Citrus Sinensis ID: 003098


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------85
MLRNFRKDGHNWKKKKDGKTVKEAHEHLKVGNEERIHVYYAHGEDSPTFVRRCYWLLDKTLENIVLVHYRETHEGTPATPPNSHSSSISDQSAPLLLSEEFNSGAGHAYSAGGKELQAPNESLTVQNHEMRLHELNTLEWDDLVVTNDSNDSTEPRGDKFSHFDQQNHTAIKGAASNGSFFPSHDSYAEVSSGGCLTSLSQPIDRSNNTQFNNLDGVYSELMGTQSSVSSQRNEFGEVCTGDSLDILAGDGLQSQDSFGKWMNYIMTDSPGSVDDPVLEPSISSGHHQFTVPEHLFSITDVSPAWAFSNEKTKILVTGFFHKDCLHLSKSNMFCVCGEVRVPAEFVQAGVYRCFLPPHSPGLFLLYMSLDGHKPISQVLNFEYRSPQLHAPVASSEDKSKWEEFQVQMRLAHLLFSSFKGLNILSSKVPPNSLKEAKKFASKSTCISNSWAYLFKSVGDKRTSLPEAKDSFFELTLKSKLKEWLLERVVEGSKTTEYDVHGQGVIHLCAMLGYTWAILLFSWSGLSLDFRDKYGWTALHWAAYYGREKMVVDLLSAGAKPNLVTDPTSQNPGGLNAADIASKKGFDGLAAFLSEQALVAQFNDMTLAGNISGSLQTGSTITVDTQNLTEDEVYLKDTLSAYRTAAEAAARIQAAFREHSLKVQTKAIRFSSPEEEAQNIIAALKIQHAFRNFEVRKKMAAAARIQHRFRSWKVRKEFLNMRRQAIKIQAAFRGFQVRKQYGKILWSVGVLEKAILRWRLKRKGFRGLQVDRVEVEAVSDPNHEGDAEEDFYRASRKQAEERVERSVVRVQSMFRSKKAQEEYRRMKLAHDQAKLEYEGLLDPDMEMAD
ccccccccccccEEccccccHHHHHHHcccccEEEEEEEEEcccccccccEEEEEEcccccccEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEccccccccccEEEEEEccccccccccccccEEEEEccEEEEEEEEEccEEEEEcccccccEEEEEEEEcccccccccEEEEEcccccccccccccccccHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHcccccccccHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccccccHHHHHHHHcccccHHHHHHHHHHHHHHcccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccc
ccHHHcccccccEEcccccccHHHHHHHcccccEEEEEEEEccccccccHHEEHHHcccccccEEEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcccccccccccccccccccccccccccccEEEEEEcccccccccccEEEEEEccccccccccccccEEEEEcccEccEEEEcccEEEEEccccccccEEEEEEEcccEEEEEEEEEEEcccccccccccccccccHcHHHHHHHHHHHHHHHHHHHHHcccccccHHcccccccccccccccccHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHcHHHHHHHHHHccccccHHcccccHHHHHHHHHcHHHHHHHHHHccccccccccccccccccccHHHHHHHcccHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHcccccccccc
mlrnfrkdghnwkkkkdgktvKEAHEHLKVGNEERIHVYYahgedsptfVRRCYWLLDKTLENIVLVHYRethegtpatppnshsssisdqsaplllseefnsgaghaysaggkelqapnesltvqNHEMRlhelntlewddlvvtndsndsteprgdkfshfdqqNHTAikgaasngsffpshdsyaevssggcltslsqpidrsnntqfnnLDGVYSELmgtqssvssqrnefgevctgdsldilagdglqsqdSFGKWMNyimtdspgsvddpvlepsissghhqftvpehlfsitdvspawafsnektKILVTGFFhkdclhlsksnmfcvcgevrvpaefvqagvyrcflpphspglFLLYMsldghkpisqvlnfeyrspqlhapvassedksKWEEFQVQMRLAHLLFSSfkglnilsskvppnslkEAKKFASKSTCISNSWAYLFKSvgdkrtslpeakdSFFELTLKSKLKEWLLERVVegsktteydvhgQGVIHLCAMLGYTWAILLFSWsglsldfrdkygWTALHWAAYYGREKMVVDLLSagakpnlvtdptsqnpgglnaadiasKKGFDGLAAFLSEQALVAQFNDmtlagnisgslqtgstitvdtqnlteDEVYLKDTLSAYRTAAEAAARIQAAFREHSLKVQTkairfsspEEEAQNIIAALKIQHAFRNFEVRKKMAAAARIQHRFRSWKVRKEFLNMRRQAIKIQAAFRGFQVRKQYGKILWSVGVLEKAILRWRLKrkgfrglqvdrveveavsdpnhegdaeeDFYRASRKQAEERVERSVVRVQSMFRSKKAQEEYRRMKLAHDQAKLeyeglldpdmemad
mlrnfrkdghnwkkkkdgktvkeahehlkvgneerIHVYyahgedsptFVRRCYWLLDKTLENIVLVHYRETHEgtpatppnshssSISDQSAPLLLSEEFNSGAGHAYSAGGKELQAPNESLTVQNHEMRLHElntlewddlVVTNDSNDSTEPRGDKFSHFDQQNHTAIKGAASNGSFFPSHDSYAEVSSGGCLTSLSQPIDRSNNTQFNNLDGVYSELMGTQSSVSSQRNEFGEVCTGDSLDILAGDGLQSQDSFGKWMNYIMTDSPGSVDDPVLEPSISSGHHQFTVPEHLFSITDVSPAWAFSNEKTKILVTGFFHKDCLHLSKSNMFCVCGEVRVPAEFVQAGVYRCFLPPHSPGLFLLYMSLDGHKPISQVLNFEYRSPQLHAPVASSEDKSKWEEFQVQMRLAHLLFSSFKGLNILSSKVPPNSLKEAKKFASKSTCISNSWAYLFKSVGDKRTSLPEAKDSFFELTLKSKLKEWLLERVVEGSktteydvhGQGVIHLCAMLGYTWAILLFSWSGLSLDFRDKYGWTALHWAAYYGREKMVVDLLSAGAKPNLVTDPTSQNPGGLNAADIASKKGFDGLAAFLSEQALVAQFNDMTLAGNISGSLQTGSTITVDTQNLTEDEVYLKDTLSAYRTAAEAAARIQAAFREHSLKVQTKAIRFSSPEEEAQNIIAALKIQHAFRNFEVRKKMAAAARIqhrfrswkVRKEFLNMRRQAIKIQAAFRGFQVRKQYGKILWSVGVLEKAILRWrlkrkgfrglqvdrveveavsdpnhegdaeedfYRASRKQAeerversvvrvqsmfrskkaqeEYRRMKlahdqakleyeglldpdmeMAD
MLRNFRKDGHNWKKKKDGKTVKEAHEHLKVGNEERIHVYYAHGEDSPTFVRRCYWLLDKTLENIVLVHYRETHEGTPATPPNSHSSSISDQSAPLLLSEEFNSGAGHAYSAGGKELQAPNESLTVQNHEMRLHELNTLEWDDLVVTNDSNDSTEPRGDKFSHFDQQNHTAIKGAASNGSFFPSHDSYAEVSSGGCLTSLSQPIDRSNNTQFNNLDGVYSELMGTQSSVSSQRNEFGEVCTGDSLDILAGDGLQSQDSFGKWMNYIMTDSPGSVDDPVLEPSISSGHHQFTVPEHLFSITDVSPAWAFSNEKTKILVTGFFHKDCLHLSKSNMFCVCGEVRVPAEFVQAGVYRCFLPPHSPGLFLLYMSLDGHKPISQVLNFEYRSPQLHAPVASSEDKSKWEEFQVQMRLAHLLFSSFKGLNILSSKVPPNSLKEAKKFASKSTCISNSWAYLFKSVGDKRTSLPEAKDSFFELTLKSKLKEWLLERVVEGSKTTEYDVHGQGVIHLCAMLGYTWAILLFSWSGLSLDFRDKYGWTALHWAAYYGREKMVVDLLSAGAKPNLVTDPTSQNPGGLNAADIASKKGFDGLAAFLSEQALVAQFNDMTLAGNISGSLQTGSTITVDTQNLTEDEVYLKDTLSayrtaaeaaariqaafrEHSLKVQTKAIRFSSPEEEAQNIIAALKIQHAFRNFEVRKKMAAAARIQHRFRSWKVRKEFLNMRRQAIKIQAAFRGFQVRKQYGKILWSVGVLEKAILRWRLKRKGFRGLQVDRVEVEAVSDPNHEGDAEEDFYRASRKQAeerversvvrvQSMFRSKKAQEEYRRMKLAHDQAKLEYEGLLDPDMEMAD
****************************KVGNEERIHVYYAHGEDSPTFVRRCYWLLDKTLENIVLVHYR*************************************************************LHELNTLEWDDLVV******************************************************************************************GEVCTGDSLDILAGDGLQSQDSFGKWMNYIMT******************HHQFTVPEHLFSITDVSPAWAFSNEKTKILVTGFFHKDCLHLSKSNMFCVCGEVRVPAEFVQAGVYRCFLPPHSPGLFLLYMSLDGHKPISQVLNFEYR****************WEEFQVQMRLAHLLFSSFKGLNILS****************KSTCISNSWAYLFKSVGDKRTSLPEAKDSFFELTLKSKLKEWLLERVVEGSKTTEYDVHGQGVIHLCAMLGYTWAILLFSWSGLSLDFRDKYGWTALHWAAYYGREKMVVDLLSAGA********************IASKKGFDGLAAFLSEQALVAQFNDMTLAGNISGSLQTGSTITVDTQNLTEDEVYLKDTLSAYRTAAEAAARIQAAFREHSLKVQTKAIRF******AQNIIAALKIQHAFRNFEVRKKMAAAARIQHRFRSWKVRKEFLNMRRQAIKIQAAFRGFQVRKQYGKILWSVGVLEKAILRWRLKRKGFRGLQVDRVEV**************************************************************************
*LRNFRKDGHNWKKKK******EAHEHLKVGNEERIHVYYAHGEDSPTFVRRCYWLLDKTLENIVLVHYR***********************************************************************************************************************************************************************************************************************************ITDVSPAWAFSNEKTKILVTGFFHKDCLHLSKSNMFCVCGEVRVPAEFVQAGVYRCFLPPHSPGLFLLYMSLDGHKPISQVLNFEY********************FQVQMRLAHLL******************************************************DSFFELTLKSKLKEWLLERVVE*****EYDVHGQGVIHLCAMLGYTWAILLFSWSGLSLDFRDKYGWTALHWAAYYGREKMVVDLLSAGAKPNLVTDPTSQNPGGLNAADIASKKGFDGLAAFLSEQALVAQFNDMTLAGNISGSLQTGSTITVDTQNLTEDEVYLKDTLSAYRTAAEAAARIQAAFREHSLKVQTKAIRFSSPEEEAQNIIAALKIQHAFRNFEVRKKMAAAARIQHRFRSWKVRKEFLNMRRQAIKIQAAFRGFQVRKQYGKILWSVGVLEKAILRWRLKRKGFRGLQVDRVEVEAVSDPNHEGDAEEDFYRASRKQAEERVERSVVRVQSMFRSKKAQEEYRRMKLAHDQAKLEYEGLL*PD*****
***********************AHEHLKVGNEERIHVYYAHGEDSPTFVRRCYWLLDKTLENIVLVHYRET********************APLLLSEEFNSGAGHAYSAGGKELQAPNESLTVQNHEMRLHELNTLEWDDLVVTND********GDKFSHFDQQNHTAIKGAASNGSFFPSHDSYAEVSSGGCLTSLSQPIDRSNNTQFNNLDGVYSELMG************GEVCTGDSLDILAGDGLQSQDSFGKWMNYIMTDSPGSVDDPVLEPSISSGHHQFTVPEHLFSITDVSPAWAFSNEKTKILVTGFFHKDCLHLSKSNMFCVCGEVRVPAEFVQAGVYRCFLPPHSPGLFLLYMSLDGHKPISQVLNFEYRSPQL***********KWEEFQVQMRLAHLLFSSFKGLNILSSKVPPNSL**********TCISNSWAYLFKSVGDKRTSLPEAKDSFFELTLKSKLKEWLLERVVEGSKTTEYDVHGQGVIHLCAMLGYTWAILLFSWSGLSLDFRDKYGWTALHWAAYYGREKMVVDLLSAGAKPNLVTDPTSQNPGGLNAADIASKKGFDGLAAFLSEQALVAQFNDMTLAGNISGSLQTGSTITVDTQNLTEDEVYLKDTLSAYRTAAEAAARIQAAFREHSLKVQTKAIRFSSPEEEAQNIIAALKIQHAFRNFEVRKKMAAAARIQHRFRSWKVRKEFLNMRRQAIKIQAAFRGFQVRKQYGKILWSVGVLEKAILRWRLKRKGFRGLQVDRVEVEAVSDPNHEGDAEE******************VRVQSMFRSKKAQEEYRRMKLAHDQAKLEYEGLLDPDMEMAD
MLRNFRKDGHNWKKKKDGKTVKEAHEHLKVGNEERIHVYYAHGEDSPTFVRRCYWLLDKTLENIVLVHYRETH************************************************************************************************************************************************************************************SQDSFGKWMNYIMT**P*********************PEHLFSITDVSPAWAFSNEKTKILVTGFFHKDCLHLSKSNMFCVCGEVRVPAEFVQAGVYRCFLPPHSPGLFLLYMSLDGHKPISQVLNFEYRSPQLHAPVASSEDKSKWEEFQVQMRLAHLLFSSFKGLNILS************KFASKSTCISNSWAYLFKSVGDKRTSLPEAKDSFFELTLKSKLKEWLLERVVEGSKTTEYDVHGQGVIHLCAMLGYTWAILLFSWSGLSLDFRDKYGWTALHWAAYYGREKMVVDLLSAGAKPNLVTDPTSQNPGGLNAADIASKKGFDGLAAFLSEQALVAQFNDMT************************DEVYLKDTLSAYRTAAEAAARIQAAFREHSLKVQTKAIRFSSPEEEAQNIIAALKIQHAFRNFEVRKKMAAAARIQHRFRSWKVRKEFLNMRRQAIKIQAAFRGFQVRKQYGKILWSVGVLEKAILRWRLKRKGF**L*****************DAEEDFYRASRKQAEERVERSVVRVQSMFRSKKAQEEYRRMKLAHDQAKLEY************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLRNFRKDGHNWKKKKDGKTVKEAHEHLKVGNEERIHVYYAHGEDSPTFVRRCYWLLDKTLENIVLVHYRETHEGTPATPPNSHSSSISDQSAPLLLSEEFNSGAGHAYSAGGKELQAPNESLTVQNHEMRLHELNTLEWDDLVVTNDSNDSTEPRGDKFSHFDQQNHTAIKGAASNGSFFPSHDSYAEVSSGGCLTSLSQPIDRSNNTQFNNLDGVYSELMGTQSSVSSQRNEFGEVCTGDSLDILAGDGLQSQDSFGKWMNYIMTDSPGSVDDPVLEPSISSGHHQFTVPEHLFSITDVSPAWAFSNEKTKILVTGFFHKDCLHLSKSNMFCVCGEVRVPAEFVQAGVYRCFLPPHSPGLFLLYMSLDGHKPISQVLNFEYRSPQLHAPVASSEDKSKWEEFQVQMRLAHLLFSSFKGLNILSSKVPPNSLKEAKKFASKSTCISNSWAYLFKSVGDKRTSLPEAKDSFFELTLKSKLKEWLLERVVEGSKTTEYDVHGQGVIHLCAMLGYTWAILLFSWSGLSLDFRDKYGWTALHWAAYYGREKMVVDLLSAGAKPNLVTDPTSQNPGGLNAADIASKKGFDGLAAFLSEQALVAQFNDMTLAGNISGSLQTGSTITVDTQNLTEDEVYLKDTLSAYRTAAEAAARIQAAFREHSLKVQTKAIRFSSPEEEAQNIIAALKIQHAFRNFEVRKKMAAAARIQHRFRSWKVRKEFLNMRRQAIKIQAAFRGFQVRKQYGKILWSVGVLEKAILRWRLKRKGFRGLQVDRVEVEAVSDPNHEGDAEEDFYRASRKQAEERVERSVVRVQSMFRxxxxxxxxxxxxxxxxxxxxxYEGLLDPDMEMAD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query848 2.2.26 [Sep-21-2011]
O23463923 Calmodulin-binding transc yes no 0.977 0.898 0.595 0.0
Q9LSP8838 Calmodulin-binding transc no no 0.891 0.902 0.545 0.0
Q9FY741007 Calmodulin-binding transc no no 0.938 0.790 0.310 5e-99
Q8GSA71032 Calmodulin-binding transc no no 0.650 0.534 0.324 3e-81
Q6NPP41050 Calmodulin-binding transc no no 0.656 0.530 0.320 1e-74
Q9FYG21016 Calmodulin-binding transc no no 0.616 0.514 0.356 1e-70
A2A891 1682 Calmodulin-binding transc yes no 0.074 0.037 0.553 3e-13
Q9Y6Y1 1673 Calmodulin-binding transc no no 0.074 0.037 0.553 3e-13
O94983 1202 Calmodulin-binding transc yes no 0.075 0.053 0.545 3e-13
Q80Y50 1208 Calmodulin-binding transc no no 0.075 0.052 0.507 1e-11
>sp|O23463|CMTA5_ARATH Calmodulin-binding transcription activator 5 OS=Arabidopsis thaliana GN=CMTA5 PE=2 SV=2 Back     alignment and function desciption
 Score =  997 bits (2578), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 510/857 (59%), Positives = 646/857 (75%), Gaps = 28/857 (3%)

Query: 1   MLRNFRKDGHNWKKKKDGKTVKEAHEHLKVGNEERIHVYYAHGEDSPTFVRRCYWLLDKT 60
           MLRNFRKDGHNWKKKKDGKT+KEAHEHLKVGNEERIHVYYAHGED+PTFVRRCYWLLDK+
Sbjct: 74  MLRNFRKDGHNWKKKKDGKTIKEAHEHLKVGNEERIHVYYAHGEDTPTFVRRCYWLLDKS 133

Query: 61  LENIVLVHYRETHE--GTPATPPNSHSSSISDQSAPLLLSEEFNSGAGHAYSAGGKELQA 118
            E+IVLVHYRETHE    PATP NS+SSSI+D  +P +++E+ +SG  +  + G    + 
Sbjct: 134 QEHIVLVHYRETHEVHAAPATPGNSYSSSITDHLSPKIVAEDTSSGVHNTCNTG---FEV 190

Query: 119 PNESLTVQNHEMRLHELNTLEWDDLVVTNDSNDSTEPRGDKFSHFDQQNHTAIKGAASNG 178
            + SL  +NHE+RLHE+NTL+WD+L+V  D ++ + P  +   +F +Q  TA +G+   G
Sbjct: 191 RSNSLGSRNHEIRLHEINTLDWDELLVPADISNQSHPTEEDMLYFTEQLQTAPRGSVKQG 250

Query: 179 SFFPSHDSYAEVSSGGCLTSLSQPIDRSNNTQFNNLDGVYSELMGTQSSVSSQRNEFGEV 238
           +    ++   ++ S      L  P+ ++NN+             G   ++  QR +F   
Sbjct: 251 NHLAGYNGSVDIPS---FPGLEDPVYQNNNSCGAGEFSSQHSHCGVDPNL--QRRDFSAT 305

Query: 239 CTGDSLDILAGDGLQSQDSFGKWMNYIMTDSPGSVDDPVLEPSISSG----------HHQ 288
            T    D L  +G  SQDSFG+W+N  ++DSPGSVDDP LE   + G          H  
Sbjct: 306 VTDQPGDALLNNGYGSQDSFGRWVNNFISDSPGSVDDPSLEAVYTPGQDSSTPPTVFHSH 365

Query: 289 FTVPEHLFSITDVSPAWAFSNEKTKILVTGFFHKDCLHLSKSNMFCVCGEVRVPAEFVQA 348
             +PE +F+ITDVSPAWA+S EKTKILVTGFFH    HL +SN+ C+CGE+RVPAEF+Q 
Sbjct: 366 SDIPEQVFNITDVSPAWAYSTEKTKILVTGFFHDSFQHLGRSNLICICGELRVPAEFLQM 425

Query: 349 GVYRCFLPPHSPGLFLLYMSLDGHKPISQVLNFEYRSPQLHAPVASSEDK-SKWEEFQVQ 407
           GVYRCFLPP SPG+  LY+S+DG+KPISQ+ +FE+RS Q        +D+  KWEEF+ Q
Sbjct: 426 GVYRCFLPPQSPGVVNLYLSVDGNKPISQLFSFEHRSVQFIEKAIPQDDQLYKWEEFEFQ 485

Query: 408 MRLAHLLFSSFKGLNILSSKVPPNSLKEAKKFASKSTCISNSWAYLFKSVGDKRTSLPEA 467
           +RLAHLLF+S   +++L+SK+ P +L EAKK AS+++ + NSWAYL KS+        +A
Sbjct: 486 VRLAHLLFTSSNKISVLTSKISPENLLEAKKLASRTSHLLNSWAYLMKSIQANEVPFDQA 545

Query: 468 KDSFFELTLKSKLKEWLLERVVEGSKTTEYDVHGQGVIHLCAMLGYTWAILLFSWSGLSL 527
           +D  FELTLK++LKEWLLE+V+E   T EYD  G GVIHLCA+LGYTW+ILLFSW+ +SL
Sbjct: 546 RDHLFELTLKNRLKEWLLEKVIENRNTKEYDSKGLGVIHLCAVLGYTWSILLFSWANISL 605

Query: 528 DFRDKYGWTALHWAAYYGREKMVVDLLSAGAKPNLVTDPTSQNPGGLNAADIASKKGFDG 587
           DFRDK GWTALHWAAYYGREKMV  LLSAGA+PNLVTDPT +  GG  AAD+A +KG+DG
Sbjct: 606 DFRDKQGWTALHWAAYYGREKMVAALLSAGARPNLVTDPTKEFLGGCTAADLAQQKGYDG 665

Query: 588 LAAFLSEQALVAQFNDMTLAGNISGSLQT-GSTITVDTQNLTEDEVYLKDTLSAYRTAAE 646
           LAAFL+E+ LVAQF DM  AGNISG+L+T  +  + +  N  E+E  LKDTL+AYRTAAE
Sbjct: 666 LAAFLAEKCLVAQFKDMQTAGNISGNLETIKAEKSSNPGNANEEEQSLKDTLAAYRTAAE 725

Query: 647 AAARIQAAFREHSLKVQTKAIRFSSPEEEAQNIIAALKIQHAFRNFEVRKKMAAAARIQH 706
           AAARIQ AFREH LKV++ A+RF+S EEEA+NIIAA+KIQHAFRNFEVR+K+AAAARIQ+
Sbjct: 726 AAARIQGAFREHELKVRSSAVRFASKEEEAKNIIAAMKIQHAFRNFEVRRKIAAAARIQY 785

Query: 707 RFRSWKVRKEFLNMRRQAIKIQAAFRGFQVRKQYGKILWSVGVLEKAILRWRLKRKGFRG 766
           RF++WK+R+EFLNMR++AI+IQAAFRGFQVR+QY KI WSVGVLEKAILRWRLKRKGFRG
Sbjct: 786 RFQTWKMRREFLNMRKKAIRIQAAFRGFQVRRQYQKITWSVGVLEKAILRWRLKRKGFRG 845

Query: 767 LQVDRVEVEAVSDPNHEGDAEEDFYRASRKQAEERVERSVVRVQSMFRSKKAQEEYRRMK 826
           LQV +       D     +A EDFY+ S+KQAEER+ERSVV+VQ+MFRSKKAQ++YRRMK
Sbjct: 846 LQVSQ------PDEKEGSEAVEDFYKTSQKQAEERLERSVVKVQAMFRSKKAQQDYRRMK 899

Query: 827 LAHDQAKLEYEGLLDPD 843
           LAH++A+LEY+G+ + D
Sbjct: 900 LAHEEAQLEYDGMQELD 916




Regulates transcriptional activity in response to calcium signals. Binds to the consensus sequence 5'-[ACG]CGCG[GTC]-3'. Activates the expression of the V-PPase proton pump in pollen.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9LSP8|CMTA6_ARATH Calmodulin-binding transcription activator 6 OS=Arabidopsis thaliana GN=CMTA6 PE=2 SV=1 Back     alignment and function description
>sp|Q9FY74|CMTA1_ARATH Calmodulin-binding transcription activator 1 OS=Arabidopsis thaliana GN=CMTA1 PE=2 SV=2 Back     alignment and function description
>sp|Q8GSA7|CMTA3_ARATH Calmodulin-binding transcription activator 3 OS=Arabidopsis thaliana GN=CMTA3 PE=1 SV=1 Back     alignment and function description
>sp|Q6NPP4|CMTA2_ARATH Calmodulin-binding transcription activator 2 OS=Arabidopsis thaliana GN=CMTA2 PE=1 SV=1 Back     alignment and function description
>sp|Q9FYG2|CMTA4_ARATH Calmodulin-binding transcription activator 4 OS=Arabidopsis thaliana GN=CMTA4 PE=1 SV=1 Back     alignment and function description
>sp|A2A891|CMTA1_MOUSE Calmodulin-binding transcription activator 1 OS=Mus musculus GN=Camta1 PE=2 SV=1 Back     alignment and function description
>sp|Q9Y6Y1|CMTA1_HUMAN Calmodulin-binding transcription activator 1 OS=Homo sapiens GN=CAMTA1 PE=1 SV=4 Back     alignment and function description
>sp|O94983|CMTA2_HUMAN Calmodulin-binding transcription activator 2 OS=Homo sapiens GN=CAMTA2 PE=1 SV=3 Back     alignment and function description
>sp|Q80Y50|CMTA2_MOUSE Calmodulin-binding transcription activator 2 OS=Mus musculus GN=Camta2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query848
359477127927 PREDICTED: calmodulin-binding transcript 0.987 0.902 0.649 0.0
224108659915 predicted protein [Populus trichocarpa] 0.972 0.901 0.680 0.0
356519932920 PREDICTED: calmodulin-binding transcript 0.979 0.903 0.638 0.0
255556328918 calmodulin-binding transcription activat 0.977 0.903 0.654 0.0
147834981907 hypothetical protein VITISV_010763 [Viti 0.963 0.900 0.626 0.0
357478931920 Calmodulin-binding transcription activat 0.978 0.902 0.635 0.0
356564630921 PREDICTED: calmodulin-binding transcript 0.977 0.900 0.636 0.0
449501552910 PREDICTED: LOW QUALITY PROTEIN: calmodul 0.966 0.901 0.619 0.0
356558139911 PREDICTED: calmodulin-binding transcript 0.945 0.880 0.640 0.0
357449029 953 Calmodulin-binding transcription activat 0.950 0.845 0.618 0.0
>gi|359477127|ref|XP_002272118.2| PREDICTED: calmodulin-binding transcription activator 5-like [Vitis vinifera] gi|296083270|emb|CBI22906.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score = 1130 bits (2923), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 559/861 (64%), Positives = 678/861 (78%), Gaps = 24/861 (2%)

Query: 1   MLRNFRKDGHNWKKKKDGKTVKEAHEHLKVGNEERIHVYYAHGEDSPTFVRRCYWLLDKT 60
           MLRNFRKDGHNWKKK DGKTVKEAHEHLKVGN+ERIHVYYAHG+D+PTFVRRCYWLLDKT
Sbjct: 74  MLRNFRKDGHNWKKKNDGKTVKEAHEHLKVGNDERIHVYYAHGQDNPTFVRRCYWLLDKT 133

Query: 61  LENIVLVHYRETHE--GTPATPPNSH---SSSISDQSAPLLLSEEFNSGAGHAYSAGGKE 115
           LE+IVLVHYRET E  G+P TP NS    +S+ SD SAP LLSEE +SG G  Y AG KE
Sbjct: 134 LEHIVLVHYRETQESQGSPVTPVNSSPSPNSATSDPSAPWLLSEETDSGTGSTYRAGEKE 193

Query: 116 LQAPNESLTVQNHEMRLHELNTLEWDDLVVTNDSNDSTEPRGDKFSHFDQQNHTAIKGAA 175
            Q P +S+TV+N+EMR+HELNTLEWD+L+V+ND N+S  P+  K S F+QQN   I  + 
Sbjct: 194 HQEPRDSITVRNYEMRIHELNTLEWDELLVSNDPNNSMAPKEGKISSFEQQNQHVITSSN 253

Query: 176 SNGSFFPSHDSYAEVSSGGCLTSLSQPIDRSNNTQFNNLDGVYSELMGTQSSVSSQRNEF 235
           S      ++D    +S    L + ++ I  + +  FN LD VY + +G Q + + QR + 
Sbjct: 254 SYNRPHSTNDLPVGISP---LGNPAESIAGNESAHFNFLDDVYFQKIGGQVNPNGQRRDS 310

Query: 236 GEVCTGDSLDILAGDGLQSQDSFGKWMNYIMTDSPGSVDDPVL----------EPSISSG 285
             V TGD +DIL  D L+ QDSFG+WMNYIMTDSP SVDDP L            S +  
Sbjct: 311 VAVGTGDPVDILLKDSLEPQDSFGRWMNYIMTDSPVSVDDPSLGSPVSSSHDSVVSAAGN 370

Query: 286 HHQFTVPEHLFSITDVSPAWAFSNEKTKILVTGFFHKDCLHLSKSNMFCVCGEVRVPAEF 345
           H Q +VP+ +FSITD SP+WA S EKTKILV GF H++   L+KSN+F VCG+V VPAE 
Sbjct: 371 HQQSSVPDTIFSITDFSPSWAISTEKTKILVIGFLHENYADLAKSNLFFVCGDVCVPAEI 430

Query: 346 VQAGVYRCFLPPHSPGLFLLYMSLDGHKPISQVLNFEYRSPQLHAPVASSEDKSKWEEFQ 405
           +Q GV+RC +PPH+PGL   Y+S DGHKPISQV+ FEYR+P L+    SSE ++ WEEFQ
Sbjct: 431 IQLGVFRCLVPPHAPGLVNFYLSFDGHKPISQVVTFEYRAPLLYNQTVSSEVETNWEEFQ 490

Query: 406 VQMRLAHLLFSSFKGLNILSSKVPPNSLKEAKKFASKSTCISNSWAYLFKSVGDKRTSLP 465
            QMRL+HLLFS+ KGLNI+SSK+ PN+L+EAK F  K++ I+ +WA L K++GD R  + 
Sbjct: 491 FQMRLSHLLFSTSKGLNIMSSKISPNALREAKNFVKKTSFIARNWANLTKTIGDNRILVS 550

Query: 466 EAKDSFFELTLKSKLKEWLLERVVEGSKTTEYDVHGQGVIHLCAMLGYTWAILLFSWSGL 525
           +AKD  FE  L +KL+EWL+ER+VEG KT+E D  GQGVIHLCAMLGYT A+ L+S SGL
Sbjct: 551 QAKDLLFEFALLNKLQEWLVERIVEGGKTSERDGQGQGVIHLCAMLGYTRAVYLYSLSGL 610

Query: 526 SLDFRDKYGWTALHWAAYYGREKMVVDLLSAGAKPNLVTDPTSQNPGGLNAADIASKKGF 585
           SLD+RDK+GWTALHWAAYYGR+KMV  LLSAGAKPNLVTDPTS+NPGG  AAD+ASK+G 
Sbjct: 611 SLDYRDKFGWTALHWAAYYGRQKMVAVLLSAGAKPNLVTDPTSENPGGCTAADLASKEGH 670

Query: 586 DGLAAFLSEQALVAQFNDMTLAGNISGSLQTGSTITVDTQNLTEDEVYLKDTLSAYRTAA 645
           DGLAA+L+E+ LV QFNDMTLAGN+SGSLQ  +T  ++++NL+E+E+ LKDTL+AYRTAA
Sbjct: 671 DGLAAYLAEKGLVEQFNDMTLAGNVSGSLQVSTTEQINSENLSEEEMNLKDTLAAYRTAA 730

Query: 646 EAAARIQAAFREHSLKVQTKAIRFSSPEEEAQNIIAALKIQHAFRNFEVRKKMAAAARIQ 705
           +AAARIQ AFRE SLK++TKA+   +PE EA+NI+AA++IQHAFRN+E RK+MAAAARIQ
Sbjct: 731 DAAARIQVAFRERSLKLRTKAVENCNPEIEARNIVAAMRIQHAFRNYETRKRMAAAARIQ 790

Query: 706 HRFRSWKVRKEFLNMRRQAIKIQAAFRGFQVRKQYGKILWSVGVLEKAILRWRLKRKGFR 765
           HRFRSWK+RKEFLNMRRQAIKIQA FRGFQVR+QY KILWSVGVLEK ILRWR+KRKGFR
Sbjct: 791 HRFRSWKIRKEFLNMRRQAIKIQAVFRGFQVRRQYRKILWSVGVLEKVILRWRMKRKGFR 850

Query: 766 GLQVDRVEVEAVSDPNHEGDAEEDFYRASRKQAEERVERSVVRVQSMFRSKKAQEEYRRM 825
           GLQVD V      D   E D EEDF+RASR+QAE+RVERSV+RVQ+MFRSKKAQEEYRRM
Sbjct: 851 GLQVDTV------DQLQESDTEEDFFRASRRQAEDRVERSVIRVQAMFRSKKAQEEYRRM 904

Query: 826 KLAHDQAKLEYEGLLDPDMEM 846
           KLAH++AKLE+EG +DPD  M
Sbjct: 905 KLAHNEAKLEFEGFIDPDTNM 925




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224108659|ref|XP_002314926.1| predicted protein [Populus trichocarpa] gi|222863966|gb|EEF01097.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356519932|ref|XP_003528622.1| PREDICTED: calmodulin-binding transcription activator 5-like [Glycine max] Back     alignment and taxonomy information
>gi|255556328|ref|XP_002519198.1| calmodulin-binding transcription activator (camta), plants, putative [Ricinus communis] gi|223541513|gb|EEF43062.1| calmodulin-binding transcription activator (camta), plants, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|147834981|emb|CAN70197.1| hypothetical protein VITISV_010763 [Vitis vinifera] Back     alignment and taxonomy information
>gi|357478931|ref|XP_003609751.1| Calmodulin-binding transcription activator [Medicago truncatula] gi|355510806|gb|AES91948.1| Calmodulin-binding transcription activator [Medicago truncatula] Back     alignment and taxonomy information
>gi|356564630|ref|XP_003550554.1| PREDICTED: calmodulin-binding transcription activator 5-like [Glycine max] Back     alignment and taxonomy information
>gi|449501552|ref|XP_004161401.1| PREDICTED: LOW QUALITY PROTEIN: calmodulin-binding transcription activator 5-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356558139|ref|XP_003547365.1| PREDICTED: calmodulin-binding transcription activator 5-like [Glycine max] Back     alignment and taxonomy information
>gi|357449029|ref|XP_003594790.1| Calmodulin-binding transcription activator [Medicago truncatula] gi|355483838|gb|AES65041.1| Calmodulin-binding transcription activator [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query848
TAIR|locus:2130125923 AT4G16150 [Arabidopsis thalian 0.979 0.900 0.566 3.8e-259
TAIR|locus:20604051032 SR1 "signal responsive 1" [Ara 0.641 0.527 0.321 1.7e-98
TAIR|locus:20195341016 AT1G67310 [Arabidopsis thalian 0.620 0.517 0.329 8.5e-94
TAIR|locus:21733681050 AT5G64220 [Arabidopsis thalian 0.759 0.613 0.284 1.2e-89
UNIPROTKB|J9NZ90 1214 CAMTA2 "Uncharacterized protei 0.074 0.051 0.553 1.3e-27
UNIPROTKB|F1RFY4 1201 CAMTA2 "Uncharacterized protei 0.074 0.052 0.553 1.6e-27
UNIPROTKB|Q9Y6Y1 1673 CAMTA1 "Calmodulin-binding tra 0.074 0.037 0.553 2.4e-27
UNIPROTKB|E1BH04 1196 Bt.24734 "Uncharacterized prot 0.074 0.052 0.553 2.5e-27
UNIPROTKB|F1PDC5 1596 CAMTA1 "Uncharacterized protei 0.074 0.039 0.553 4.9e-27
UNIPROTKB|O94983 1202 CAMTA2 "Calmodulin-binding tra 0.074 0.052 0.553 1.4e-26
TAIR|locus:2130125 AT4G16150 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2494 (883.0 bits), Expect = 3.8e-259, P = 3.8e-259
 Identities = 488/862 (56%), Positives = 624/862 (72%)

Query:     1 MLRNFRKDGHNWKKKKDGKTVKEAHEHLKVGNEERIHVYYAHGEDSPTFVRRCYWLLDKT 60
             MLRNFRKDGHNWKKKKDGKT+KEAHEHLKVGNEERIHVYYAHGED+PTFVRRCYWLLDK+
Sbjct:    74 MLRNFRKDGHNWKKKKDGKTIKEAHEHLKVGNEERIHVYYAHGEDTPTFVRRCYWLLDKS 133

Query:    61 LENIVLVHYRETHE--GTPATPPNSHSSSISDQSAPLLLSEEFNSGAGHAYSAGGKELQA 118
              E+IVLVHYRETHE    PATP NS+SSSI+D  +P +++E+ +SG  +  + G    + 
Sbjct:   134 QEHIVLVHYRETHEVHAAPATPGNSYSSSITDHLSPKIVAEDTSSGVHNTCNTG---FEV 190

Query:   119 PNESLTVQNHEMRLHELNTLEWDDLVVTNDSNDSTEPRGDKFSHFDQQNHTAIKGAASNG 178
              + SL  +NHE+RLHE+NTL+WD+L+V  D ++ + P  +   +F +Q  TA +G+   G
Sbjct:   191 RSNSLGSRNHEIRLHEINTLDWDELLVPADISNQSHPTEEDMLYFTEQLQTAPRGSVKQG 250

Query:   179 SFFPSHDSYAEVSSGGCLTSLSQPIDRSNNT-QFNNLDGVYSELMGTQSSVSSQRNEFGE 237
             +    ++   ++ S      L  P+ ++NN+         +S   G   ++  QR +F  
Sbjct:   251 NHLAGYNGSVDIPS---FPGLEDPVYQNNNSCGAGEFSSQHSHC-GVDPNL--QRRDFSA 304

Query:   238 VCTGDSLDILAGDGLQSQDSFGKWMNYIMTDSPGSVDDPVLEPSISSG----------HH 287
               T    D L  +G  SQDSFG+W+N  ++DSPGSVDDP LE   + G          H 
Sbjct:   305 TVTDQPGDALLNNGYGSQDSFGRWVNNFISDSPGSVDDPSLEAVYTPGQDSSTPPTVFHS 364

Query:   288 QFTVPEHLFSITDVSPAWAFSNEKTKILVTGFFHKDCLHLSKSNMFCVCGEVRVPAEFVQ 347
                +PE +F+ITDVSPAWA+S EKTKILVTGFFH    HL +SN+ C+CGE+RVPAEF+Q
Sbjct:   365 HSDIPEQVFNITDVSPAWAYSTEKTKILVTGFFHDSFQHLGRSNLICICGELRVPAEFLQ 424

Query:   348 AGVYRCFLPPHSPGLFLLYMSLDGHKPISQVLNFEYRSPQLHAPVASSEDKS-KWEEFQV 406
              GVYRCFLPP SPG+  LY+S+DG+KPISQ+ +FE+RS Q        +D+  KWEEF+ 
Sbjct:   425 MGVYRCFLPPQSPGVVNLYLSVDGNKPISQLFSFEHRSVQFIEKAIPQDDQLYKWEEFEF 484

Query:   407 QMRLAHLLFSSFKGLNILSSKVPPNSLKEAKKFASKSTCISNSWAYLFKSVGDKRTSLPE 466
             Q+RLAHLLF+S   +++L+SK+ P +L EAKK AS+++ + NSWAYL KS+        +
Sbjct:   485 QVRLAHLLFTSSNKISVLTSKISPENLLEAKKLASRTSHLLNSWAYLMKSIQANEVPFDQ 544

Query:   467 AKDSFFELTLKSKLKEWLLERVVEGSKTTEYDVHGQGVIHLCAMLGYTWAILLFSWSGLS 526
             A+D  FELTLK++LKEWLLE+V+E   T EYD  G GVIHLCA+LGYTW+ILLFSW+ +S
Sbjct:   545 ARDHLFELTLKNRLKEWLLEKVIENRNTKEYDSKGLGVIHLCAVLGYTWSILLFSWANIS 604

Query:   527 LDFRDKYGWTALHWAAYYGREKMVVDLLSAGAKPNLVTDPTSQNPGGLNAADIASKKGFD 586
             LDFRDK GWTALHWAAYYGREKMV  LLSAGA+PNLVTDPT +  GG  AAD+A +KG+D
Sbjct:   605 LDFRDKQGWTALHWAAYYGREKMVAALLSAGARPNLVTDPTKEFLGGCTAADLAQQKGYD 664

Query:   587 GLAAFLSEQALVAQFNDMTLAGNISGSLQT-GSTITVDTQNLTEDEVYLKDTLSXXXXXX 645
             GLAAFL+E+ LVAQF DM  AGNISG+L+T  +  + +  N  E+E  LKDTL+      
Sbjct:   665 GLAAFLAEKCLVAQFKDMQTAGNISGNLETIKAEKSSNPGNANEEEQSLKDTLAAYRTAA 724

Query:   646 XXXXXXXXXXXEHSLKVQTKAIRFSSPEEEAQNIIAALKIQHAFRNFEVRKKMAAAARIQ 705
                        EH LKV++ A+RF+S EEEA+NIIAA+KIQHAFRNFEVR+K+AAAARIQ
Sbjct:   725 EAAARIQGAFREHELKVRSSAVRFASKEEEAKNIIAAMKIQHAFRNFEVRRKIAAAARIQ 784

Query:   706 HRFRSWKVRKEFLNMRRQAIKIQAAFRGFQVRKQYGKILWSVGVLEKAILRWRLKRKGFR 765
             +RF++WK+R+EFLNMR++AI+IQAAFRGFQVR+QY KI WSVGVLEKAILRWRLKRKGFR
Sbjct:   785 YRFQTWKMRREFLNMRKKAIRIQAAFRGFQVRRQYQKITWSVGVLEKAILRWRLKRKGFR 844

Query:   766 GLQVDRVEVEAVSDPNHEGDAEEDFYRASRKQAXXXXXXXXXXXQSMFRSKKAQEEYRRM 825
             GLQV +       D     +A EDFY+ S+KQA           Q+MFRSKKAQ++YRRM
Sbjct:   845 GLQVSQ------PDEKEGSEAVEDFYKTSQKQAEERLERSVVKVQAMFRSKKAQQDYRRM 898

Query:   826 KLAHDQAKLEYEGLLDPDMEMA 847
             KLAH++A+LEY+G+ + D +MA
Sbjct:   899 KLAHEEAQLEYDGMQELD-QMA 919




GO:0003677 "DNA binding" evidence=IEA
GO:0005634 "nucleus" evidence=ISM;IEA
GO:0005516 "calmodulin binding" evidence=ISS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=TAS
TAIR|locus:2060405 SR1 "signal responsive 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2019534 AT1G67310 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2173368 AT5G64220 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|J9NZ90 CAMTA2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1RFY4 CAMTA2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q9Y6Y1 CAMTA1 "Calmodulin-binding transcription activator 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1BH04 Bt.24734 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1PDC5 CAMTA1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|O94983 CAMTA2 "Calmodulin-binding transcription activator 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O23463CMTA5_ARATHNo assigned EC number0.59500.97750.8981yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00033115001
SubName- Full=Chromosome chr5 scaffold_64, whole genome shotgun sequence; (869 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query848
pfam03859119 pfam03859, CG-1, CG-1 domain 1e-41
smart01076118 smart01076, CG-1, CG-1 domains are highly conserve 1e-37
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 2e-13
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 3e-08
pfam0002333 pfam00023, Ank, Ankyrin repeat 1e-07
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 2e-07
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 4e-07
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 6e-07
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 3e-06
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 6e-06
pfam0183384 pfam01833, TIG, IPT/TIG domain 7e-06
COG5022 1463 COG5022, COG5022, Myosin heavy chain [Cytoskeleton 2e-05
smart0024830 smart00248, ANK, ankyrin repeats 5e-05
smart0001523 smart00015, IQ, Calmodulin-binding motif 9e-05
PHA02876 682 PHA02876, PHA02876, ankyrin repeat protein; Provis 1e-04
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 1e-04
pfam1360630 pfam13606, Ank_3, Ankyrin repeat 1e-04
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 2e-04
pfam0061221 pfam00612, IQ, IQ calmodulin-binding motif 5e-04
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 6e-04
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 0.002
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 0.003
>gnl|CDD|217766 pfam03859, CG-1, CG-1 domain Back     alignment and domain information
 Score =  147 bits (374), Expect = 1e-41
 Identities = 51/73 (69%), Positives = 60/73 (82%)

Query: 1   MLRNFRKDGHNWKKKKDGKTVKEAHEHLKVGNEERIHVYYAHGEDSPTFVRRCYWLLDKT 60
           ++R FRKDG+NWKKKKDGKT +EAHE LKVG  E ++ YYAHGED+PTF RRCYWLLD+ 
Sbjct: 47  VVRYFRKDGYNWKKKKDGKTTREAHEKLKVGGVEVLNCYYAHGEDNPTFQRRCYWLLDED 106

Query: 61  LENIVLVHYRETH 73
           LE+IVLVHY    
Sbjct: 107 LEHIVLVHYLNVK 119


CG-1 domains are highly conserved domains of about 130 amino-acid residues containing a predicted bipartite NLS and named after a partial cDNA clone isolated from parsley encoding a sequence-specific DNA-binding protein. CG-1 domains are associated with CAMTA proteins (for CAlModulin -binding Transcription Activator) that are transcription factors containing a calmodulin -binding domain and ankyrins (ANK) motifs. Length = 119

>gnl|CDD|198144 smart01076, CG-1, CG-1 domains are highly conserved domains of about 130 amino-acid residues Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|216730 pfam01833, TIG, IPT/TIG domain Back     alignment and domain information
>gnl|CDD|227355 COG5022, COG5022, Myosin heavy chain [Cytoskeleton] Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|197470 smart00015, IQ, Calmodulin-binding motif Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|205784 pfam13606, Ank_3, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|201341 pfam00612, IQ, IQ calmodulin-binding motif Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 848
KOG0520975 consensus Uncharacterized conserved protein, conta 100.0
PF03859118 CG-1: CG-1 domain; InterPro: IPR005559 CG-1 domain 100.0
KOG4412226 consensus 26S proteasome regulatory complex, subun 99.86
KOG4412226 consensus 26S proteasome regulatory complex, subun 99.82
PHA02743166 Viral ankyrin protein; Provisional 99.74
PHA02791284 ankyrin-like protein; Provisional 99.74
KOG0509 600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.73
PHA02791284 ankyrin-like protein; Provisional 99.72
KOG0509 600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.71
PHA02859209 ankyrin repeat protein; Provisional 99.71
PLN03192823 Voltage-dependent potassium channel; Provisional 99.71
PHA02741169 hypothetical protein; Provisional 99.7
PHA02875413 ankyrin repeat protein; Provisional 99.7
PHA02736154 Viral ankyrin protein; Provisional 99.69
PHA02875413 ankyrin repeat protein; Provisional 99.69
PHA02874434 ankyrin repeat protein; Provisional 99.68
PHA02878477 ankyrin repeat protein; Provisional 99.68
PHA02878477 ankyrin repeat protein; Provisional 99.67
PHA02798489 ankyrin-like protein; Provisional 99.66
PHA02795437 ankyrin-like protein; Provisional 99.66
PHA03100480 ankyrin repeat protein; Provisional 99.66
PHA02874434 ankyrin repeat protein; Provisional 99.66
KOG0508 615 consensus Ankyrin repeat protein [General function 99.65
PHA02859209 ankyrin repeat protein; Provisional 99.64
PHA03095471 ankyrin-like protein; Provisional 99.64
PHA02989494 ankyrin repeat protein; Provisional 99.64
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 99.64
PHA02884300 ankyrin repeat protein; Provisional 99.63
PHA03100480 ankyrin repeat protein; Provisional 99.63
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 99.62
PHA02946446 ankyin-like protein; Provisional 99.62
KOG0508 615 consensus Ankyrin repeat protein [General function 99.61
PHA03095471 ankyrin-like protein; Provisional 99.61
PHA02946446 ankyin-like protein; Provisional 99.6
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 99.6
PHA02989494 ankyrin repeat protein; Provisional 99.6
PHA02876682 ankyrin repeat protein; Provisional 99.6
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.6
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.6
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.59
PHA02798489 ankyrin-like protein; Provisional 99.58
KOG0510 929 consensus Ankyrin repeat protein [General function 99.58
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.58
PHA02876682 ankyrin repeat protein; Provisional 99.55
PHA02741169 hypothetical protein; Provisional 99.54
KOG0195448 consensus Integrin-linked kinase [Signal transduct 99.52
cd0117585 IPT_COE IPT domain of the COE family (Col/Olf-1/EB 99.51
KOG0195448 consensus Integrin-linked kinase [Signal transduct 99.51
KOG0514452 consensus Ankyrin repeat protein [General function 99.51
PHA02795437 ankyrin-like protein; Provisional 99.51
PHA02917 661 ankyrin-like protein; Provisional 99.51
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 99.49
PHA02917 661 ankyrin-like protein; Provisional 99.49
KOG0510 929 consensus Ankyrin repeat protein [General function 99.48
KOG0514452 consensus Ankyrin repeat protein [General function 99.48
PHA02730672 ankyrin-like protein; Provisional 99.48
PHA02743166 Viral ankyrin protein; Provisional 99.48
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.47
PHA02884300 ankyrin repeat protein; Provisional 99.45
KOG0505527 consensus Myosin phosphatase, regulatory subunit [ 99.44
PHA02792631 ankyrin-like protein; Provisional 99.43
PHA02730672 ankyrin-like protein; Provisional 99.42
KOG0505527 consensus Myosin phosphatase, regulatory subunit [ 99.42
KOG0520975 consensus Uncharacterized conserved protein, conta 99.4
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.39
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.38
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.38
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.36
PLN03192823 Voltage-dependent potassium channel; Provisional 99.35
KOG1710396 consensus MYND Zn-finger and ankyrin repeat protei 99.34
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.32
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.31
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.28
PHA02792 631 ankyrin-like protein; Provisional 99.28
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.27
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.27
PHA02736154 Viral ankyrin protein; Provisional 99.27
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.27
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.25
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.22
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.21
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 99.16
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.16
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.15
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.15
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.14
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.07
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.06
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 99.03
PF0183385 TIG: IPT/TIG domain; InterPro: IPR002909 This fami 99.0
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 98.98
cd0117985 IPT_plexin_repeat2 Second repeat of the IPT domain 98.92
cd0010289 IPT Immunoglobulin-like fold, Plexins, Transcripti 98.83
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 98.82
KOG0818 669 consensus GTPase-activating proteins of the GIT fa 98.82
KOG1710396 consensus MYND Zn-finger and ankyrin repeat protei 98.76
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.66
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.63
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 98.57
cd0060390 IPT_PCSR IPT domain of Plexins and Cell Surface Re 98.5
PF1360630 Ank_3: Ankyrin repeat 98.47
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.47
cd0118094 IPT_plexin_repeat1 First repeat of the IPT domain 98.44
smart0042990 IPT ig-like, plexins, transcription factors. 98.41
KOG0160862 consensus Myosin class V heavy chain [Cytoskeleton 98.32
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.29
KOG0818 669 consensus GTPase-activating proteins of the GIT fa 98.23
KOG0522 560 consensus Ankyrin repeat protein [General function 98.23
COG5022 1463 Myosin heavy chain [Cytoskeleton] 98.2
KOG0522 560 consensus Ankyrin repeat protein [General function 98.19
cd0118199 IPT_plexin_repeat3 Third repeat of the IPT domain 98.19
KOG0160862 consensus Myosin class V heavy chain [Cytoskeleton 98.17
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 98.17
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.15
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.15
PF1360630 Ank_3: Ankyrin repeat 98.15
cd0284981 CGTase_C_term Cgtase (cyclodextrin glycosyltransfe 98.12
KOG0521785 consensus Putative GTPase activating proteins (GAP 98.03
KOG2384223 consensus Major histocompatibility complex protein 98.0
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 97.88
KOG0783 1267 consensus Uncharacterized conserved protein, conta 97.86
cd0060481 IPT_CGTD IPT domain (domain D) of cyclodextrin gly 97.71
KOG0511 516 consensus Ankyrin repeat protein [General function 97.63
KOG0164 1001 consensus Myosin class I heavy chain [Cytoskeleton 97.61
KOG2384223 consensus Major histocompatibility complex protein 97.58
KOG0164 1001 consensus Myosin class I heavy chain [Cytoskeleton 97.52
KOG0511 516 consensus Ankyrin repeat protein [General function 97.21
PF0061221 IQ: IQ calmodulin-binding motif; InterPro: IPR0000 96.98
COG5022 1463 Myosin heavy chain [Cytoskeleton] 96.98
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 96.74
KOG0521785 consensus Putative GTPase activating proteins (GAP 96.58
PF0061221 IQ: IQ calmodulin-binding motif; InterPro: IPR0000 96.53
KOG2505591 consensus Ankyrin repeat protein [General function 96.48
KOG3836605 consensus HLH transcription factor EBF/Olf-1 and r 96.34
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 96.15
cd00602101 IPT_TF IPT domain of eukaryotic transcription fact 96.04
cd01178101 IPT_NFAT IPT domain of the NFAT family of transcri 96.03
PTZ00014821 myosin-A; Provisional 95.92
cd0117697 IPT_RBP-Jkappa IPT domain of the recombination sig 95.77
smart0001526 IQ Short calmodulin-binding motif containing conse 95.59
KOG2128 1401 consensus Ras GTPase-activating protein family - I 95.17
KOG3610 1025 consensus Plexins (functional semaphorin receptors 95.11
KOG2128 1401 consensus Ras GTPase-activating protein family - I 95.06
cd01177102 IPT_NFkappaB IPT domain of the transcription facto 94.94
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 94.91
PTZ00014821 myosin-A; Provisional 94.83
smart0001526 IQ Short calmodulin-binding motif containing conse 94.76
KOG2505591 consensus Ankyrin repeat protein [General function 93.94
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 93.6
KOG0163 1259 consensus Myosin class VI heavy chain [Cytoskeleto 89.61
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 83.56
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
Probab=100.00  E-value=2.8e-114  Score=1007.03  Aligned_cols=807  Identities=42%  Similarity=0.638  Sum_probs=601.9

Q ss_pred             CcccccccCccccccCCCcchHHhhhhhccCCeeeEEEeeeccCCCCCcceeeeeeccCCCCceEEEEeeecCCCCCCC-
Q 003098            1 MLRNFRKDGHNWKKKKDGKTVKEAHEHLKVGNEERIHVYYAHGEDSPTFVRRCYWLLDKTLENIVLVHYRETHEGTPAT-   79 (848)
Q Consensus         1 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-   79 (848)
                      ||||||||||+|||||||||||||||||||||+|+||||||||+++|||||||||||+++++||||||||||++..-+. 
T Consensus        74 ~lr~fRKDGh~WkKkkDGKtirEaHe~LKvg~~~~l~~~Y~Hg~~~ptF~RRcYwllq~~~~hIVLVHYl~v~~~~~~~~  153 (975)
T KOG0520|consen   74 VLRYFRKDGHNWKKKKDGKTIREAHEKLKVGGVEVLHCYYAHGEINPTFQRRCYWLLQQELEHIVLVHYLNVKGNEDAAK  153 (975)
T ss_pred             HHHHHhhcchhhhhcCCCCcChHHHHhhccCCccceeeeeecccccchHHHHHHHhhccccCceEEEEEeeccccccccc
Confidence            6899999999999999999999999999999999999999999999999999999999999999999999999944332 


Q ss_pred             -CCCCCCCCCCCCCccccccccccCCCCCcc---c-----------cCcccccCCCCCccccccccccccccccc-cccc
Q 003098           80 -PPNSHSSSISDQSAPLLLSEEFNSGAGHAY---S-----------AGGKELQAPNESLTVQNHEMRLHELNTLE-WDDL  143 (848)
Q Consensus        80 -~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~---~-----------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~  143 (848)
                       +.....+.++|.-  ++..+.+.+..++..   +           +....++.-.+  ...+|..+++..+..+ |..+
T Consensus       154 ~~~~~~~s~~sd~~--~S~~~~~~q~~~~~~~~~s~~~~v~~i~s~~~~~~~g~~~~--~s~~h~i~~~~~~s~~~~~~~  229 (975)
T KOG0520|consen  154 GAGEIFSSIISDKA--WSLNQLAGQLSPIFHNHSSVNEDVAEINSNQTGNALGSVFG--NSRNHRIRLHEVNSLDPLYKL  229 (975)
T ss_pred             Cccccccccccccc--ccHHHhhcccCcchhcccchHHHHHHHhhhccccccccccC--cchhhhhcccccCCccccccc
Confidence             1112223444443  333333322222111   0           11111111001  2358999999999999 9999


Q ss_pred             cccCCCCCCCCCCCCCC--------------ccccccccccccCCCCCCCCCCCCCC-ccccccCCCCCCCCCC-ccCCC
Q 003098          144 VVTNDSNDSTEPRGDKF--------------SHFDQQNHTAIKGAASNGSFFPSHDS-YAEVSSGGCLTSLSQP-IDRSN  207 (848)
Q Consensus       144 ~~~~~~~~~~~~~~~~~--------------~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~-~~~~~  207 (848)
                      .++.++.+...|.-...              .++.....+..+++..-   ..+..+ +..|.+   +..+..+ +..++
T Consensus       230 p~s~~s~~~~~~~~~~~~~~~~~~~~rs~~~s~~te~l~n~~~~~~~~---g~s~s~~l~~i~~---~~~~~~~~~~~p~  303 (975)
T KOG0520|consen  230 PVSDDSLNLSAPKPIDLPKGPTSVKQRSSSPSYFTEILGNAPSGLVSQ---GNSLSSSLQRISS---FTGLDNAAYEQPN  303 (975)
T ss_pred             cccCCccccccCCCcccccCCcchhhcCCCCcchhhhcccCCCccccc---ccccccchhhccc---ccccccccccCCc
Confidence            99988644443322111              11111111111110000   000000 000100   0000000 00000


Q ss_pred             CccccCCccchhhccCCccc---ccccccccccccCCCc----cc-chhcCCCCCCCchhhhhHHhhcCCCC--------
Q 003098          208 NTQFNNLDGVYSELMGTQSS---VSSQRNEFGEVCTGDS----LD-ILAGDGLQSQDSFGKWMNYIMTDSPG--------  271 (848)
Q Consensus       208 ~~~~~~~~~~~~~~~~~~~~---~~~~~~~~~~~~~~~~----~~-~~~~~~~~~~~sf~~~~~~~~~~s~~--------  271 (848)
                      ...|.   ...+..-+..+.   ...+...........+    .+ .+.++||++.|||++|++-+...+++        
T Consensus       304 ~~nf~---~~ss~~s~~~~~~~g~g~~~~~~sa~~~~~P~~~~~~~~~~~~~l~sgdsf~~~~~t~~e~~d~~q~~s~~~  380 (975)
T KOG0520|consen  304 SQNFE---PNSSLNSHVTGQSYGQGLQARSPSATSESRPITSAADAALSELGLKSGDSFSRWASTFGEISDLGQDPSGEA  380 (975)
T ss_pred             ccccc---ccccCCCCccccccCccccCCCcccccccCCcchhhccccccccccccccccchhhhhcccccCCCCCcccc
Confidence            01110   000000000000   0011111111111111    22 46689999999999999986543322        


Q ss_pred             CCCCCCCCCCCCC--CCCCCCCCCCcceeEEeccCCccCCCCeEEEEECcCCCCcccCCCcceEEEcCCeecceeeeeCC
Q 003098          272 SVDDPVLEPSISS--GHHQFTVPEHLFSITDVSPAWAFSNEKTKILVTGFFHKDCLHLSKSNMFCVCGEVRVPAEFVQAG  349 (848)
Q Consensus       272 ~~~~~~~~~~~~~--~~~~s~~~~~~~~I~d~sP~w~~~~gg~kVlV~G~~~~~~~~~~~~~~~c~FG~~~vpa~~~~~g  349 (848)
                      .|.. ...+.+..  ..++| .++|+|+|+||||+|+|++||+||+|+|++.    +....+|+||||+++|||++|++|
T Consensus       381 ~~~p-~~~~~~~~~s~~~~S-~p~qlf~I~DfSP~Wsy~~ggvKVlV~G~~~----~~~~~~ysc~Fg~~~VPAeliq~G  454 (975)
T KOG0520|consen  381 VWTP-ENDPMGPPGSFLSPS-SPEQLFTITDFSPEWSYLDGGVKVLVTGFPQ----DETRSNYSCMFGEQRVPAELIQEG  454 (975)
T ss_pred             cccc-CCCcCCCcccccCCC-CCcceeeeeccCcccccCCCCcEEEEecCcc----ccCCCceEEEeCCccccHHHhhcc
Confidence            1211 11111111  34445 4499999999999999999999999999743    235889999999999999999999


Q ss_pred             eeeeecCCCCCceeEEEEEeC-CCCCcccccccccCCCC--CccCCCCccccchhhHHHHHHHHHHHHhccccccccccC
Q 003098          350 VYRCFLPPHSPGLFLLYMSLD-GHKPISQVLNFEYRSPQ--LHAPVASSEDKSKWEEFQVQMRLAHLLFSSFKGLNILSS  426 (848)
Q Consensus       350 vl~C~~Pph~~G~Vpl~v~~~-~~~~~Sev~~Fey~~~~--~~~~~~~~~~~~~~~~~~l~~Rl~~LL~~~~~~l~il~s  426 (848)
                      |||||||||+||.|+|||+|+ ++..|||+++|+|...+  .+++.+   -++...++.++.||..++...   .+++++
T Consensus       455 VLrC~~P~h~~G~V~l~V~c~~~~~~~se~ref~~~~~~~~~~d~~s---~~d~~~~~sl~~rl~~~~~r~---~~~~~s  528 (975)
T KOG0520|consen  455 VLRCYAPPHEPGVVNLQVTCRISGLACSEVREFAYLVQPSQQIDKLS---WEDFLFQMSLLHRLETMLNRK---QSILSS  528 (975)
T ss_pred             eeeeecCccCCCeEEEEEEecccceeeeeehheeecccCcccccccc---cccchhhhHHHHHHHHHHHHh---HhHhhc
Confidence            999999999999999999998 88999999999999843  344433   124457778888888887643   245666


Q ss_pred             CCCCCChHHHHH--HhhhhhcCCCCHHH-HHHHhCCCCCCcccccchHHHHHHcCCcHHHHHHHHHc--CCCCccccCCC
Q 003098          427 KVPPNSLKEAKK--FASKSTCISNSWAY-LFKSVGDKRTSLPEAKDSFFELTLKSKLKEWLLERVVE--GSKTTEYDVHG  501 (848)
Q Consensus       427 k~~~~~l~e~~~--~~~~i~~~~~~~~~-li~~l~~~~~~~~~~~~~ll~aa~~~~l~e~Ll~~L~~--Ga~in~~D~~G  501 (848)
                      +.++....++..  ++.+++...+.|.+ .+.....+.....+.++-++.-.++..+..||++++++  |...+..|.+|
T Consensus       529 ~~~~~n~~~~~~~~l~skv~~l~~~~~~r~~~~~~~~~~~~~~~r~~lllhL~a~~lyawLie~~~e~~~~~~~eld~d~  608 (975)
T KOG0520|consen  529 KPSTENTSDAESGNLASKVVHLLNEWAYRLLKSISENLSSSVNFRDMLLLHLLAELLYAWLIEKVIEWAGSGDLELDRDG  608 (975)
T ss_pred             cCCccccccccchhHHHHHHHHHHHHHHHHHhhHhhhccccCCCcchHHHHHHHHHhHHHHHHHHhcccccCchhhcccC
Confidence            777777777777  88999998999999 88888888888888888877777888889999999999  55666699999


Q ss_pred             CchHHHHHHcCCHHHHHHHHHCCCCCccccCCCCcHHHHHHHcCCHHHHHHHHHcCCCCCCCCCCCCCCCCCCCHHHHHH
Q 003098          502 QGVIHLCAMLGYTWAILLFSWSGLSLDFRDKYGWTALHWAAYYGREKMVVDLLSAGAKPNLVTDPTSQNPGGLNAADIAS  581 (848)
Q Consensus       502 ~T~LH~Aa~~G~~~~v~~LL~~Ga~in~~D~~G~TpLh~Aa~~G~~eiv~~LL~~GA~in~~td~~~~d~~G~TpL~lA~  581 (848)
                      +..+|++|..|+.+.+.+.++.|..++++|.+||||||||+.+|++.++..|++.|++.+++|||+..+..|.|+.++|.
T Consensus       609 qgV~hfca~lg~ewA~ll~~~~~~ai~i~D~~G~tpL~wAa~~G~e~l~a~l~~lga~~~~~tdps~~~p~g~ta~~la~  688 (975)
T KOG0520|consen  609 QGVIHFCAALGYEWAFLPISADGVAIDIRDRNGWTPLHWAAFRGREKLVASLIELGADPGAVTDPSPETPGGKTAADLAR  688 (975)
T ss_pred             CChhhHhhhcCCceeEEEEeecccccccccCCCCcccchHhhcCHHHHHHHHHHhccccccccCCCCCCCCCCchhhhhh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HcCChHHHHHHHhhhhhhccccccccc-cccCcccccccccc-ccc--CccchhhhhhhhhhHHhhhHHHHHHHHHHHhh
Q 003098          582 KKGFDGLAAFLSEQALVAQFNDMTLAG-NISGSLQTGSTITV-DTQ--NLTEDEVYLKDTLSAYRTAAEAAARIQAAFRE  657 (848)
Q Consensus       582 ~~G~~~iv~lLle~Ga~~~l~~~~l~~-~is~~~~~~~~~~~-~~~--~~~~~~lsl~~sL~a~r~~~~Aai~IQ~~~R~  657 (848)
                      .+||.++..+|.++.+..++.++.+++ ++++.......... .+.  +..+++.+++|+|.++|++++||.+||++||+
T Consensus       689 s~g~~gia~~lse~~L~~~~~~~~~~~~~~s~~~~~~~~~~t~~e~s~~~~~~~~sl~Dtl~avrdAa~aa~r~q~vfr~  768 (975)
T KOG0520|consen  689 ANGHKGIAGYLSEKALSAHLSNLELADPNLSADSEEDKAEKTSSEGSPNPDEDSDSLKDTLAAVRDAAQAAARIQAVFRA  768 (975)
T ss_pred             cccccchHHHHhhhHHHHHHhhccccccccCCCchhhhhhhccCCCCCCCCccccccccccccccchHHHHHhhhhhhhh
Confidence            999999999999999999999999988 55554433333322 222  22345567999999999999999999999999


Q ss_pred             hHHHHHHHH-hhcCChHHHHHHHHHHHHHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHH
Q 003098          658 HSLKVQTKA-IRFSSPEEEAQNIIAALKIQHAFRNFEVRKKMAAAARIQHRFRSWKVRKEFLNMRRQAIKIQAAFRGFQV  736 (848)
Q Consensus       658 ~~~Rkr~~~-~r~~~~~~~~~~~~Aa~~IQ~~~R~~~~r~~~~aA~~IQa~~Rg~~~Rk~~~~~r~aai~IQa~~Rg~~~  736 (848)
                      ...++...+ +...............+.++..++++..|..-.+|..||.+||+|+.|+.|+..|+.+++||+++||++.
T Consensus       769 ~~~~~~~a~~i~~~~~~~i~~~~~~~m~~~~a~~~~~~r~~~~aa~~iq~~f~~yk~r~~~l~tr~p~v~iqa~~rg~q~  848 (975)
T KOG0520|consen  769 QSFQKKQAREIMDATKEQISEELAVSMKASSAFSMCDDRSDPAAASRIQKKFRGYKQRKEFLSTRQPIVKIQAAVRGYQV  848 (975)
T ss_pred             hhhhhhhHHHHHhhcchhhhhhhhhhhhcccchhcCccccchhHHHHhhhhhhhHHhhhhhcccCCccccchhhhhchhH
Confidence            999865544 3333445566777788899999987777777789999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhhhhhhhccCCCCCC---chhHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 003098          737 RKQYGKILWSVGVLEKAILRWRLKRKGFRGLQVDRVEVEAVSDPNHE---GDAEEDFYRASRKQAEERVERSVVRVQSMF  813 (848)
Q Consensus       737 Rk~y~~~~~aa~~IQ~~~R~~r~~r~~~r~lr~~~~~~~~~~~q~qa---~~~~~~~~~~~R~q~~~~~~~A~irIQs~~  813 (848)
                      |+.|+++.|++.++.+.+.+||++++.+|+++.++...    .|..+   .++++++|+..|++.++++.+|+++||+|+
T Consensus       849 r~dy~ki~wSv~~lek~~lrwR~k~~g~Rgfk~~~~~e----~~~~a~t~~e~~yd~yKq~~~~~~~r~~~A~~~VQsm~  924 (975)
T KOG0520|consen  849 RKDYRKITWSVGVLEKLILRWRRKGKGFRGFKGRALFE----EQETAATVIEDCYDFYKQLRKQTEERLTRAVVRVQSMF  924 (975)
T ss_pred             hhhhheechhhhHHHHHHHHHHHhhhhhcccccccchh----ccccccchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            99999999999999999999999999999999886431    11111   268999999999999999999999999999


Q ss_pred             hHHHHHHHHHHHHHHHHHHHHHH
Q 003098          814 RSKKAQEEYRRMKLAHDQAKLEY  836 (848)
Q Consensus       814 R~~~aRr~~~~lk~~~~qak~e~  836 (848)
                      |.+++|.+|+|+....++.++.+
T Consensus       925 rs~~a~qqyrR~~~~~~~~~~~~  947 (975)
T KOG0520|consen  925 RSPKAQQQYRRLLLVYEQYQESY  947 (975)
T ss_pred             cCHHHHHHHHHHHHHHHHHHhhh
Confidence            99999999999999999988865



>PF03859 CG-1: CG-1 domain; InterPro: IPR005559 CG-1 domains are highly conserved domains of about 130 amino-acid residues containing a predicted bipartite NLS and named after a partial cDNA clone isolated from parsley encoding a sequence-specific DNA-binding protein [] Back     alignment and domain information
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd01175 IPT_COE IPT domain of the COE family (Col/Olf-1/EBF) of non-basic, helix-loop-helix (HLH)-containing transcription factors Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PF01833 TIG: IPT/TIG domain; InterPro: IPR002909 This family consists of a domain that has an immunoglobulin like fold Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>cd01179 IPT_plexin_repeat2 Second repeat of the IPT domain of Plexins and Cell Surface Receptors (PCSR) Back     alignment and domain information
>cd00102 IPT Immunoglobulin-like fold, Plexins, Transcription factors (IPT) Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>cd00603 IPT_PCSR IPT domain of Plexins and Cell Surface Receptors (PCSR) and related proteins Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>cd01180 IPT_plexin_repeat1 First repeat of the IPT domain of Plexins and Cell Surface Receptors (PCSR) Back     alignment and domain information
>smart00429 IPT ig-like, plexins, transcription factors Back     alignment and domain information
>KOG0160 consensus Myosin class V heavy chain [Cytoskeleton] Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>COG5022 Myosin heavy chain [Cytoskeleton] Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>cd01181 IPT_plexin_repeat3 Third repeat of the IPT domain of Plexins and Cell Surface Receptors (PCSR) Back     alignment and domain information
>KOG0160 consensus Myosin class V heavy chain [Cytoskeleton] Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>cd02849 CGTase_C_term Cgtase (cyclodextrin glycosyltransferase) C-terminus domain Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>cd00604 IPT_CGTD IPT domain (domain D) of cyclodextrin glycosyltransferase (CGTase) and similar enzymes Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0164 consensus Myosin class I heavy chain [Cytoskeleton] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG0164 consensus Myosin class I heavy chain [Cytoskeleton] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF00612 IQ: IQ calmodulin-binding motif; InterPro: IPR000048 The IQ motif is an extremely basic unit of about 23 amino acids, whose conserved core usually fits the consensus A-x(3)-I-Q-x(2)-F-R-x(4)-K-K Back     alignment and domain information
>COG5022 Myosin heavy chain [Cytoskeleton] Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>PF00612 IQ: IQ calmodulin-binding motif; InterPro: IPR000048 The IQ motif is an extremely basic unit of about 23 amino acids, whose conserved core usually fits the consensus A-x(3)-I-Q-x(2)-F-R-x(4)-K-K Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG3836 consensus HLH transcription factor EBF/Olf-1 and related DNA binding proteins [Transcription] Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>cd00602 IPT_TF IPT domain of eukaryotic transcription factors NF-kappaB/Rel, nuclear factor of activated Tcells (NFAT), and recombination signal J-kappa binding protein (RBP-Jkappa) Back     alignment and domain information
>cd01178 IPT_NFAT IPT domain of the NFAT family of transcription factors Back     alignment and domain information
>PTZ00014 myosin-A; Provisional Back     alignment and domain information
>cd01176 IPT_RBP-Jkappa IPT domain of the recombination signal Jkappa binding protein (RBP-Jkappa) Back     alignment and domain information
>smart00015 IQ Short calmodulin-binding motif containing conserved Ile and Gln residues Back     alignment and domain information
>KOG2128 consensus Ras GTPase-activating protein family - IQGAP [Signal transduction mechanisms] Back     alignment and domain information
>KOG3610 consensus Plexins (functional semaphorin receptors) [Signal transduction mechanisms] Back     alignment and domain information
>KOG2128 consensus Ras GTPase-activating protein family - IQGAP [Signal transduction mechanisms] Back     alignment and domain information
>cd01177 IPT_NFkappaB IPT domain of the transcription factor NFkappaB and related transcription factors Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>PTZ00014 myosin-A; Provisional Back     alignment and domain information
>smart00015 IQ Short calmodulin-binding motif containing conserved Ile and Gln residues Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0163 consensus Myosin class VI heavy chain [Cytoskeleton] Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query848
2cxk_A95 Crystal Structure Of The Tig Domain Of Human Calmod 6e-10
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 4e-05
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 1e-04
3q9u_C158 In Silico And In Vitro Co-Evolution Of A High Affin 1e-04
2ix7_C58 Structure Of Apo-Calmodulin Bound To Unconventional 2e-04
2dfs_A 1080 3-D Structure Of Myosin-V Inhibited State Length = 3e-04
2xeh_A157 Structural Determinants For Improved Thermal Stabil 3e-04
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 3e-04
4atz_D154 Ad5 Knob In Complex With A Designed Ankyrin Repeat 3e-04
2j8s_D169 Drug Export Pathway Of Multidrug Exporter Acrb Reve 4e-04
4f6r_D169 Tubulin:stathmin-Like Domain Complex Length = 169 5e-04
2qyj_A166 Crystal Structure Of A Designed Full Consensus Anky 5e-04
4dui_A169 Darpin D1 Binding To Tubulin Beta Chain (not In Com 5e-04
4drx_E169 Gtp-Tubulin In Complex With A Darpin Length = 169 6e-04
1qym_A227 X-Ray Structure Of Human Gankyrin Length = 227 6e-04
1uoh_A226 Human Gankyrin Length = 226 6e-04
2p2c_P169 Inhibition Of Caspase-2 By A Designed Ankyrin Repea 7e-04
1svx_A169 Crystal Structure Of A Designed Selected Ankyrin Re 8e-04
2dvw_A231 Structure Of The Oncoprotein Gankyrin In Complex Wi 9e-04
>pdb|2CXK|A Chain A, Crystal Structure Of The Tig Domain Of Human Calmodulin- Binding Transcription Activator 1 (Camta1) Length = 95 Back     alignment and structure

Iteration: 1

Score = 63.2 bits (152), Expect = 6e-10, Method: Composition-based stats. Identities = 30/88 (34%), Positives = 51/88 (57%), Gaps = 6/88 (6%) Query: 298 ITDVSPAWAFSNEKTKILVTGFFHKDCLHLSKSNMFCVCGEVRVPAEFVQAGVYRCFLPP 357 +TD SP W++ K+L+TG + + + +N C+ ++ VPA +Q GV RC+ P Sbjct: 9 VTDYSPEWSYPEGGVKVLITGPWQE-----ASNNYSCLFDQISVPASLIQPGVLRCYCPA 63 Query: 358 HSPGLFLLYMSLDGHKPISQVLNFEYRS 385 H GL L ++ + ++ IS + FEY+S Sbjct: 64 HDTGLVTLQVAFN-NQIISNSVVFEYKS 90
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 Back     alignment and structure
>pdb|2IX7|C Chain C, Structure Of Apo-Calmodulin Bound To Unconventional Myosin V Length = 58 Back     alignment and structure
>pdb|2DFS|A Chain A, 3-D Structure Of Myosin-V Inhibited State Length = 1080 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure
>pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 Back     alignment and structure
>pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 Back     alignment and structure
>pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 Back     alignment and structure
>pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 Back     alignment and structure
>pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 Back     alignment and structure
>pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 Back     alignment and structure
>pdb|1QYM|A Chain A, X-Ray Structure Of Human Gankyrin Length = 227 Back     alignment and structure
>pdb|1UOH|A Chain A, Human Gankyrin Length = 226 Back     alignment and structure
>pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 Back     alignment and structure
>pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 Back     alignment and structure
>pdb|2DVW|A Chain A, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 231 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query848
2cxk_A95 Camta1, calmodulin binding transcription activator 2e-31
2ix7_C58 Myosin-5A; contractIle protein/metal binding, acti 1e-15
2ix7_C58 Myosin-5A; contractIle protein/metal binding, acti 5e-07
2ix7_C58 Myosin-5A; contractIle protein/metal binding, acti 4e-05
2dfs_A 1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 7e-15
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-12
2ycu_A995 Non muscle myosin 2C, alpha-actinin; motor protein 3e-10
2ycu_A995 Non muscle myosin 2C, alpha-actinin; motor protein 4e-05
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 1e-09
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 2e-07
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 4e-07
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 1e-06
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 4e-06
1g8x_A1010 Myosin II heavy chain fused to alpha-actinin 3; mo 2e-09
1g8x_A1010 Myosin II heavy chain fused to alpha-actinin 3; mo 3e-05
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 3e-09
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 5e-08
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 7e-07
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 2e-06
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 1e-05
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 4e-09
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 1e-07
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 2e-06
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 7e-09
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 2e-05
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 3e-04
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 8e-09
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 2e-06
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 1e-05
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 4e-04
1sw6_A327 Regulatory protein SWI6; transcription regulation, 1e-08
1sw6_A327 Regulatory protein SWI6; transcription regulation, 3e-07
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-08
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-06
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 9e-06
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 5e-05
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-04
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-04
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 6e-04
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 1e-08
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 2e-05
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 1e-08
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 2e-08
3v31_A167 Ankyrin repeat family A protein 2; structural geno 2e-08
3v31_A167 Ankyrin repeat family A protein 2; structural geno 2e-08
3v31_A167 Ankyrin repeat family A protein 2; structural geno 4e-07
3v31_A167 Ankyrin repeat family A protein 2; structural geno 6e-07
3v31_A167 Ankyrin repeat family A protein 2; structural geno 5e-06
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 2e-08
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 3e-08
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 1e-07
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 6e-05
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-08
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-08
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 4e-08
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-07
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-07
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 5e-07
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 7e-07
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-04
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 3e-08
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 4e-08
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 3e-07
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 3e-07
1awc_B153 Protein (GA binding protein beta 1); complex (tran 4e-08
1awc_B153 Protein (GA binding protein beta 1); complex (tran 7e-07
1awc_B153 Protein (GA binding protein beta 1); complex (tran 1e-06
3v30_A172 DNA-binding protein rfxank; structural genomics co 4e-08
3v30_A172 DNA-binding protein rfxank; structural genomics co 5e-08
3v30_A172 DNA-binding protein rfxank; structural genomics co 6e-07
3v30_A172 DNA-binding protein rfxank; structural genomics co 8e-07
3v30_A172 DNA-binding protein rfxank; structural genomics co 2e-04
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 5e-08
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 1e-07
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 7e-07
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 1e-06
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 2e-05
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 5e-05
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 6e-08
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 4e-07
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 3e-06
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 8e-06
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 1e-05
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 3e-05
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 4e-05
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 6e-05
3deo_A183 Signal recognition particle 43 kDa protein; chloro 7e-08
3deo_A183 Signal recognition particle 43 kDa protein; chloro 1e-07
3deo_A183 Signal recognition particle 43 kDa protein; chloro 2e-07
3deo_A183 Signal recognition particle 43 kDa protein; chloro 8e-04
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 7e-08
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 1e-07
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 4e-07
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 8e-07
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-06
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 4e-06
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 7e-08
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 3e-07
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-06
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-06
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 1e-05
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 4e-05
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 9e-08
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 9e-08
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 1e-06
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 1e-06
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 9e-06
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 1e-07
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 4e-07
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 8e-07
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 1e-07
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 1e-07
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 1e-06
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-06
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 9e-06
2rfa_A232 Transient receptor potential cation channel subfa 1e-07
2rfa_A232 Transient receptor potential cation channel subfa 1e-06
2rfa_A232 Transient receptor potential cation channel subfa 5e-06
2rfa_A232 Transient receptor potential cation channel subfa 8e-06
2rfa_A232 Transient receptor potential cation channel subfa 3e-05
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 1e-07
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 2e-07
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 2e-07
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-07
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-07
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 3e-07
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-06
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-06
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 6e-06
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-05
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 2e-07
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 1e-06
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 3e-06
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 8e-05
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 2e-07
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 4e-06
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 2e-05
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 2e-07
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 2e-07
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 6e-07
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 2e-04
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 2e-07
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 2e-06
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 2e-05
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 2e-05
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 2e-04
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 3e-07
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 7e-07
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 8e-07
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 3e-06
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 4e-06
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 6e-06
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 5e-05
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 3e-07
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 3e-07
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 9e-07
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 1e-06
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 5e-05
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 3e-07
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 1e-06
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-06
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 3e-06
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 3e-06
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 1e-05
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 5e-05
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 4e-04
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 3e-07
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 2e-06
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 2e-06
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 2e-05
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 2e-05
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 4e-04
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 4e-07
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 2e-06
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 6e-06
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 6e-06
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 4e-07
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 5e-07
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 8e-07
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 9e-07
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 1e-06
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 2e-06
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 9e-06
1kk8_A837 Myosin heavy chain, striated muscle; actin-detache 4e-07
3hra_A201 Ankyrin repeat family protein; structural protein; 4e-07
3hra_A201 Ankyrin repeat family protein; structural protein; 2e-06
3hra_A201 Ankyrin repeat family protein; structural protein; 1e-05
3hra_A201 Ankyrin repeat family protein; structural protein; 4e-05
3hra_A201 Ankyrin repeat family protein; structural protein; 5e-05
3hra_A201 Ankyrin repeat family protein; structural protein; 3e-04
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 5e-07
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 9e-07
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 1e-06
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 4e-06
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 1e-05
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 4e-05
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 1e-04
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 7e-07
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 9e-07
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 3e-06
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 3e-06
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-05
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-05
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 3e-04
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 7e-07
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 8e-07
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 1e-06
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 3e-04
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 7e-07
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 1e-06
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 1e-06
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 3e-04
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 3e-04
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 8e-07
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 1e-06
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 4e-06
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 6e-05
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 6e-04
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 9e-07
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 1e-06
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 3e-06
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 2e-04
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 3e-04
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 1e-06
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 1e-06
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 5e-04
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 1e-06
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 4e-06
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 4e-06
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 1e-05
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 2e-05
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 6e-04
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 3e-06
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 9e-06
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 2e-04
2etb_A256 Transient receptor potential cation channel subfam 4e-06
2etb_A256 Transient receptor potential cation channel subfam 1e-04
2etb_A256 Transient receptor potential cation channel subfam 9e-04
2pnn_A273 Transient receptor potential cation channel subfa 6e-06
2pnn_A273 Transient receptor potential cation channel subfa 3e-05
3jxi_A260 Vanilloid receptor-related osmotically activated p 8e-06
3jxi_A260 Vanilloid receptor-related osmotically activated p 3e-05
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 2e-05
3muj_A138 Transcription factor COE3; immunoglobulin like fol 2e-05
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 3e-05
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 8e-05
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 2e-04
>2cxk_A Camta1, calmodulin binding transcription activator 1; structural genomics, TIG/IPT domain, NPPSFA; 1.85A {Homo sapiens} SCOP: b.1.18.1 Length = 95 Back     alignment and structure
 Score =  116 bits (293), Expect = 2e-31
 Identities = 30/92 (32%), Positives = 50/92 (54%), Gaps = 6/92 (6%)

Query: 295 LFSITDVSPAWAFSNEKTKILVTGFFHKDCLHLSKSNMFCVCGEVRVPAEFVQAGVYRCF 354
              +TD SP W++     K+L+TG + +     + +N  C+  ++ VPA  +Q GV RC+
Sbjct: 6   SGMVTDYSPEWSYPEGGVKVLITGPWQE-----ASNNYSCLFDQISVPASLIQPGVLRCY 60

Query: 355 LPPHSPGLFLLYMSLDGHKPISQVLNFEYRSP 386
            P H  GL  L ++ +  + IS  + FEY+S 
Sbjct: 61  CPAHDTGLVTLQVAFNN-QIISNSVVFEYKSG 91


>2ix7_C Myosin-5A; contractIle protein/metal binding, actin-binding, UBL conjugation, Ca2+ regulation, myosin, calcium, IQ motif, acetylation; 2.5A {Mus musculus} Length = 58 Back     alignment and structure
>2ix7_C Myosin-5A; contractIle protein/metal binding, actin-binding, UBL conjugation, Ca2+ regulation, myosin, calcium, IQ motif, acetylation; 2.5A {Mus musculus} Length = 58 Back     alignment and structure
>2ix7_C Myosin-5A; contractIle protein/metal binding, actin-binding, UBL conjugation, Ca2+ regulation, myosin, calcium, IQ motif, acetylation; 2.5A {Mus musculus} Length = 58 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2ycu_A Non muscle myosin 2C, alpha-actinin; motor protein; HET: AOV; 2.25A {Homo sapiens} PDB: 1br1_A* 1br4_A* 1br2_A* Length = 995 Back     alignment and structure
>2ycu_A Non muscle myosin 2C, alpha-actinin; motor protein; HET: AOV; 2.25A {Homo sapiens} PDB: 1br1_A* 1br4_A* 1br2_A* Length = 995 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 Back     alignment and structure
>1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>1kk8_A Myosin heavy chain, striated muscle; actin-detached, mechanics of motor, contractIle PROT; HET: ADP; 2.30A {Argopecten irradians} SCOP: b.34.3.1 c.37.1.9 PDB: 1kk7_A* 1qvi_A* 1s5g_A* 1sr6_A 1b7t_A* 1kqm_A* 1kwo_A* 1l2o_A* 1dfl_A* 2w4t_C 2w4v_C 2w4w_C 1dfk_A 2ec6_A 2otg_A* 2os8_A* 2ovk_A 2ekv_A 2ekw_A 2oy6_A* ... Length = 837 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3muj_A Transcription factor COE3; immunoglobulin like fold, helix-loop-helix, structural genom consortium, SGC, DNA binding protein; 1.92A {Homo sapiens} PDB: 3mqi_A Length = 138 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query848
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.9
2cxk_A95 Camta1, calmodulin binding transcription activator 99.89
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.88
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.86
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.84
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.84
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.83
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.83
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.82
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.82
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 99.82
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.82
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.82
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.82
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.82
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.81
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.81
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.81
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.81
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.8
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.8
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.8
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.8
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.8
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.8
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 99.8
2dfs_A 1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 99.79
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.79
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.79
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.79
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 99.79
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 99.79
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 99.79
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 99.78
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.78
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.78
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 99.78
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 99.78
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.78
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 99.78
2etb_A256 Transient receptor potential cation channel subfam 99.77
2pnn_A273 Transient receptor potential cation channel subfa 99.77
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.77
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.77
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 99.77
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.77
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 99.77
2rfa_A232 Transient receptor potential cation channel subfa 99.77
2rfa_A232 Transient receptor potential cation channel subfa 99.77
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.77
3hra_A201 Ankyrin repeat family protein; structural protein; 99.77
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.77
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.77
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 99.77
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 99.77
2etb_A256 Transient receptor potential cation channel subfam 99.76
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 99.76
3hra_A201 Ankyrin repeat family protein; structural protein; 99.76
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 99.76
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.76
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.76
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.76
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 99.76
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 99.76
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 99.75
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.75
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.75
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 99.75
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 99.75
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 99.75
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.74
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.74
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 99.74
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.74
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 99.74
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 99.74
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.74
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.74
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 99.73
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.73
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 99.73
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 99.73
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 99.73
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.73
2pnn_A273 Transient receptor potential cation channel subfa 99.73
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 99.73
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 99.72
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.72
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.72
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 99.71
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.71
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 99.71
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 99.71
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 99.7
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 99.7
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 99.69
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 99.69
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 99.69
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.68
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.67
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.67
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.66
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.66
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.66
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.65
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.65
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.62
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.61
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 99.61
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.6
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.54
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.47
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.46
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.44
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.44
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.43
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.42
3muj_A138 Transcription factor COE3; immunoglobulin like fol 98.9
2ix7_C58 Myosin-5A; contractIle protein/metal binding, acti 98.84
1n2d_C48 IQ2 and IQ3 motifs from MYO2P, A class V myosin; p 98.65
3mlp_A402 Transcription factor COE1; transcription factor, p 98.56
2ix7_C58 Myosin-5A; contractIle protein/metal binding, acti 98.47
1n2d_C48 IQ2 and IQ3 motifs from MYO2P, A class V myosin; p 98.33
1uad_C99 RSEC5, exocyst complex component SEC5; small GTP-b 97.95
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 97.68
3kya_A496 Putative phosphatase; structural genomics, joint c 97.53
2uzx_B727 Hepatocyte growth factor receptor; signaling prote 97.49
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 97.29
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 97.22
2uzx_B727 Hepatocyte growth factor receptor; signaling prote 97.12
2yrp_A114 Nuclear factor of activated T-cells, cytoplasmic 4 97.04
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 97.02
1wdc_A64 Scallop myosin; calcium binding protein, muscle pr 96.94
2bl0_A63 Major plasmodial myosin heavy chain; muscle protei 96.89
1kk8_A837 Myosin heavy chain, striated muscle; actin-detache 96.88
2bl0_A63 Major plasmodial myosin heavy chain; muscle protei 96.66
1wdc_A64 Scallop myosin; calcium binding protein, muscle pr 96.65
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 96.62
1kk8_A837 Myosin heavy chain, striated muscle; actin-detache 95.87
1ikn_C119 P50D, protein (NF-kappa-B P50D subunit); transcrip 95.61
1my7_A114 NF-kappab P65 (RELA) subunit; immunoglobulin, IG, 94.96
1u36_A106 DNA-binding, nuclear factor NF-kappa-B P105 subuni 94.94
1oy3_C136 Transcription factor P65; protein-protein complex, 94.06
1zk9_A110 Transcription factor RELB; NF-KB, transcription fa 93.92
2l53_B31 CAM, voltage-gated sodium channel type V alpha iso 92.36
2kxw_B27 Sodium channel protein type 2 subunit alpha; actio 92.34
3gn4_A148 Myosin-VI; unconventional myosin, motility, lever 91.85
2v2t_A288 RELB, transcription factor RELB; 4-diphosphocytidy 91.74
1nfk_A325 Protein (nuclear factor kappa-B (NF-KB)); NF-KB P5 91.62
1a3q_A285 Protein (nuclear factor kappa-B P52); transcriptio 91.3
1ikn_A286 P65, protein (NF-kappa-B P65 subunit); transcripti 90.71
1p7h_L286 Nuclear factor of activated T-cells, cytoplasmic 2 90.04
2o61_A540 Transcription factor P65/interferon regulatory FA 89.92
3iag_C422 Recombining binding protein suppressor of hairless 89.53
1svc_P365 Protein (nuclear factor kappa-B (NF-KB)); DNA-bind 89.49
2l53_B31 CAM, voltage-gated sodium channel type V alpha iso 89.45
2kxw_B27 Sodium channel protein type 2 subunit alpha; actio 88.68
1imh_C281 NF-AT5, tonebp, nuclear factor of activated T cell 88.09
1gji_A275 C-REL protein, C-REL proto-oncogene protein; NF-KB 87.37
4anj_A 1052 Unconventional myosin-VI, green fluorescent prote; 85.32
3gn4_A148 Myosin-VI; unconventional myosin, motility, lever 85.06
3orj_A439 Sugar-binding protein; structural genomics, joint 84.43
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
Probab=99.90  E-value=4.7e-23  Score=205.20  Aligned_cols=131  Identities=22%  Similarity=0.313  Sum_probs=115.6

Q ss_pred             CcccccchHHHHHHcCCcHHHHHHHHHc-CCCCccccCCCCchHHHHHHcCCHHHHHHHHHCCCCCccccCCCCcHHHHH
Q 003098          463 SLPEAKDSFFELTLKSKLKEWLLERVVE-GSKTTEYDVHGQGVIHLCAMLGYTWAILLFSWSGLSLDFRDKYGWTALHWA  541 (848)
Q Consensus       463 ~~~~~~~~ll~aa~~~~l~e~Ll~~L~~-Ga~in~~D~~G~T~LH~Aa~~G~~~~v~~LL~~Ga~in~~D~~G~TpLh~A  541 (848)
                      ....+.++++.++..+...  ++..|++ |++++..|..|+||||+|+..|+.++|++|+++|+++|.+|..|+||||+|
T Consensus        33 ~d~~g~t~l~~a~~~~~~~--~~~~ll~~gad~~~~d~~g~TpLh~A~~~g~~~~v~~Ll~~gadvn~~d~~G~TpLh~A  110 (169)
T 4gpm_A           33 SDSDGRTPLHHAAENGHKE--VVKLLISKGADVNAKDSDGRTPLHHAAENGHKEVVKLLISKGADVNAKDSDGRTPLHHA  110 (169)
T ss_dssp             CCTTSCCHHHHHHHTTCHH--HHHHHHHTTCCTTCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCCTTCCCTTSCCHHHHH
T ss_pred             cCCCCCCHHHHHHHcCCHH--HHHHHHhcccchhhhccCCCCHHHHHHHcCCHHHHHHHHHCcCCCCCCCCCCCCHHHHH
Confidence            3456788999998888765  4444444 999999999999999999999999999999999999999999999999999


Q ss_pred             HHcCCHHHHHHHHHcCCCCCCCCCCCCCCCCCCCHHHHHHHcCChHHHHHHHhhhhhhcc
Q 003098          542 AYYGREKMVVDLLSAGAKPNLVTDPTSQNPGGLNAADIASKKGFDGLAAFLSEQALVAQF  601 (848)
Q Consensus       542 a~~G~~eiv~~LL~~GA~in~~td~~~~d~~G~TpL~lA~~~G~~~iv~lLle~Ga~~~l  601 (848)
                      +..|+.++|++|++.|++++.      +|..|.|||++|+..|+.+++++|+++||+..-
T Consensus       111 ~~~g~~~~v~~Ll~~gad~~~------~d~~G~TpL~~A~~~g~~~iv~~Ll~~GA~ie~  164 (169)
T 4gpm_A          111 AENGHKEVVKLLISKGADVNT------SDSDGRTPLDLAREHGNEEVVKLLEKQGGWLEH  164 (169)
T ss_dssp             HHTTCHHHHHHHHHTTCCTTC------CCTTSCCHHHHHHHTTCHHHHHHHHTC------
T ss_pred             HHcCCHHHHHHHHHcCCCccc------cCCCCCCHHHHHHHcCCHHHHHHHHHCCCCcCC
Confidence            999999999999999999998      889999999999999999999999999998743



>2cxk_A Camta1, calmodulin binding transcription activator 1; structural genomics, TIG/IPT domain, NPPSFA; 1.85A {Homo sapiens} SCOP: b.1.18.1 Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>3muj_A Transcription factor COE3; immunoglobulin like fold, helix-loop-helix, structural genom consortium, SGC, DNA binding protein; 1.92A {Homo sapiens} PDB: 3mqi_A Back     alignment and structure
>2ix7_C Myosin-5A; contractIle protein/metal binding, actin-binding, UBL conjugation, Ca2+ regulation, myosin, calcium, IQ motif, acetylation; 2.5A {Mus musculus} Back     alignment and structure
>1n2d_C IQ2 and IQ3 motifs from MYO2P, A class V myosin; protein-peptide complex, myosin light chain, cell cycle; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3mlp_A Transcription factor COE1; transcription factor, pseudo-IG-fold, TIG-domain, IPT-domain loop-helix; HET: DNA CIT; 2.80A {Mus musculus} PDB: 3n50_A Back     alignment and structure
>2ix7_C Myosin-5A; contractIle protein/metal binding, actin-binding, UBL conjugation, Ca2+ regulation, myosin, calcium, IQ motif, acetylation; 2.5A {Mus musculus} Back     alignment and structure
>1n2d_C IQ2 and IQ3 motifs from MYO2P, A class V myosin; protein-peptide complex, myosin light chain, cell cycle; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1uad_C RSEC5, exocyst complex component SEC5; small GTP-binding protein, immunogloblin-like fold, beta- sandwich, endocytosis/exocytosis complex; HET: GNP; 2.10A {Rattus norvegicus} SCOP: b.1.18.18 PDB: 1hk6_A Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2uzx_B Hepatocyte growth factor receptor; signaling protein/receptor, leucine rich repeat, receptor ectodomain, signaling protein, ATP-binding; 2.8A {Homo sapiens} PDB: 2uzy_B 1shy_B 1ssl_A Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>2uzx_B Hepatocyte growth factor receptor; signaling protein/receptor, leucine rich repeat, receptor ectodomain, signaling protein, ATP-binding; 2.8A {Homo sapiens} PDB: 2uzy_B 1shy_B 1ssl_A Back     alignment and structure
>2yrp_A Nuclear factor of activated T-cells, cytoplasmic 4; beta-sandwich, immunoglobulin-like fold, TIG domain, IPT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Back     alignment and structure
>1wdc_A Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} PDB: 3jvt_A 3jtd_A 3pn7_A 3ts5_A 3tuy_A* 1scm_A Back     alignment and structure
>2bl0_A Major plasmodial myosin heavy chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>1kk8_A Myosin heavy chain, striated muscle; actin-detached, mechanics of motor, contractIle PROT; HET: ADP; 2.30A {Argopecten irradians} SCOP: b.34.3.1 c.37.1.9 PDB: 1kk7_A* 1qvi_A* 1s5g_A* 1sr6_A 1b7t_A* 1kqm_A* 1kwo_A* 1l2o_A* 1dfl_A* 2w4t_C 2w4v_C 2w4w_C 1dfk_A 2ec6_A 2otg_A* 2os8_A* 2ovk_A 2ekv_A 2ekw_A 2oy6_A* ... Back     alignment and structure
>2bl0_A Major plasmodial myosin heavy chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>1wdc_A Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} PDB: 3jvt_A 3jtd_A 3pn7_A 3ts5_A 3tuy_A* 1scm_A Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Back     alignment and structure
>1kk8_A Myosin heavy chain, striated muscle; actin-detached, mechanics of motor, contractIle PROT; HET: ADP; 2.30A {Argopecten irradians} SCOP: b.34.3.1 c.37.1.9 PDB: 1kk7_A* 1qvi_A* 1s5g_A* 1sr6_A 1b7t_A* 1kqm_A* 1kwo_A* 1l2o_A* 1dfl_A* 2w4t_C 2w4v_C 2w4w_C 1dfk_A 2ec6_A 2otg_A* 2os8_A* 2ovk_A 2ekv_A 2ekw_A 2oy6_A* ... Back     alignment and structure
>1ikn_C P50D, protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Mus musculus} SCOP: b.1.18.1 Back     alignment and structure
>1my7_A NF-kappab P65 (RELA) subunit; immunoglobulin, IG, beta-sandwich, beta-sheet, homodimerdna- binding, transcription regulation, activator; 1.49A {Mus musculus} SCOP: b.1.18.1 PDB: 1my5_A 1bft_A Back     alignment and structure
>1u36_A DNA-binding, nuclear factor NF-kappa-B P105 subunit; transcription factor, NF-KB, dimerization domain, intertwined folding; 1.89A {Mus musculus} SCOP: b.1.18.1 PDB: 1u3z_A 1u3y_A 3jv4_B 1bfs_A 1u3j_A 1u42_A 1u41_A 1nfi_B Back     alignment and structure
>1oy3_C Transcription factor P65; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: b.1.18.1 PDB: 1k3z_A Back     alignment and structure
>1zk9_A Transcription factor RELB; NF-KB, transcription factors, intertwined dimer; 2.18A {Mus musculus} PDB: 1zka_A 3jv6_A 3jv4_A 3jss_A 3juz_A 3jv0_A Back     alignment and structure
>2l53_B CAM, voltage-gated sodium channel type V alpha isoform variant; calmodulin, IQ motif, complex, Ca-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2kxw_B Sodium channel protein type 2 subunit alpha; action potential, amino acid motifs, animals, autism, biomol brain chemistry; NMR {Rattus norvegicus} Back     alignment and structure
>3gn4_A Myosin-VI; unconventional myosin, motility, lever ARM, 3-helix bundle, actin-binding, ATP-binding, calmodulin-binding, coiled coil; 2.70A {Sus scrofa} Back     alignment and structure
>2v2t_A RELB, transcription factor RELB; 4-diphosphocytidyl-2C-methyl-D-erythritol, aquifex aeolicus, nucleotide-binding, isoprene biosynthesis; 3.05A {Mus musculus} PDB: 3do7_A Back     alignment and structure
>1nfk_A Protein (nuclear factor kappa-B (NF-KB)); NF-KB P50, complex (transcription factor/DNA), transcription/DNA complex; HET: DNA; 2.30A {Mus musculus} SCOP: b.1.18.1 b.2.5.3 PDB: 2v2t_B 1ooa_A 1lei_B* 1le9_B 1le5_B* 2i9t_B 1vkx_B* 3gut_B 2o61_B Back     alignment and structure
>1a3q_A Protein (nuclear factor kappa-B P52); transcription factor, immune response, DNA-protein complex, transcription/DNA complex; HET: DNA; 2.10A {Homo sapiens} SCOP: b.1.18.1 b.2.5.3 PDB: 3do7_B 3jv6_B 3jv5_A Back     alignment and structure
>1ikn_A P65, protein (NF-kappa-B P65 subunit); transcription factor, IKB/NFKB complex; 2.30A {Mus musculus} SCOP: b.1.18.1 b.2.5.3 PDB: 1nfi_A 2ram_A* 1ram_A* 2i9t_A 1lei_A* 1le9_A 1le5_A* 1vkx_A* 3gut_A Back     alignment and structure
>1p7h_L Nuclear factor of activated T-cells, cytoplasmic 2; DNA binding protein, transcription regulation, activator, transcription/DNA complex; 2.60A {Homo sapiens} SCOP: b.1.18.1 b.2.5.3 PDB: 2o93_L 1a02_N* 1pzu_B 1owr_M 2as5_N 1s9k_C 3qrf_N 1nfa_A 1a66_A* Back     alignment and structure
>2o61_A Transcription factor P65/interferon regulatory FA 7/interferon regulatory factor...; protein-DNA complex, transcription-DNA complex; 2.80A {Homo sapiens} Back     alignment and structure
>3iag_C Recombining binding protein suppressor of hairless; protein-DNA complex, signaling, transcription, notch, activator, alternative splicing; HET: XYL; 2.00A {Mus musculus} PDB: 3brg_C* 3nbn_A 2f8x_C 3v79_C* Back     alignment and structure
>1svc_P Protein (nuclear factor kappa-B (NF-KB)); DNA-binding, transcription regulation, activator, nuclear protein, phosphorylation, repeat, DNA; HET: DNA; 2.60A {Homo sapiens} SCOP: b.1.18.1 b.2.5.3 Back     alignment and structure
>2l53_B CAM, voltage-gated sodium channel type V alpha isoform variant; calmodulin, IQ motif, complex, Ca-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2kxw_B Sodium channel protein type 2 subunit alpha; action potential, amino acid motifs, animals, autism, biomol brain chemistry; NMR {Rattus norvegicus} Back     alignment and structure
>1imh_C NF-AT5, tonebp, nuclear factor of activated T cells 5; beta barrel, protein-DNA complex, double helix, DNA encirclement, transcription/DNA complex; 2.86A {Homo sapiens} SCOP: b.1.18.1 b.2.5.3 Back     alignment and structure
>1gji_A C-REL protein, C-REL proto-oncogene protein; NF-KB/DNA complex, transcription factor, C-REL homodimer, transcription/DNA complex; 2.85A {Gallus gallus} SCOP: b.1.18.1 b.2.5.3 Back     alignment and structure
>4anj_A Unconventional myosin-VI, green fluorescent prote; motor protein-metal-bindng protein complex, molecular motor, metal-binding protein, transition state; HET: CR2 ADP; 2.60A {Sus scrofa} Back     alignment and structure
>3gn4_A Myosin-VI; unconventional myosin, motility, lever ARM, 3-helix bundle, actin-binding, ATP-binding, calmodulin-binding, coiled coil; 2.70A {Sus scrofa} Back     alignment and structure
>3orj_A Sugar-binding protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology; 2.16A {Bacteroides ovatus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 848
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-11
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 8e-09
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 6e-07
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-05
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 3e-05
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 3e-05
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 3e-04
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 0.001
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 5e-11
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 6e-04
d2cxka182 b.1.18.1 (A:872-953) Calmodulin binding transcript 4e-10
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 1e-09
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 3e-09
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 8e-06
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 2e-04
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 1e-08
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 7e-07
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 0.004
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-07
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 4e-06
d2mysa2794 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain 3e-07
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 5e-07
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 6e-07
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 0.003
d1kk8a2789 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain 9e-07
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 3e-06
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 5e-06
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 1e-05
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 1e-05
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 0.002
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 0.004
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 2e-05
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 2e-04
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 7e-05
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 0.003
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 9e-05
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-04
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-04
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 3e-04
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 1e-04
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 0.003
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 65.0 bits (157), Expect = 1e-11
 Identities = 24/128 (18%), Positives = 48/128 (37%), Gaps = 11/128 (8%)

Query: 479 KLKEWLLERVVEGSKTTEYDVHGQGVIHLCAMLGYTWAILLFSWSGLSLDFRDKYGWTAL 538
            + + L++    G         G   +H+ +  G    +         ++ + K G++ L
Sbjct: 278 PVADVLIKH---GVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPL 334

Query: 539 HWAAYYGREKMVVDLLSAGAKPNLVTDPTSQNPGGLNAADIASKKGFDGLAAFLSEQALV 598
           H AA  G   +V  LL  GA PN        +  G     IA + G+  +   L  + + 
Sbjct: 335 HQAAQQGHTDIVTLLLKNGASPNE------VSSDGTTPLAIAKRLGYISVTDVL--KVVT 386

Query: 599 AQFNDMTL 606
            + + + +
Sbjct: 387 DETSFVLV 394


>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d2cxka1 b.1.18.1 (A:872-953) Calmodulin binding transcription activator 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Length = 794 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Length = 789 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query848
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.81
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.81
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.8
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.8
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.76
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.74
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.73
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.73
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.73
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.72
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.7
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.7
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.69
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.69
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.67
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.67
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.67
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.67
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.67
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.66
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.66
d2cxka182 Calmodulin binding transcription activator 1 {Huma 99.66
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.65
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.62
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.62
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.61
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.61
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.6
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.58
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.56
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.54
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.51
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.5
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.5
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.48
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.47
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.46
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.38
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.33
d1qhoa181 Five domain "maltogenic" alpha-amylase (glucan 1,4 98.69
d1uadc_92 Exocyst complex component Sec5, Ral-binding domain 98.58
d1p7hl1103 T-cell transcription factor NFAT1 (NFATC2) {Human 98.55
d3bmva183 Cyclomaltodextrin glycanotransferase, domain D {Th 98.43
d3brda1119 DNA-binding protein LAG-1 (CSL) {Caenorhabditis el 98.41
d1cxla187 Cyclomaltodextrin glycanotransferase, domain D {Ba 98.39
d1cyga183 Cyclomaltodextrin glycanotransferase, domain D {Ba 98.35
d2mysa2794 Myosin S1, motor domain {Chicken (Gallus gallus), 97.14
d1kk8a2789 Myosin S1, motor domain {Bay scallop (Aequipecten 97.13
d1imhc1101 T-cell transcription factor NFAT5 (TONEBP) {Human 96.91
d1gjia1100 p65 subunit of NF-kappa B (NFKB), dimerization dom 96.75
d2mysa2794 Myosin S1, motor domain {Chicken (Gallus gallus), 96.54
d1kk8a2789 Myosin S1, motor domain {Bay scallop (Aequipecten 96.46
d1my7a_107 p65 subunit of NF-kappa B (NFKB), dimerization dom 96.35
d1u36a_104 p50 subunit of NF-kappa B transcription factor {Hu 96.03
d1a3qa1101 p52 subunit of NF-kappa B (NFKB) {Human (Homo sapi 95.92
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Cell cycle inhibitor p16ink4A
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.81  E-value=2.4e-20  Score=173.75  Aligned_cols=120  Identities=20%  Similarity=0.262  Sum_probs=109.9

Q ss_pred             ccchHHHHHHcCCcHHHHHHHHHc-CCCCccccCCCCchHHHHHHcCCHHHHHHHHHCCCCCccccCCCC-cHHHHHHHc
Q 003098          467 AKDSFFELTLKSKLKEWLLERVVE-GSKTTEYDVHGQGVIHLCAMLGYTWAILLFSWSGLSLDFRDKYGW-TALHWAAYY  544 (848)
Q Consensus       467 ~~~~ll~aa~~~~l~e~Ll~~L~~-Ga~in~~D~~G~T~LH~Aa~~G~~~~v~~LL~~Ga~in~~D~~G~-TpLh~Aa~~  544 (848)
                      ..+.|+.|+..|++.  +++.|++ |+++|..|..|.||||+|+ .|+.+++++|+++|+++|.+|..|. ||||+|+..
T Consensus         3 ~~~~L~~Aa~~G~~~--~v~~Ll~~gad~n~~~~~g~t~l~~a~-~g~~~~v~~Ll~~ga~~~~~~~~~~~~~L~~A~~~   79 (125)
T d1bi7b_           3 SADWLATAAARGRVE--EVRALLEAGANPNAPNSYGRRPIQVMM-MGSARVAELLLLHGAEPNCADPATLTRPVHDAARE   79 (125)
T ss_dssp             STTHHHHHHHHTCHH--HHHHHHTTTCCTTCCCSSSCCTTTSSC-TTCHHHHHHHHTTTCCCCCCCTTTCCCHHHHHHHH
T ss_pred             ChhHHHHHHHCCCHH--HHHHHHHcCCccccccccccccccccc-ccccccccccccccccccccccccccccccccccc
Confidence            557899999999977  5666666 9999999999999999764 7999999999999999999999876 699999999


Q ss_pred             CCHHHHHHHHHcCCCCCCCCCCCCCCCCCCCHHHHHHHcCChHHHHHHHhh
Q 003098          545 GREKMVVDLLSAGAKPNLVTDPTSQNPGGLNAADIASKKGFDGLAAFLSEQ  595 (848)
Q Consensus       545 G~~eiv~~LL~~GA~in~~td~~~~d~~G~TpL~lA~~~G~~~iv~lLle~  595 (848)
                      |+.+++++|++.|++++.      +|..|.||||+|+.+|+.+++++|++.
T Consensus        80 g~~~~v~~Ll~~ga~~~~------~d~~G~T~l~~A~~~g~~~~v~~Llsa  124 (125)
T d1bi7b_          80 GFLDTLVVLHRAGARLDV------RDAWGRLPVDLAEELGHRDVARYLRAA  124 (125)
T ss_dssp             TCHHHHHHHHHHTCCSSC------CCTTCCCHHHHHHHHTCHHHHHHHSSC
T ss_pred             cccccccccccccccccc------ccCCCCCHHHHHHHcCCHHHHHHHHhc
Confidence            999999999999999998      889999999999999999999999763



>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cxka1 b.1.18.1 (A:872-953) Calmodulin binding transcription activator 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qhoa1 b.1.18.2 (A:496-576) Five domain "maltogenic" alpha-amylase (glucan 1,4-alpha-maltohydrolase), domain D {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1uadc_ b.1.18.18 (C:) Exocyst complex component Sec5, Ral-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p7hl1 b.1.18.1 (L:576-678) T-cell transcription factor NFAT1 (NFATC2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bmva1 b.1.18.2 (A:496-578) Cyclomaltodextrin glycanotransferase, domain D {Thermoanaerobacterium [TaxId: 28895]} Back     information, alignment and structure
>d3brda1 b.1.18.1 (A:542-660) DNA-binding protein LAG-1 (CSL) {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1cxla1 b.1.18.2 (A:497-583) Cyclomaltodextrin glycanotransferase, domain D {Bacillus circulans, different strains [TaxId: 1397]} Back     information, alignment and structure
>d1cyga1 b.1.18.2 (A:492-574) Cyclomaltodextrin glycanotransferase, domain D {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Back     information, alignment and structure
>d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1imhc1 b.1.18.1 (C:368-468) T-cell transcription factor NFAT5 (TONEBP) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gjia1 b.1.18.1 (A:182-281) p65 subunit of NF-kappa B (NFKB), dimerization domain {Chicken (Gallus gallus), C-rel [TaxId: 9031]} Back     information, alignment and structure
>d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Back     information, alignment and structure
>d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1my7a_ b.1.18.1 (A:) p65 subunit of NF-kappa B (NFKB), dimerization domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u36a_ b.1.18.1 (A:) p50 subunit of NF-kappa B transcription factor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a3qa1 b.1.18.1 (A:227-327) p52 subunit of NF-kappa B (NFKB) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure