPRG------------------VLSRLRKL  394 (848)
Q Consensus       333 ~~~~~~~i~~l~~L~~L~l~~~~l~~lp~~i~~L~~L~~L~l~~~~~~~~~p~~------------------~l~~l~~L  394 (848)
                      +... ..++.+++|+.|+++++.++.++. ......+..+....+......+..                  .+......
T Consensus       100 i~~i-~~l~~l~~L~~L~~~~~~~~~~~~-~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  177 (384)
T d2omza2         100 IADI-TPLANLTNLTGLTLFNNQITDIDP-LKNLTNLNRLELSSNTISDISALSGLTSLQQLSFGNQVTDLKPLANLTTL  177 (384)
T ss_dssp             CCCC-GGGTTCTTCCEEECCSSCCCCCGG-GTTCTTCSEEEEEEEEECCCGGGTTCTTCSEEEEEESCCCCGGGTTCTTC
T ss_pred             cccc-cccccccccccccccccccccccc-ccccccccccccccccccccccccccccccccccccccchhhhhcccccc
Confidence            5443 346777777777777776665543 233344444444332211110000                  01111111


Q ss_pred             cEEeccccccccccccccccccCcccchhhhcccCCCcEEEeeccCCCCCCCCCccCCCCeEEEEeCCCCCCCCCcccce
Q 003090          395 EELYMSHSFRHWQFESESEEDSSSNAKFIELGALSRLTSLHIHIPEGKIMPSDMSFQNLTSFSIAIGDLEERPLSDFIGL  474 (848)
Q Consensus       395 ~~L~l~~~~~~~~~~~~~~~~~~~~~~~~~L~~l~~L~~L~l~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~l~~l  474 (848)
                      .......+               ..........+++++.++++.+.+..++.....++|+.|.+..+..           
T Consensus       178 ~~~~~~~~---------------~~~~~~~~~~l~~~~~l~l~~n~i~~~~~~~~~~~L~~L~l~~n~l-----------  231 (384)
T d2omza2         178 ERLDISSN---------------KVSDISVLAKLTNLESLIATNNQISDITPLGILTNLDELSLNGNQL-----------  231 (384)
T ss_dssp             CEEECCSS---------------CCCCCGGGGGCTTCSEEECCSSCCCCCGGGGGCTTCCEEECCSSCC-----------
T ss_pred             cccccccc---------------ccccccccccccccceeeccCCccCCCCcccccCCCCEEECCCCCC-----------
Confidence            11111111               1123345667778888888888777665544667777777763332           


Q ss_pred             EEecccccccccccCccccchhhHHHHHHHHHhhcceeeeccccccccccccccccCCCCCcEEEEecCCCceeeccccc
Q 003090          475 FLQKFKKRCSRAMGLSQDMRISALHSWIKNLLLRSEILALAEVNYFENIVSDLANDGFNELMFLVIFRCNEMKYLLNSLE  554 (848)
Q Consensus       475 ~l~~~~~~c~~~~~l~~~~~l~~l~~~~~~~~~~L~~L~l~~~~~~~~~~~~l~~~~l~~L~~L~l~~~~~l~~l~~~~~  554 (848)
                                           +.++. + ..+++|+.|.+.++... ....   ...+++|+.|++.++.. +.      
T Consensus       232 ---------------------~~~~~-l-~~l~~L~~L~l~~n~l~-~~~~---~~~~~~L~~L~l~~~~l-~~------  277 (384)
T d2omza2         232 ---------------------KDIGT-L-ASLTNLTDLDLANNQIS-NLAP---LSGLTKLTELKLGANQI-SN------  277 (384)
T ss_dssp             ---------------------CCCGG-G-GGCTTCSEEECCSSCCC-CCGG---GTTCTTCSEEECCSSCC-CC------
T ss_pred             ---------------------CCcch-h-hcccccchhccccCccC-CCCc---ccccccCCEeeccCccc-CC------
Confidence                                 00000 0 01356777777666432 2221   24567888888877642 22      


Q ss_pred             ccccccCCCccEEecccccccccccccccccccCCCcceEEEecCchhhHhhhHHHHHhhccCcEEEEeccCCceeeeec
Q 003090          555 RTLRVTLHKLEWLFIRENQNFVEICHGQLPAGCLSNVKRSDVVDCGSILKILLSHLVQSFQNLQRLRVYSCGLLVSVFEI  634 (848)
Q Consensus       555 ~~~~~~~p~L~~L~l~~~~~L~~~~~~~~~~~~l~~L~~L~l~~c~~l~~~l~~~~~~~l~~L~~L~l~~c~~l~~~~~~  634 (848)
                      ......++.++.+.+.++. ++.+    .....+++++.|+++++ ++ ..+++.  ..+++|++|++++| .++.++  
T Consensus       278 ~~~~~~~~~l~~l~~~~n~-l~~~----~~~~~~~~l~~L~ls~n-~l-~~l~~l--~~l~~L~~L~L~~n-~l~~l~--  345 (384)
T d2omza2         278 ISPLAGLTALTNLELNENQ-LEDI----SPISNLKNLTYLTLYFN-NI-SDISPV--SSLTKLQRLFFANN-KVSDVS--  345 (384)
T ss_dssp             CGGGTTCTTCSEEECCSSC-CSCC----GGGGGCTTCSEEECCSS-CC-SCCGGG--GGCTTCCEEECCSS-CCCCCG--
T ss_pred             CCccccccccccccccccc-cccc----cccchhcccCeEECCCC-CC-CCCccc--ccCCCCCEEECCCC-CCCCCh--
Confidence            2234556777788777663 3322    22345778888888876 45 555543  67788888888887 555552  


Q ss_pred             cccccccccccccCCcCEEecCCCccccccccCCCccccccCccEEEeec
Q 003090          635 ERVNIAKEETELFSSLEKLTLWDLPRMTDIWKGDTQFVSLHNLKKVRVEE  684 (848)
Q Consensus       635 ~~~~~~~~~~~~l~~L~~L~l~~c~~L~~l~~~~~~l~~l~~L~~L~i~~  684 (848)
                              .+..+++|++|+++++ .++.++    ++.++++|+.|+|++
T Consensus       346 --------~l~~l~~L~~L~l~~N-~l~~l~----~l~~l~~L~~L~L~~  382 (384)
T d2omza2         346 --------SLANLTNINWLSAGHN-QISDLT----PLANLTRITQLGLND  382 (384)
T ss_dssp             --------GGGGCTTCCEEECCSS-CCCBCG----GGTTCTTCSEEECCC
T ss_pred             --------hHcCCCCCCEEECCCC-cCCCCh----hhccCCCCCEeeCCC
Confidence                    3567788888888776 466553    366778888888764



>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure