Citrus Sinensis ID: 003132
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 845 | 2.2.26 [Sep-21-2011] | |||||||
| Q8L7I1 | 984 | Uncharacterized protein A | yes | no | 0.382 | 0.328 | 0.5 | 7e-79 | |
| Q9P1Y6 | 1649 | PHD and RING finger domai | no | no | 0.145 | 0.074 | 0.253 | 7e-07 | |
| A6H619 | 1682 | PHD and RING finger domai | yes | no | 0.145 | 0.073 | 0.267 | 3e-06 | |
| Q63625 | 1685 | PHD and RING finger domai | yes | no | 0.149 | 0.074 | 0.254 | 1e-05 | |
| Q80Z37 | 1033 | E3 ubiquitin-protein liga | no | no | 0.055 | 0.045 | 0.425 | 3e-05 | |
| Q9NS56 | 1045 | E3 ubiquitin-protein liga | yes | no | 0.055 | 0.044 | 0.425 | 4e-05 | |
| O94400 | 571 | PHD and RING finger domai | yes | no | 0.130 | 0.192 | 0.239 | 7e-05 | |
| P09309 | 467 | E3 ubiquitin-protein liga | no | no | 0.063 | 0.115 | 0.444 | 8e-05 | |
| Q9V8P9 | 1038 | E3 ubiquitin-protein liga | no | no | 0.054 | 0.044 | 0.413 | 0.0001 | |
| Q99590 | 1463 | Protein SCAF11 OS=Homo sa | no | no | 0.071 | 0.041 | 0.349 | 0.0002 |
| >sp|Q8L7I1|Y4193_ARATH Uncharacterized protein At4g10930 OS=Arabidopsis thaliana GN=At4g10930 PE=2 SV=1 | Back alignment and function desciption |
|---|
Score = 295 bits (756), Expect = 7e-79, Method: Compositional matrix adjust.
Identities = 176/352 (50%), Positives = 228/352 (64%), Gaps = 29/352 (8%)
Query: 478 DVTSDIMSIVKGTKCKLPKGLAHKNSADRSSKDRENVSGLRVKKIMKRPAEDKDSSELVQ 537
+ T DI SIVKGT + K L N D+SS + EN +GLRVKKI + P ++K+S LV+
Sbjct: 211 NTTVDIFSIVKGTGRR--KNLMRSNPTDKSS-EAENAAGLRVKKIKRTPEDEKESMVLVE 267
Query: 538 ELRKEIREAVRNRSSKDCDENLFDPKLLAAFRAAIAGPKC-EPVKQPAHLAVKVKKSMLE 596
+LRKEIREAVRN+S +D EN FDPKLLAAFRAA+AGPK E ++ + LAVK KK ML+
Sbjct: 268 KLRKEIREAVRNKSMEDIRENQFDPKLLAAFRAAVAGPKTGEAPRRSSALAVKAKKLMLQ 327
Query: 597 KGKVRESLTKKIYGNSNGRRRRAWNRDCEVEFWKYRCMKATKTEKIGTLKSVLDLLRNNS 656
KGKVRE+LTKKIY + NG+R+ AW+RDCEVEFWK+RC++ K EKI TLKSVL LL+N
Sbjct: 328 KGKVRENLTKKIYADLNGKRKSAWHRDCEVEFWKHRCIQGRKPEKIETLKSVLSLLKNKP 387
Query: 657 QSSDTEQSTEC-QETNPILSRLYLADTSVFPRKDNIMPLSALKATDNSEQSKEQAISMEK 715
+ T S+E Q +NPILSRLYLADTSVFPR DN+ PL A K NS+ + + + +
Sbjct: 388 ADTKTNFSSETPQASNPILSRLYLADTSVFPRNDNLKPLLAPKEMGNSQNNGKPTEASKT 447
Query: 716 PLKLSSDNCASKVAETNKVSSKVGVLSAYEKGTRNMSCSKSNAALSKVHPIQLGDPKVNS 775
K+S A+K + SK+ + G N++ S NS
Sbjct: 448 LPKIS----AAKGSSVKAAGSKLNSGNKQSDGQPNLTSS-------------------NS 484
Query: 776 LKGTATSDDVKVDKRKWALEILARKTAVACKSATHEKPEDTAMLKRNYPLLV 827
+ DD+K DKRKWAL++LARK A+A ++T +K E + LK NYPLL
Sbjct: 485 KEMVENPDDLKKDKRKWALQVLARKKALAGNNSTQDK-EGSPELKGNYPLLA 535
|
Arabidopsis thaliana (taxid: 3702) |
| >sp|Q9P1Y6|PHRF1_HUMAN PHD and RING finger domain-containing protein 1 OS=Homo sapiens GN=PHRF1 PE=1 SV=3 | Back alignment and function description |
|---|
| >sp|A6H619|PHRF1_MOUSE PHD and RING finger domain-containing protein 1 OS=Mus musculus GN=Phrf1 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q63625|PHRF1_RAT PHD and RING finger domain-containing protein 1 OS=Rattus norvegicus GN=Phrf1 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q80Z37|TOPRS_MOUSE E3 ubiquitin-protein ligase Topors OS=Mus musculus GN=Topors PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q9NS56|TOPRS_HUMAN E3 ubiquitin-protein ligase Topors OS=Homo sapiens GN=TOPORS PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|O94400|YQF7_SCHPO PHD and RING finger domain-containing protein C126.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC126.07c PE=4 SV=1 | Back alignment and function description |
|---|
| >sp|P09309|IE61_VZVD E3 ubiquitin-protein ligase IE61 OS=Varicella-zoster virus (strain Dumas) GN=61 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q9V8P9|TOPRS_DROME E3 ubiquitin-protein ligase Topors OS=Drosophila melanogaster GN=Topors PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q99590|SCAFB_HUMAN Protein SCAF11 OS=Homo sapiens GN=SCAF11 PE=1 SV=2 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 845 | ||||||
| 225426296 | 1304 | PREDICTED: uncharacterized protein LOC10 | 0.950 | 0.615 | 0.544 | 0.0 | |
| 297742352 | 1223 | unnamed protein product [Vitis vinifera] | 0.911 | 0.629 | 0.541 | 0.0 | |
| 147805924 | 1328 | hypothetical protein VITISV_011762 [Viti | 0.932 | 0.593 | 0.504 | 0.0 | |
| 356527686 | 1316 | PREDICTED: uncharacterized protein At4g1 | 0.930 | 0.597 | 0.489 | 0.0 | |
| 356511439 | 1307 | PREDICTED: uncharacterized protein At4g1 | 0.930 | 0.601 | 0.489 | 0.0 | |
| 449452404 | 1237 | PREDICTED: uncharacterized protein LOC10 | 0.881 | 0.602 | 0.484 | 0.0 | |
| 413926778 | 1322 | hypothetical protein ZEAMMB73_785632, pa | 0.850 | 0.543 | 0.375 | 1e-119 | |
| 255537835 | 848 | conserved hypothetical protein [Ricinus | 0.463 | 0.462 | 0.557 | 1e-111 | |
| 224058206 | 774 | predicted protein [Populus trichocarpa] | 0.383 | 0.418 | 0.609 | 1e-106 | |
| 255537833 | 454 | hypothetical protein RCOM_1692360 [Ricin | 0.457 | 0.852 | 0.524 | 1e-106 |
| >gi|225426296|ref|XP_002265315.1| PREDICTED: uncharacterized protein LOC100254675 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 805 bits (2079), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 471/865 (54%), Positives = 577/865 (66%), Gaps = 62/865 (7%)
Query: 4 MLEEQTFQVDNTENDLLNFECGRCGICMDVVIDRGVLDCCQHWFCFACIDNWSTITNLCP 63
M E+ +++VD + D E +CGICMD++IDRGVLDCCQHWFCFACIDNW+TITNLCP
Sbjct: 10 MAEDDSYEVDE-DIDASGLEGEKCGICMDIIIDRGVLDCCQHWFCFACIDNWATITNLCP 68
Query: 64 LCQGEFQLITCVPVYDTIGSNNIDGDSLSRGEDWSIEEKSNTLSFPSYYIDENAVICLDG 123
LCQ EFQLITCVPVYDTIG++ +D DS R +DWSIE K+NTLSFPSYYIDENAVICLDG
Sbjct: 69 LCQTEFQLITCVPVYDTIGTSKVDEDSFPRDDDWSIEGKNNTLSFPSYYIDENAVICLDG 128
Query: 124 DGCKIRSGSMVAEESSNLDTSIACDSCDLWYHAFCVGFDPEGTCEDTWLCPRC-VAEVPQ 182
DGCKIRSGS E SNLDTSIACDSCD+WYHAFCVGFDPEGT ED+WLCPRC VA +P
Sbjct: 129 DGCKIRSGSATITEDSNLDTSIACDSCDIWYHAFCVGFDPEGTSEDSWLCPRCAVAGMPG 188
Query: 183 NSSIDLTQSTNDQSGPENANGDHLAESLFPRKVSVSVADAGETAVVVSMIG-----EEPN 237
S + SG + N + L E F RK+SVSVADAGETA+VVSM+ EE +
Sbjct: 189 KSVV---------SGLGDGNSECLLEDGFSRKLSVSVADAGETALVVSMVEGNQWMEESS 239
Query: 238 ENFQSMLEIEKGVGNEAFNPYG-GDRN---AKSESNERTDIQSMLQAQEPELSFSQDASF 293
E+F S LE + F Y D N + + S ER ++Q L+AQE ELS S+D SF
Sbjct: 240 EDFLSNLE---DCNDWKFESYLISDANCLESPTPSAERDNMQPNLEAQELELSLSRDTSF 296
Query: 294 CLPSTSLGSSEVKTDSADEKLNEQSSCGGVKSFLGKTFNEPYPGNKPSDCISNVDLHLGL 353
LPS S +++KT+SA++ +NE S G++ K + NKPS+ S++ LHLGL
Sbjct: 297 SLPSNSSVLNDLKTNSANKIVNEPSGFDGLRISSTKLLDGSCSENKPSESESSIGLHLGL 356
Query: 354 SMSK--SVADTNKYLTEDQ----------ITGYVQQQNPSEESLHEADKIEPGAKEENSQ 401
S+ SV T T+D+ + V QQ+PSEES ADKI A E+ +
Sbjct: 357 SVGSFLSVESTKDRGTDDENTKDTGTDEVVAADVHQQHPSEESPLSADKIIAHAN-EDMK 415
Query: 402 IIGGKRNH-DNCSGINKEITTKKV-----TEVPAKKIRAEKLTQTNPHKDEANAS-ILAN 454
I G KR H D G+ KV TEV AKK+RAE Q P + +AN + +
Sbjct: 416 IAGVKRKHTDYSDGVQTSAGNGKVKAEIGTEVSAKKVRAEGKIQMAPIEKQANGQHVSVD 475
Query: 455 SKKFPTLIAGRRHEKSKLCPEKVDVTSDIMSIVKGTKCKLPKGLAHKNSADRSSKDRENV 514
++K + + ++ + ++ +VTSDIMSIV+GT + KGLA K S +REN
Sbjct: 476 AQKGHSTVEVSTGDELRHNRKRKEVTSDIMSIVQGTDRRPLKGLAEK-----SDGERENA 530
Query: 515 SGLRVKKIMKRPAEDKDSSELVQELRKEIREAVRNRSSKDCDENLFDPKLLAAFRAAIAG 574
+GLRVKKIMKR +EDK+S+ LVQ+LRKEIREAVR++SS + NLFDPKLL AFRAAIAG
Sbjct: 531 TGLRVKKIMKRASEDKESAVLVQKLRKEIREAVRSKSSIELGTNLFDPKLLTAFRAAIAG 590
Query: 575 PKCE-PVKQPAHLAVKVKKSMLEKGKVRESLTKKIYGNSNGRRRRAWNRDCEVEFWKYRC 633
P E ++ + A+KVKKSML+KGK+RE+LTKKIY S G+RRRAW+RD EVEFWK+RC
Sbjct: 591 PITETTARKLSPSALKVKKSMLQKGKIRENLTKKIYATSKGKRRRAWDRDLEVEFWKHRC 650
Query: 634 MKATKTEKIGTLKSVLDLLRNNSQSSDTEQSTECQETNPILSRLYLADTSVFPRKDNIMP 693
M+ATK EKI TLKSVLDLLR S+ D EQ +E Q TNPILSRLYLADTSVFPRKD+I P
Sbjct: 651 MRATKPEKIETLKSVLDLLR-TSECIDPEQGSESQTTNPILSRLYLADTSVFPRKDDIKP 709
Query: 694 LSALKATDNSEQSKEQAISMEKPLKLSSDNCASKVAETNKVSSKVGVLSAYEKGTR-NMS 752
L+ALKA+ N EQ+KE A SMEK K + + A K ET K+ SKVG KG + N S
Sbjct: 710 LAALKASGNPEQNKEHA-SMEKVSKPALHSPAVKAPETCKIPSKVGFSPYDHKGNKSNAS 768
Query: 753 CSKSNAALSKVHPIQLGD---------PKVNSLKGTAT-SDDVKVDKRKWALEILARKTA 802
K A K HP + + KVNS K SDD+K DKRKWALE+LARK A
Sbjct: 769 SLKDATAHGKPHPGKRPEGSSIPLSVASKVNSQKEAGVKSDDIKTDKRKWALEVLARKNA 828
Query: 803 VACKSATHEKPEDTAMLKRNYPLLV 827
A K+ T EK ED A+LK NYPLL
Sbjct: 829 AASKNTTQEKQEDNALLKGNYPLLT 853
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|297742352|emb|CBI34501.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|147805924|emb|CAN74396.1| hypothetical protein VITISV_011762 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356527686|ref|XP_003532439.1| PREDICTED: uncharacterized protein At4g10930-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356511439|ref|XP_003524434.1| PREDICTED: uncharacterized protein At4g10930-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449452404|ref|XP_004143949.1| PREDICTED: uncharacterized protein LOC101208477 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|413926778|gb|AFW66710.1| hypothetical protein ZEAMMB73_785632, partial [Zea mays] | Back alignment and taxonomy information |
|---|
| >gi|255537835|ref|XP_002509984.1| conserved hypothetical protein [Ricinus communis] gi|223549883|gb|EEF51371.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|224058206|ref|XP_002299464.1| predicted protein [Populus trichocarpa] gi|222846722|gb|EEE84269.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255537833|ref|XP_002509983.1| hypothetical protein RCOM_1692360 [Ricinus communis] gi|223549882|gb|EEF51370.1| hypothetical protein RCOM_1692360 [Ricinus communis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 845 | ||||||
| TAIR|locus:2123431 | 984 | AT4G10930 [Arabidopsis thalian | 0.331 | 0.284 | 0.529 | 1.5e-72 | |
| TAIR|locus:2123446 | 192 | AT4G10940 "AT4G10940" [Arabido | 0.201 | 0.885 | 0.617 | 3.9e-60 | |
| TAIR|locus:2078092 | 883 | AT3G05670 "AT3G05670" [Arabido | 0.175 | 0.167 | 0.309 | 1.9e-09 | |
| ZFIN|ZDB-GENE-030131-624 | 1670 | phrf1 "PHD and ring finger dom | 0.138 | 0.070 | 0.262 | 1.4e-06 | |
| UNIPROTKB|E1BTQ2 | 136 | RNF8 "Uncharacterized protein" | 0.072 | 0.448 | 0.380 | 6.6e-06 | |
| DICTYBASE|DDB_G0294609 | 697 | polD3 "DNA polymerase delta su | 0.566 | 0.687 | 0.201 | 2.2e-05 | |
| UNIPROTKB|F8W6K1 | 118 | SCAF11 "Protein SCAF11" [Homo | 0.071 | 0.508 | 0.349 | 3.3e-05 | |
| DICTYBASE|DDB_G0281183 | 548 | DDB_G0281183 "RING zinc finger | 0.080 | 0.124 | 0.380 | 6.6e-05 | |
| FB|FBgn0037344 | 2296 | CG2926 [Drosophila melanogaste | 0.211 | 0.077 | 0.284 | 9.5e-05 | |
| ZFIN|ZDB-GENE-041210-22 | 1145 | scaf11 "SR-related CTD-associa | 0.069 | 0.051 | 0.393 | 0.0002 |
| TAIR|locus:2123431 AT4G10930 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 679 (244.1 bits), Expect = 1.5e-72, Sum P(2) = 1.5e-72
Identities = 155/293 (52%), Positives = 197/293 (67%)
Query: 467 HEKSKLCPEKVDVTSDIMSIVKGTKCKLPKGLAHKNSADRSSKDRENVSGLRVKKIMKRP 526
H +S+ P + T DI SIVKGT + K L N D+SS + EN +GLRVKKI + P
Sbjct: 202 HHESR-SPSN-NTTVDIFSIVKGTGRR--KNLMRSNPTDKSS-EAENAAGLRVKKIKRTP 256
Query: 527 AEDKDSSELVQELRKEIREAVRNRSSKDCDENLFDPKLLAAFRAAIAGPKC-EPVKQPAH 585
++K+S LV++LRKEIREAVRN+S +D EN FDPKLLAAFRAA+AGPK E ++ +
Sbjct: 257 EDEKESMVLVEKLRKEIREAVRNKSMEDIRENQFDPKLLAAFRAAVAGPKTGEAPRRSSA 316
Query: 586 LAVKVKKSMLEKGKVRESLTKKIYGNSNGRRRRAWNRDCEVEFWKYRCMKATKTEKIGTL 645
LAVK KK ML+KGKVRE+LTKKIY + NG+R+ AW+RDCEVEFWK+RC++ K EKI TL
Sbjct: 317 LAVKAKKLMLQKGKVRENLTKKIYADLNGKRKSAWHRDCEVEFWKHRCIQGRKPEKIETL 376
Query: 646 KSVLDLLRNNSQSSDTEQSTEC-QETNPILSRLYLADTSVFPRKDNIMPLSALKATDNSE 704
KSVL LL+N + T S+E Q +NPILSRLYLADTSVFPR DN+ PL A K NS+
Sbjct: 377 KSVLSLLKNKPADTKTNFSSETPQASNPILSRLYLADTSVFPRNDNLKPLLAPKEMGNSQ 436
Query: 705 QS-KEQAISMEKPLKLSSDNCASKVAETNKVSSKVGVLSAYEKGTRNMSCSKS 756
+ K S P K+S A+K + SK+ + G N++ S S
Sbjct: 437 NNGKPTEASKTLP-KIS----AAKGSSVKAAGSKLNSGNKQSDGQPNLTSSNS 484
|
|
| TAIR|locus:2123446 AT4G10940 "AT4G10940" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2078092 AT3G05670 "AT3G05670" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030131-624 phrf1 "PHD and ring finger domains 1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BTQ2 RNF8 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0294609 polD3 "DNA polymerase delta subunit 3" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F8W6K1 SCAF11 "Protein SCAF11" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0281183 DDB_G0281183 "RING zinc finger-containing protein" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0037344 CG2926 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-041210-22 scaf11 "SR-related CTD-associated factor 11" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
No confident hit for EC number transfering in SWISSPROT detected by BLAST
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
No EC number assignment, probably not an enzyme!
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
 |
 |
 |
 |
 |
 |
 |
 |
 |
 | GSVIVG00006733001 | SubName- Full=Chromosome chr2 scaffold_176, whole genome shotgun sequence; (864 aa) | ||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 845 | |||
| pfam13923 | 45 | pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI | 1e-08 | |
| cd00162 | 45 | cd00162, RING, RING-finger (Really Interesting New | 2e-08 | |
| pfam13639 | 46 | pfam13639, zf-RING_2, Ring finger domain | 6e-08 | |
| PHA02929 | 238 | PHA02929, PHA02929, N1R/p28-like protein; Provisio | 7e-08 | |
| smart00184 | 40 | smart00184, RING, Ring finger | 9e-08 | |
| pfam00628 | 51 | pfam00628, PHD, PHD-finger | 5e-07 | |
| smart00249 | 47 | smart00249, PHD, PHD zinc finger | 9e-06 | |
| PHA02926 | 242 | PHA02926, PHA02926, zinc finger-like protein; Prov | 2e-05 | |
| pfam00097 | 40 | pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING | 7e-05 | |
| PLN03208 | 193 | PLN03208, PLN03208, E3 ubiquitin-protein ligase RM | 2e-04 | |
| COG5194 | 88 | COG5194, APC11, Component of SCF ubiquitin ligase | 0.004 |
| >gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) | Back alignment and domain information |
|---|
Score = 51.0 bits (122), Expect = 1e-08
Identities = 16/39 (41%), Positives = 22/39 (56%)
Query: 27 CGICMDVVIDRGVLDCCQHWFCFACIDNWSTITNLCPLC 65
C IC+D++ D VL C H FC CI + + CP+C
Sbjct: 5 CPICLDLLRDPVVLTPCGHVFCRECILRYLKKKSKCPIC 43
|
Length = 45 |
| >gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain | Back alignment and domain information |
|---|
| >gnl|CDD|222944 PHA02929, PHA02929, N1R/p28-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|214546 smart00184, RING, Ring finger | Back alignment and domain information |
|---|
| >gnl|CDD|201356 pfam00628, PHD, PHD-finger | Back alignment and domain information |
|---|
| >gnl|CDD|214584 smart00249, PHD, PHD zinc finger | Back alignment and domain information |
|---|
| >gnl|CDD|165237 PHA02926, PHA02926, zinc finger-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215715 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING finger) | Back alignment and domain information |
|---|
| >gnl|CDD|178747 PLN03208, PLN03208, E3 ubiquitin-protein ligase RMA2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227521 COG5194, APC11, Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 845 | |||
| KOG0825 | 1134 | consensus PHD Zn-finger protein [General function | 99.68 | |
| PHA02926 | 242 | zinc finger-like protein; Provisional | 98.86 | |
| KOG1244 | 336 | consensus Predicted transcription factor Requiem/N | 98.84 | |
| PHA02929 | 238 | N1R/p28-like protein; Provisional | 98.82 | |
| PF13639 | 44 | zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C | 98.81 | |
| PLN03208 | 193 | E3 ubiquitin-protein ligase RMA2; Provisional | 98.74 | |
| KOG0823 | 230 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.63 | |
| PF12678 | 73 | zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 | 98.57 | |
| PF13923 | 39 | zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); | 98.57 | |
| KOG0317 | 293 | consensus Predicted E3 ubiquitin ligase, integral | 98.56 | |
| PF15227 | 42 | zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: | 98.51 | |
| cd00162 | 45 | RING RING-finger (Really Interesting New Gene) dom | 98.48 | |
| PF13920 | 50 | zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); | 98.47 | |
| KOG0320 | 187 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.4 | |
| KOG4628 | 348 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.33 | |
| PF00097 | 41 | zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I | 98.32 | |
| smart00504 | 63 | Ubox Modified RING finger domain. Modified RING fi | 98.27 | |
| PF00628 | 51 | PHD: PHD-finger; InterPro: IPR019787 Zinc finger ( | 98.26 | |
| TIGR00599 | 397 | rad18 DNA repair protein rad18. This family is bas | 98.14 | |
| KOG1512 | 381 | consensus PHD Zn-finger protein [General function | 98.14 | |
| COG5540 | 374 | RING-finger-containing ubiquitin ligase [Posttrans | 98.13 | |
| PF12861 | 85 | zf-Apc11: Anaphase-promoting complex subunit 11 RI | 98.1 | |
| PF14634 | 44 | zf-RING_5: zinc-RING finger domain | 98.07 | |
| COG5243 | 491 | HRD1 HRD ubiquitin ligase complex, ER membrane com | 98.03 | |
| smart00184 | 39 | RING Ring finger. E3 ubiquitin-protein ligase acti | 98.03 | |
| smart00249 | 47 | PHD PHD zinc finger. The plant homeodomain (PHD) f | 98.01 | |
| KOG2177 | 386 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.95 | |
| KOG0287 | 442 | consensus Postreplication repair protein RAD18 [Re | 97.93 | |
| COG5194 | 88 | APC11 Component of SCF ubiquitin ligase and anapha | 97.9 | |
| KOG0955 | 1051 | consensus PHD finger protein BR140/LIN-49 [General | 97.89 | |
| KOG0802 | 543 | consensus E3 ubiquitin ligase [Posttranslational m | 97.78 | |
| COG5432 | 391 | RAD18 RING-finger-containing E3 ubiquitin ligase [ | 97.77 | |
| KOG2164 | 513 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.76 | |
| COG5574 | 271 | PEX10 RING-finger-containing E3 ubiquitin ligase [ | 97.75 | |
| KOG4299 | 613 | consensus PHD Zn-finger protein [General function | 97.75 | |
| KOG1039 | 344 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.74 | |
| KOG1973 | 274 | consensus Chromatin remodeling protein, contains P | 97.73 | |
| KOG4443 | 694 | consensus Putative transcription factor HALR/MLL3, | 97.68 | |
| PF04564 | 73 | U-box: U-box domain; InterPro: IPR003613 Quality c | 97.68 | |
| PF13445 | 43 | zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. | 97.67 | |
| COG5141 | 669 | PHD zinc finger-containing protein [General functi | 97.65 | |
| KOG2930 | 114 | consensus SCF ubiquitin ligase, Rbx1 component [Po | 97.58 | |
| KOG0978 | 698 | consensus E3 ubiquitin ligase involved in syntaxin | 97.52 | |
| PF14835 | 65 | zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM | 97.5 | |
| TIGR00570 | 309 | cdk7 CDK-activating kinase assembly factor MAT1. A | 97.49 | |
| KOG4265 | 349 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.45 | |
| KOG4323 | 464 | consensus Polycomb-like PHD Zn-finger protein [Gen | 97.44 | |
| KOG0311 | 381 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.42 | |
| cd04718 | 148 | BAH_plant_2 BAH, or Bromo Adjacent Homology domain | 97.41 | |
| KOG0954 | 893 | consensus PHD finger protein [General function pre | 97.38 | |
| COG5034 | 271 | TNG2 Chromatin remodeling protein, contains PhD zi | 97.29 | |
| KOG0956 | 900 | consensus PHD finger protein AF10 [General functio | 97.25 | |
| KOG1493 | 84 | consensus Anaphase-promoting complex (APC), subuni | 97.12 | |
| COG5219 | 1525 | Uncharacterized conserved protein, contains RING Z | 97.1 | |
| KOG1245 | 1404 | consensus Chromatin remodeling complex WSTF-ISWI, | 97.05 | |
| KOG0828 | 636 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.95 | |
| KOG2660 | 331 | consensus Locus-specific chromosome binding protei | 96.92 | |
| KOG0383 | 696 | consensus Predicted helicase [General function pre | 96.92 | |
| KOG4172 | 62 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.85 | |
| KOG0297 | 391 | consensus TNF receptor-associated factor [Signal t | 96.58 | |
| KOG2879 | 298 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.48 | |
| KOG0804 | 493 | consensus Cytoplasmic Zn-finger protein BRAP2 (BRC | 96.4 | |
| KOG4159 | 398 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.32 | |
| PF11793 | 70 | FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. | 96.3 | |
| KOG1734 | 328 | consensus Predicted RING-containing E3 ubiquitin l | 96.09 | |
| PF11789 | 57 | zf-Nse: Zinc-finger of the MIZ type in Nse subunit | 96.06 | |
| KOG0827 | 465 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.06 | |
| KOG0824 | 324 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.03 | |
| PF13831 | 36 | PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A. | 95.8 | |
| smart00744 | 49 | RINGv The RING-variant domain is a C4HC3 zinc-fing | 95.78 | |
| PHA03096 | 284 | p28-like protein; Provisional | 95.69 | |
| KOG1813 | 313 | consensus Predicted E3 ubiquitin ligase [Posttrans | 95.32 | |
| KOG1785 | 563 | consensus Tyrosine kinase negative regulator CBL [ | 95.24 | |
| KOG4692 | 489 | consensus Predicted E3 ubiquitin ligase [Posttrans | 95.18 | |
| KOG1002 | 791 | consensus Nucleotide excision repair protein RAD16 | 95.14 | |
| KOG1645 | 463 | consensus RING-finger-containing E3 ubiquitin liga | 95.11 | |
| COG5152 | 259 | Uncharacterized conserved protein, contains RING a | 94.8 | |
| KOG0957 | 707 | consensus PHD finger protein [General function pre | 94.76 | |
| COG5222 | 427 | Uncharacterized conserved protein, contains RING Z | 94.54 | |
| PF04641 | 260 | Rtf2: Rtf2 RING-finger | 93.47 | |
| KOG0826 | 357 | consensus Predicted E3 ubiquitin ligase involved i | 93.04 | |
| KOG4275 | 350 | consensus Predicted E3 ubiquitin ligase [Posttrans | 92.83 | |
| PHA02825 | 162 | LAP/PHD finger-like protein; Provisional | 92.13 | |
| PF15446 | 175 | zf-PHD-like: PHD/FYVE-zinc-finger like domain | 91.43 | |
| KOG1941 | 518 | consensus Acetylcholine receptor-associated protei | 91.32 | |
| KOG3039 | 303 | consensus Uncharacterized conserved protein [Funct | 90.44 | |
| KOG1952 | 950 | consensus Transcription factor NF-X1, contains NFX | 90.08 | |
| PF14570 | 48 | zf-RING_4: RING/Ubox like zinc-binding domain; PDB | 90.05 | |
| COG5175 | 480 | MOT2 Transcriptional repressor [Transcription] | 89.99 | |
| KOG4445 | 368 | consensus Uncharacterized conserved protein, conta | 89.97 | |
| KOG4739 | 233 | consensus Uncharacterized protein involved in syna | 89.23 | |
| PHA02862 | 156 | 5L protein; Provisional | 89.07 | |
| KOG1473 | 1414 | consensus Nucleosome remodeling factor, subunit NU | 88.96 | |
| KOG1814 | 445 | consensus Predicted E3 ubiquitin ligase [Posttrans | 88.76 | |
| KOG0298 | 1394 | consensus DEAD box-containing helicase-like transc | 88.66 | |
| PF07800 | 162 | DUF1644: Protein of unknown function (DUF1644); In | 88.15 | |
| KOG1571 | 355 | consensus Predicted E3 ubiquitin ligase [Posttrans | 87.92 | |
| COG5236 | 493 | Uncharacterized conserved protein, contains RING Z | 87.84 | |
| KOG4185 | 296 | consensus Predicted E3 ubiquitin ligase [Posttrans | 87.32 | |
| KOG1473 | 1414 | consensus Nucleosome remodeling factor, subunit NU | 86.91 | |
| KOG2932 | 389 | consensus E3 ubiquitin ligase involved in ubiquiti | 86.71 | |
| PF08746 | 43 | zf-RING-like: RING-like domain; InterPro: IPR01485 | 86.26 | |
| KOG1428 | 3738 | consensus Inhibitor of type V adenylyl cyclases/Ne | 85.23 | |
| KOG1001 | 674 | consensus Helicase-like transcription factor HLTF/ | 85.13 | |
| KOG0957 | 707 | consensus PHD finger protein [General function pre | 84.96 | |
| KOG0956 | 900 | consensus PHD finger protein AF10 [General functio | 84.75 | |
| PF14447 | 55 | Prok-RING_4: Prokaryotic RING finger family 4 | 84.64 | |
| KOG3970 | 299 | consensus Predicted E3 ubiquitin ligase [Posttrans | 83.6 | |
| PF05883 | 134 | Baculo_RING: Baculovirus U-box/Ring-like domain; I | 83.46 | |
| KOG4299 | 613 | consensus PHD Zn-finger protein [General function | 83.37 | |
| PF10367 | 109 | Vps39_2: Vacuolar sorting protein 39 domain 2; Int | 82.46 | |
| KOG2114 | 933 | consensus Vacuolar assembly/sorting protein PEP5/V | 81.76 |
| >KOG0825 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
Probab=99.68 E-value=8.7e-18 Score=192.36 Aligned_cols=139 Identities=23% Similarity=0.517 Sum_probs=96.1
Q ss_pred cccccccccccccc--eeecCCCCcccHhHHHhhhccCCCCCCccCccceeeeccccccCCC-CcccCCccccCCccccc
Q 003132 24 CGRCGICMDVVIDR--GVLDCCQHWFCFACIDNWSTITNLCPLCQGEFQLITCVPVYDTIGS-NNIDGDSLSRGEDWSIE 100 (845)
Q Consensus 24 d~~CpICLE~f~d~--~iL~~CgHtFC~sCI~~Wlk~snsCPlCR~~f~~I~~ipV~d~iGs-~~i~~~sL~~rdd~~Iq 100 (845)
...|+||+-.+.+. ....+|+|.||..||..|.+..+.||+||..|..+..+ ...+. ..++.+++...... ++
T Consensus 123 ~~~CP~Ci~s~~DqL~~~~k~c~H~FC~~Ci~sWsR~aqTCPiDR~EF~~v~V~---eS~~~~~~vR~lP~EEs~~~-~e 198 (1134)
T KOG0825|consen 123 ENQCPNCLKSCNDQLEESEKHTAHYFCEECVGSWSRCAQTCPVDRGEFGEVKVL---ESTGIEANVRCLPSEESENI-LE 198 (1134)
T ss_pred hhhhhHHHHHHHHHhhccccccccccHHHHhhhhhhhcccCchhhhhhheeeee---ccccccceeEecchhhhhhh-hh
Confidence 35799999988654 44567999999999999999999999999999877633 33333 33333443222110 00
Q ss_pred -cccCccCCCccccccccccccCCCCCCCCCCCCccccCCCCccccccCCCCcc-ccccccCCCCCCCCCCcccCCcCCC
Q 003132 101 -EKSNTLSFPSYYIDENAVICLDGDGCKIRSGSMVAEESSNLDTSIACDSCDLW-YHAFCVGFDPEGTCEDTWLCPRCVA 178 (845)
Q Consensus 101 -dedeslefPs~YIDee~~iClD~~~C~ICgGs~~~~dddned~mLlCDsCDra-YH~~CLgPpl~~vPegdW~CP~Cr~ 178 (845)
+.+.. ...+.++..+. ..|.||+.. +.+++||+||+|+.+ ||+|||+|++.++|.+.|||+.|..
T Consensus 199 ~~~d~~---~d~~~~~~~E~----~~C~IC~~~------DpEdVLLLCDsCN~~~YH~YCLDPdl~eiP~~eWYC~NC~d 265 (1134)
T KOG0825|consen 199 KGGDEK---QDQISGLSQEE----VKCDICTVH------DPEDVLLLCDSCNKVYYHVYCLDPDLSESPVNEWYCTNCSL 265 (1134)
T ss_pred hccccc---cccccCccccc----ccceeeccC------ChHHhheeecccccceeeccccCcccccccccceecCcchh
Confidence 00000 01112222223 379999533 456899999999999 9999999999999999999999954
Q ss_pred C
Q 003132 179 E 179 (845)
Q Consensus 179 ~ 179 (845)
.
T Consensus 266 L 266 (1134)
T KOG0825|consen 266 L 266 (1134)
T ss_pred h
Confidence 4
|
|
| >PHA02926 zinc finger-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG1244 consensus Predicted transcription factor Requiem/NEURO-D4 [Transcription] | Back alignment and domain information |
|---|
| >PHA02929 N1R/p28-like protein; Provisional | Back alignment and domain information |
|---|
| >PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A | Back alignment and domain information |
|---|
| >PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional | Back alignment and domain information |
|---|
| >KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A | Back alignment and domain information |
|---|
| >KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A | Back alignment and domain information |
|---|
| >cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A | Back alignment and domain information |
|---|
| >KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >smart00504 Ubox Modified RING finger domain | Back alignment and domain information |
|---|
| >PF00628 PHD: PHD-finger; InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >TIGR00599 rad18 DNA repair protein rad18 | Back alignment and domain information |
|---|
| >KOG1512 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger | Back alignment and domain information |
|---|
| >PF14634 zf-RING_5: zinc-RING finger domain | Back alignment and domain information |
|---|
| >COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >smart00184 RING Ring finger | Back alignment and domain information |
|---|
| >smart00249 PHD PHD zinc finger | Back alignment and domain information |
|---|
| >KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0955 consensus PHD finger protein BR140/LIN-49 [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4299 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1973 consensus Chromatin remodeling protein, contains PHD Zn-finger [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG4443 consensus Putative transcription factor HALR/MLL3, involved in embryonic development [General function prediction only] | Back alignment and domain information |
|---|
| >PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis | Back alignment and domain information |
|---|
| >PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A | Back alignment and domain information |
|---|
| >COG5141 PHD zinc finger-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B | Back alignment and domain information |
|---|
| >TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 | Back alignment and domain information |
|---|
| >KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4323 consensus Polycomb-like PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd04718 BAH_plant_2 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function | Back alignment and domain information |
|---|
| >KOG0954 consensus PHD finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG5034 TNG2 Chromatin remodeling protein, contains PhD zinc finger [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG0956 consensus PHD finger protein AF10 [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1245 consensus Chromatin remodeling complex WSTF-ISWI, large subunit (contains heterochromatin localization, PHD and BROMO domains) [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] | Back alignment and domain information |
|---|
| >KOG0383 consensus Predicted helicase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A | Back alignment and domain information |
|---|
| >KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C | Back alignment and domain information |
|---|
| >KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13831 PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A | Back alignment and domain information |
|---|
| >smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins | Back alignment and domain information |
|---|
| >PHA03096 p28-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0957 consensus PHD finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >PF04641 Rtf2: Rtf2 RING-finger | Back alignment and domain information |
|---|
| >KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PHA02825 LAP/PHD finger-like protein; Provisional | Back alignment and domain information |
|---|
| >PF15446 zf-PHD-like: PHD/FYVE-zinc-finger like domain | Back alignment and domain information |
|---|
| >KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] | Back alignment and domain information |
|---|
| >KOG3039 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1952 consensus Transcription factor NF-X1, contains NFX-type Zn2+-binding and R3H domains [Transcription] | Back alignment and domain information |
|---|
| >PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B | Back alignment and domain information |
|---|
| >COG5175 MOT2 Transcriptional repressor [Transcription] | Back alignment and domain information |
|---|
| >KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] | Back alignment and domain information |
|---|
| >KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >PHA02862 5L protein; Provisional | Back alignment and domain information |
|---|
| >KOG1473 consensus Nucleosome remodeling factor, subunit NURF301/BPTF [Chromatin structure and dynamics; Transcription] | Back alignment and domain information |
|---|
| >KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function | Back alignment and domain information |
|---|
| >KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1473 consensus Nucleosome remodeling factor, subunit NURF301/BPTF [Chromatin structure and dynamics; Transcription] | Back alignment and domain information |
|---|
| >KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO) | Back alignment and domain information |
|---|
| >KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0957 consensus PHD finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0956 consensus PHD finger protein AF10 [General function prediction only] | Back alignment and domain information |
|---|
| >PF14447 Prok-RING_4: Prokaryotic RING finger family 4 | Back alignment and domain information |
|---|
| >KOG3970 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length | Back alignment and domain information |
|---|
| >KOG4299 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 | Back alignment and domain information |
|---|
| >KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 | Back alignment and structure |
|---|
Score = 64.3 bits (157), Expect = 3e-13
Identities = 16/55 (29%), Positives = 25/55 (45%)
Query: 26 RCGICMDVVIDRGVLDCCQHWFCFACIDNWSTITNLCPLCQGEFQLITCVPVYDT 80
RC IC++ + + C H FC+ CI W CPLC+ + + D+
Sbjct: 7 RCPICLEDPSNYSMALPCLHAFCYVCITRWIRQNPTCPLCKVPVESVVHTIESDS 61
|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 | Back alignment and structure |
|---|
| >2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Length = 75 | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 | Back alignment and structure |
|---|
| >2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Length = 72 | Back alignment and structure |
|---|
| >3o7a_A PHD finger protein 13 variant; PHF13, zinc finger, PHD domain, nuclear protein, structural structural genomics consortium, SGC, protein binding; HET: M3L; 1.67A {Homo sapiens} Length = 52 | Back alignment and structure |
|---|
| >3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >3kqi_A GRC5, PHD finger protein 2; metal-binding, zinc-finger, histone-binding, NUC protein; HET: M3L; 1.78A {Homo sapiens} Length = 75 | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 | Back alignment and structure |
|---|
| >2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A* Length = 52 | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Length = 64 | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 | Back alignment and structure |
|---|
| >1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 Length = 76 | Back alignment and structure |
|---|
| >4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 | Back alignment and structure |
|---|
| >1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 Length = 79 | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 | Back alignment and structure |
|---|
| >2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Length = 91 | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 117 | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Length = 92 | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118 | Back alignment and structure |
|---|
| >3pur_A Lysine-specific demethylase 7 homolog; oxidoreductase-oxidoreductase inhibitor complex; HET: 2HG; 2.10A {Caenorhabditis elegans} PDB: 3n9l_A 3n9m_A* 3n9o_A* 3n9p_A* 3n9q_A* 3n9n_A* 3puq_A* Length = 528 | Back alignment and structure |
|---|
| >2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} Length = 71 | Back alignment and structure |
|---|
| >2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 56 | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Length = 170 | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Length = 55 | Back alignment and structure |
|---|
| >2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 | Back alignment and structure |
|---|
| >2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A* Length = 65 | Back alignment and structure |
|---|
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Length = 165 | Back alignment and structure |
|---|
| >1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Length = 61 | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Length = 141 | Back alignment and structure |
|---|
| >2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 78 | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Length = 61 | Back alignment and structure |
|---|
| >2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >3kv4_A PHD finger protein 8; epigenetics, histone CODE, covalent histone modifications, jumonji demethylase, mental retardation, metal-binding, zinc; HET: M3L MLY OGA; 2.19A {Homo sapiens} Length = 447 | Back alignment and structure |
|---|
| >1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >2vnf_A ING 4, P29ING4, inhibitor of growth protein 4; acetylation, alternative splicing, anti-oncogene, cell cycle, coiled C nucleus, zinc, zinc-finger, ING4; HET: M3L; 1.76A {Homo sapiens} SCOP: g.50.1.2 PDB: 2k1j_A 2jmq_A 2qic_A* Length = 60 | Back alignment and structure |
|---|
| >1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A Length = 71 | Back alignment and structure |
|---|
| >3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* Length = 488 | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 112 | Back alignment and structure |
|---|
| >3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A* Length = 59 | Back alignment and structure |
|---|
| >1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Length = 51 | Back alignment and structure |
|---|
| >2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 56 | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 | Back alignment and structure |
|---|
| >3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B Length = 70 | Back alignment and structure |
|---|
| >2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Length = 114 | Back alignment and structure |
|---|
| >2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 77 | Back alignment and structure |
|---|
| >1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 Length = 91 | Back alignment and structure |
|---|
| >3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} Length = 77 | Back alignment and structure |
|---|
| >2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} Length = 105 | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Length = 116 | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Length = 85 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 845 | |||
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 99.2 | |
| 2ysm_A | 111 | Myeloid/lymphoid or mixed-lineage leukemia protein | 99.17 | |
| 3v43_A | 112 | Histone acetyltransferase KAT6A; MOZ, PHD finger, | 99.13 | |
| 2kwj_A | 114 | Zinc finger protein DPF3; acetyl-lysine, transcrip | 99.12 | |
| 2djb_A | 72 | Polycomb group ring finger protein 6; PCGF6, ring | 99.06 | |
| 3ng2_A | 71 | RNF4, snurf, ring finger protein 4; ring domain, E | 99.02 | |
| 1f62_A | 51 | Transcription factor WSTF; Zn-finger; NMR {Homo sa | 99.01 | |
| 2e6r_A | 92 | Jumonji/ARID domain-containing protein 1D; PHD dom | 99.0 | |
| 1chc_A | 68 | Equine herpes virus-1 ring domain; viral protein; | 98.99 | |
| 2ea6_A | 69 | Ring finger protein 4; RNF4, RES4-26, ring domain, | 98.98 | |
| 2d8t_A | 71 | Dactylidin, ring finger protein 146; RNF146, ring | 98.98 | |
| 1iym_A | 55 | EL5; ring-H2 finger, ubiquitin ligase, DNA binding | 98.98 | |
| 2ect_A | 78 | Ring finger protein 126; metal binding protein, st | 98.98 | |
| 3asl_A | 70 | E3 ubiquitin-protein ligase UHRF1; histone reader | 98.98 | |
| 2ecl_A | 81 | Ring-box protein 2; RNF7, ring domian, zinc-bindin | 98.97 | |
| 2e6s_A | 77 | E3 ubiquitin-protein ligase UHRF2; PHD domain, str | 98.97 | |
| 2kiz_A | 69 | E3 ubiquitin-protein ligase arkadia; ring-H2 finge | 98.96 | |
| 3shb_A | 77 | E3 ubiquitin-protein ligase UHRF1; unmodified hist | 98.96 | |
| 2yur_A | 74 | Retinoblastoma-binding protein 6; P53-associated c | 98.94 | |
| 1fp0_A | 88 | KAP-1 corepressor; PHD domain, C3HC4 type zinc bin | 98.94 | |
| 2csy_A | 81 | Zinc finger protein 183-like 1; ring finger protei | 98.94 | |
| 2xeu_A | 64 | Ring finger protein 4; transcription, zinc-finger, | 98.93 | |
| 2ep4_A | 74 | Ring finger protein 24; zinc binding, ubiquitin, E | 98.92 | |
| 1mm2_A | 61 | MI2-beta; PHD, zinc finger, protein scaffold, DNA | 98.91 | |
| 2ecm_A | 55 | Ring finger and CHY zinc finger domain- containing | 98.91 | |
| 4ayc_A | 138 | E3 ubiquitin-protein ligase RNF8; DNA damage, K63 | 98.9 | |
| 3lrq_A | 100 | E3 ubiquitin-protein ligase TRIM37; structural gen | 98.88 | |
| 2ysl_A | 73 | Tripartite motif-containing protein 31; ring-type | 98.88 | |
| 1x4j_A | 75 | Ring finger protein 38; structural genomics, NPPSF | 98.88 | |
| 3ztg_A | 92 | E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR | 98.87 | |
| 3dpl_R | 106 | Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST | 98.87 | |
| 2y43_A | 99 | E3 ubiquitin-protein ligase RAD18; DNA repair, met | 98.86 | |
| 2lri_C | 66 | Autoimmune regulator; Zn binding protein domain, a | 98.86 | |
| 1v87_A | 114 | Deltex protein 2; ring-H2 domain, zinc-binding dom | 98.86 | |
| 2ckl_A | 108 | Polycomb group ring finger protein 4; BMI1, RING1B | 98.86 | |
| 2l5u_A | 61 | Chromodomain-helicase-DNA-binding protein 4; CHD4, | 98.85 | |
| 2ecn_A | 70 | Ring finger protein 141; RNF141, ring domain, zinc | 98.85 | |
| 2l0b_A | 91 | E3 ubiquitin-protein ligase praja-1; zinc finger, | 98.84 | |
| 2ecy_A | 66 | TNF receptor-associated factor 3; metal binding pr | 98.84 | |
| 1xwh_A | 66 | Autoimmune regulator; PHD domain, Zn binding domai | 98.84 | |
| 1wev_A | 88 | Riken cDNA 1110020M19; structural genomics, PHD do | 98.83 | |
| 2puy_A | 60 | PHD finger protein 21A; PHD finger, histone CODE, | 98.83 | |
| 2yql_A | 56 | PHD finger protein 21A; PHD domain, structural gen | 98.83 | |
| 2ct2_A | 88 | Tripartite motif protein 32; zinc-finger protein H | 98.82 | |
| 2egp_A | 79 | Tripartite motif-containing protein 34; ZF-C3HC4 d | 98.81 | |
| 1t1h_A | 78 | Gspef-atpub14, armadillo repeat containing protein | 98.81 | |
| 2ecw_A | 85 | Tripartite motif-containing protein 30; metal bind | 98.81 | |
| 3ask_A | 226 | E3 ubiquitin-protein ligase UHRF1; histone reader | 98.8 | |
| 2yt5_A | 66 | Metal-response element-binding transcription facto | 98.8 | |
| 2ysj_A | 63 | Tripartite motif-containing protein 31; ring-type | 98.8 | |
| 2ecv_A | 85 | Tripartite motif-containing protein 5; metal bindi | 98.77 | |
| 2ku3_A | 71 | Bromodomain-containing protein 1; PHD finger, chro | 98.76 | |
| 1g25_A | 65 | CDK-activating kinase assembly factor MAT1; ring f | 98.76 | |
| 3fl2_A | 124 | E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA | 98.75 | |
| 2ecj_A | 58 | Tripartite motif-containing protein 39; TRIM39, ri | 98.75 | |
| 3l11_A | 115 | E3 ubiquitin-protein ligase RNF168; E3 ligase, rin | 98.74 | |
| 2ckl_B | 165 | Ubiquitin ligase protein RING2; BMI1, RING1B, poly | 98.74 | |
| 2k16_A | 75 | Transcription initiation factor TFIID subunit 3; p | 98.74 | |
| 2l43_A | 88 | N-teminal domain from histone H3.3, linker, PHD1 f | 98.71 | |
| 2kr4_A | 85 | Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri | 98.7 | |
| 4a0k_B | 117 | E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi | 98.69 | |
| 3u5n_A | 207 | E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b | 98.69 | |
| 3o36_A | 184 | Transcription intermediary factor 1-alpha; TRIM24, | 98.67 | |
| 2kre_A | 100 | Ubiquitin conjugation factor E4 B; U-box domain, E | 98.65 | |
| 1jm7_A | 112 | BRCA1, breast cancer type 1 susceptibility protein | 98.63 | |
| 1jm7_B | 117 | BARD1, BRCA1-associated ring domain protein 1; rin | 98.63 | |
| 1z6u_A | 150 | NP95-like ring finger protein isoform B; structura | 98.62 | |
| 2lv9_A | 98 | Histone-lysine N-methyltransferase MLL5; zinc fing | 98.59 | |
| 2ro1_A | 189 | Transcription intermediary factor 1-beta; KAP, TIF | 98.59 | |
| 1wgm_A | 98 | Ubiquitin conjugation factor E4A; ubiquitinating e | 98.59 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 98.58 | |
| 3hct_A | 118 | TNF receptor-associated factor 6; cross-brace, bet | 98.58 | |
| 1rmd_A | 116 | RAG1; V(D)J recombination, antibody, MAD, ring fin | 98.53 | |
| 2yu4_A | 94 | E3 SUMO-protein ligase NSE2; SP-ring domain, struc | 98.52 | |
| 1e4u_A | 78 | Transcriptional repressor NOT4; gene regulation, t | 98.5 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 98.5 | |
| 1bor_A | 56 | Transcription factor PML; proto-oncogene, nuclear | 98.49 | |
| 2ct0_A | 74 | Non-SMC element 1 homolog; ring domain, structural | 98.48 | |
| 4ic3_A | 74 | E3 ubiquitin-protein ligase XIAP; ring domain, zin | 98.45 | |
| 2d8s_A | 80 | Cellular modulator of immune recognition; C-MIR, m | 98.43 | |
| 2y1n_A | 389 | E3 ubiquitin-protein ligase; ligase-transferase co | 98.4 | |
| 3knv_A | 141 | TNF receptor-associated factor 2; cross-brace, alt | 98.39 | |
| 2vje_A | 64 | E3 ubiquitin-protein ligase MDM2; proto-oncogene, | 98.39 | |
| 1wen_A | 71 | Inhibitor of growth family, member 4; ING1-like pr | 98.34 | |
| 2vje_B | 63 | MDM4 protein; proto-oncogene, phosphorylation, alt | 98.32 | |
| 1weu_A | 91 | Inhibitor of growth family, member 4; structural g | 98.27 | |
| 2f42_A | 179 | STIP1 homology and U-box containing protein 1; cha | 98.25 | |
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 98.24 | |
| 3htk_C | 267 | E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- | 98.23 | |
| 2ecg_A | 75 | Baculoviral IAP repeat-containing protein 4; BIRC4 | 98.2 | |
| 2ea5_A | 68 | Cell growth regulator with ring finger domain prot | 98.16 | |
| 2jmi_A | 90 | Protein YNG1, ING1 homolog 1; PHD, histone, recogn | 98.15 | |
| 2vnf_A | 60 | ING 4, P29ING4, inhibitor of growth protein 4; ace | 98.15 | |
| 4gne_A | 107 | Histone-lysine N-methyltransferase NSD3; zinc fing | 98.13 | |
| 1we9_A | 64 | PHD finger family protein; structural genomics, PH | 98.12 | |
| 3c6w_A | 59 | P28ING5, inhibitor of growth protein 5; chromatin, | 98.1 | |
| 2yho_A | 79 | E3 ubiquitin-protein ligase mylip; ligase, E2 liga | 98.09 | |
| 2g6q_A | 62 | Inhibitor of growth protein 2; protein-peptide com | 98.07 | |
| 3o70_A | 68 | PHD finger protein 13; PHF13, structural genomics | 98.05 | |
| 2ysm_A | 111 | Myeloid/lymphoid or mixed-lineage leukemia protein | 98.04 | |
| 2bay_A | 61 | PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l | 97.97 | |
| 1wim_A | 94 | KIAA0161 protein; ring finger domain, UBCM4-intera | 97.96 | |
| 3t6p_A | 345 | Baculoviral IAP repeat-containing protein 2; ring, | 97.94 | |
| 1wee_A | 72 | PHD finger family protein; structural genomics, PH | 97.9 | |
| 3k1l_B | 381 | Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A | 97.81 | |
| 2kgg_A | 52 | Histone demethylase jarid1A; PHD finger, histone m | 97.79 | |
| 1wep_A | 79 | PHF8; structural genomics, PHD domain, riken struc | 97.77 | |
| 1x4i_A | 70 | Inhibitor of growth protein 3; structural genomics | 97.75 | |
| 1wem_A | 76 | Death associated transcription factor 1; structura | 97.7 | |
| 2rsd_A | 68 | E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant | 97.7 | |
| 2xb1_A | 105 | Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; | 97.7 | |
| 3o7a_A | 52 | PHD finger protein 13 variant; PHF13, zinc finger, | 97.69 | |
| 2vpb_A | 65 | Hpygo1, pygopus homolog 1; gene regulation, WNT si | 97.67 | |
| 1wew_A | 78 | DNA-binding family protein; structural genomics, P | 97.61 | |
| 1vyx_A | 60 | ORF K3, K3RING; zinc-binding protein, ring domain, | 97.59 | |
| 2lbm_A | 142 | Transcriptional regulator ATRX; metal binding prot | 97.57 | |
| 2ri7_A | 174 | Nucleosome-remodeling factor subunit BPTF; zinc fi | 97.54 | |
| 3vk6_A | 101 | E3 ubiquitin-protein ligase hakai; HYB, phosphotyr | 97.51 | |
| 3kqi_A | 75 | GRC5, PHD finger protein 2; metal-binding, zinc-fi | 97.5 | |
| 3v43_A | 112 | Histone acetyltransferase KAT6A; MOZ, PHD finger, | 97.42 | |
| 2kwj_A | 114 | Zinc finger protein DPF3; acetyl-lysine, transcrip | 97.39 | |
| 3pur_A | 528 | Lysine-specific demethylase 7 homolog; oxidoreduct | 97.31 | |
| 3lqh_A | 183 | Histone-lysine N-methyltransferase MLL; PHD finger | 97.22 | |
| 3nw0_A | 238 | Non-structural maintenance of chromosomes element | 96.95 | |
| 3ql9_A | 129 | Transcriptional regulator ATRX; zinc finger, trans | 96.86 | |
| 3kv5_D | 488 | JMJC domain-containing histone demethylation prote | 96.63 | |
| 3kv4_A | 447 | PHD finger protein 8; epigenetics, histone CODE, c | 96.35 | |
| 4bbq_A | 117 | Lysine-specific demethylase 2A; oxidoreductase, ub | 96.19 | |
| 4gne_A | 107 | Histone-lysine N-methyltransferase NSD3; zinc fing | 95.79 | |
| 2ku7_A | 140 | MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio | 95.47 | |
| 1wil_A | 89 | KIAA1045 protein; ring finger domain, structural g | 95.35 | |
| 2jun_A | 101 | Midline-1; B-BOX, TRIM, ring finger, alternative s | 92.47 | |
| 2lri_C | 66 | Autoimmune regulator; Zn binding protein domain, a | 91.5 | |
| 1weq_A | 85 | PHD finger protein 7; structural genomics, PHD dom | 91.14 | |
| 2ko5_A | 99 | Ring finger protein Z; lassa fever virus-Z, negati | 87.63 | |
| 1iym_A | 55 | EL5; ring-H2 finger, ubiquitin ligase, DNA binding | 84.77 | |
| 3u5n_A | 207 | E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b | 83.85 | |
| 3o36_A | 184 | Transcription intermediary factor 1-alpha; TRIM24, | 83.25 | |
| 3rsn_A | 177 | SET1/ASH2 histone methyltransferase complex subun; | 82.98 | |
| 2l5u_A | 61 | Chromodomain-helicase-DNA-binding protein 4; CHD4, | 82.84 | |
| 2k16_A | 75 | Transcription initiation factor TFIID subunit 3; p | 80.2 |
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
Probab=99.20 E-value=1.5e-12 Score=118.17 Aligned_cols=115 Identities=23% Similarity=0.438 Sum_probs=77.3
Q ss_pred Ccccccccccccccccc------eeecCCCCcccHhHHHhhhccCCCCCCccCccceeeeccccccCCCCcccCCccccC
Q 003132 21 NFECGRCGICMDVVIDR------GVLDCCQHWFCFACIDNWSTITNLCPLCQGEFQLITCVPVYDTIGSNNIDGDSLSRG 94 (845)
Q Consensus 21 ssEd~~CpICLE~f~d~------~iL~~CgHtFC~sCI~~Wlk~snsCPlCR~~f~~I~~ipV~d~iGs~~i~~~sL~~r 94 (845)
..+...|+||++.+.++ .+..+|+|+||..||..|+.....||+||..+......++
T Consensus 4 ~~~~~~C~IC~~~~~~~~~~~~~~~~~~CgH~fc~~Ci~~~~~~~~~CP~Cr~~~~~~~l~~l----------------- 66 (133)
T 4ap4_A 4 GSGTVSCPICMDGYSEIVQNGRLIVSTECGHVFCSQCLRDSLKNANTCPTCRKKINHKRYHPI----------------- 66 (133)
T ss_dssp -CCSCBCTTTCCBHHHHHHTTCCEEEETTCCEEEHHHHHHHHTTCSBCTTTCCBCTTTCEEEC-----------------
T ss_pred CCCCCCCcccChhhhCccccccCeEecCCCChhhHHHHHHHHHhCCCCCCCCCcCcccccccc-----------------
Confidence 34568999999999765 2666799999999999999998999999988753221110
Q ss_pred CccccccccCccCCCccccccccccccCCCCCCCCCCCCccccCCCCccccccCCCCccccccccCCCCCCCCCCcccCC
Q 003132 95 EDWSIEEKSNTLSFPSYYIDENAVICLDGDGCKIRSGSMVAEESSNLDTSIACDSCDLWYHAFCVGFDPEGTCEDTWLCP 174 (845)
Q Consensus 95 dd~~IqdedeslefPs~YIDee~~iClD~~~C~ICgGs~~~~dddned~mLlCDsCDraYH~~CLgPpl~~vPegdW~CP 174 (845)
|++. +...|.+|........ ........-.|+..||..|+...+.. ...||
T Consensus 67 -----------------~i~~------~~~~C~iC~~~~~~~~--~~~~~~~~~~CgH~fc~~Ci~~~~~~----~~~CP 117 (133)
T 4ap4_A 67 -----------------YIGS------GTVSCPICMDGYSEIV--QNGRLIVSTECGHVFCSQCLRDSLKN----ANTCP 117 (133)
T ss_dssp -----------------BCSS------SSCBCTTTCCBHHHHH--HTTCCEEEETTSBEEEHHHHHHHHHH----CSBCT
T ss_pred -----------------ccCC------CCCCCCCCCCcccccc--ccCcceEeCCCCChhhHHHHHHHHHc----CCCCC
Confidence 0010 1234889954321100 00112345689999999999877532 35899
Q ss_pred cCCCCCC
Q 003132 175 RCVAEVP 181 (845)
Q Consensus 175 ~Cr~~~~ 181 (845)
.|+..+.
T Consensus 118 ~Cr~~~~ 124 (133)
T 4ap4_A 118 TCRKKIN 124 (133)
T ss_dssp TTCCBCC
T ss_pred CCCCcCC
Confidence 9998843
|
| >2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A | Back alignment and structure |
|---|
| >2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B | Back alignment and structure |
|---|
| >2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A | Back alignment and structure |
|---|
| >4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A | Back alignment and structure |
|---|
| >2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A | Back alignment and structure |
|---|
| >1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} | Back alignment and structure |
|---|
| >2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} | Back alignment and structure |
|---|
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B | Back alignment and structure |
|---|
| >2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* | Back alignment and structure |
|---|
| >2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} | Back alignment and structure |
|---|
| >4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} | Back alignment and structure |
|---|
| >3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* | Back alignment and structure |
|---|
| >3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A | Back alignment and structure |
|---|
| >2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2lv9_A Histone-lysine N-methyltransferase MLL5; zinc finger, transcription, protein binding, NESG, northeast structural genomics consortium, SGC; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 | Back alignment and structure |
|---|
| >2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A | Back alignment and structure |
|---|
| >2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A | Back alignment and structure |
|---|
| >1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A | Back alignment and structure |
|---|
| >2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* | Back alignment and structure |
|---|
| >1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jmi_A Protein YNG1, ING1 homolog 1; PHD, histone, recognition, yeast, protein binding; NMR {Saccharomyces cerevisiae} PDB: 2jmj_A* | Back alignment and structure |
|---|
| >2vnf_A ING 4, P29ING4, inhibitor of growth protein 4; acetylation, alternative splicing, anti-oncogene, cell cycle, coiled C nucleus, zinc, zinc-finger, ING4; HET: M3L; 1.76A {Homo sapiens} SCOP: g.50.1.2 PDB: 2k1j_A 2jmq_A 2qic_A* | Back alignment and structure |
|---|
| >4gne_A Histone-lysine N-methyltransferase NSD3; zinc finger, transcription, nuclear protein, transf nuclear protein complex; 1.47A {Homo sapiens} PDB: 4gnd_A 4gnf_A 4gng_A* | Back alignment and structure |
|---|
| >1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A* | Back alignment and structure |
|---|
| >2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A | Back alignment and structure |
|---|
| >2g6q_A Inhibitor of growth protein 2; protein-peptide complex, gene regulation, apoptosis; HET: M3L; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A | Back alignment and structure |
|---|
| >1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B | Back alignment and structure |
|---|
| >1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A* | Back alignment and structure |
|---|
| >1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2rsd_A E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant homeodomain (PHD), histone binding; NMR {Oryza sativa japonica group} | Back alignment and structure |
|---|
| >2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3o7a_A PHD finger protein 13 variant; PHF13, zinc finger, PHD domain, nuclear protein, structural structural genomics consortium, SGC, protein binding; HET: M3L; 1.67A {Homo sapiens} | Back alignment and structure |
|---|
| >2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A* | Back alignment and structure |
|---|
| >1wew_A DNA-binding family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 | Back alignment and structure |
|---|
| >2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A | Back alignment and structure |
|---|
| >2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* | Back alignment and structure |
|---|
| >3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >3kqi_A GRC5, PHD finger protein 2; metal-binding, zinc-finger, histone-binding, NUC protein; HET: M3L; 1.78A {Homo sapiens} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A | Back alignment and structure |
|---|
| >2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* | Back alignment and structure |
|---|
| >3pur_A Lysine-specific demethylase 7 homolog; oxidoreductase-oxidoreductase inhibitor complex; HET: 2HG; 2.10A {Caenorhabditis elegans} PDB: 3n9l_A 3n9m_A* 3n9o_A* 3n9p_A* 3n9q_A* 3n9n_A* 3puq_A* | Back alignment and structure |
|---|
| >3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A | Back alignment and structure |
|---|
| >3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} | Back alignment and structure |
|---|
| >3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A | Back alignment and structure |
|---|
| >3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* | Back alignment and structure |
|---|
| >3kv4_A PHD finger protein 8; epigenetics, histone CODE, covalent histone modifications, jumonji demethylase, mental retardation, metal-binding, zinc; HET: M3L MLY OGA; 2.19A {Homo sapiens} | Back alignment and structure |
|---|
| >4bbq_A Lysine-specific demethylase 2A; oxidoreductase, ubiquitin, ligase, ubiquitination, demethyla ZF-CXXC DNA binding domain, CPG island, chromatin; 2.24A {Homo sapiens} | Back alignment and structure |
|---|
| >4gne_A Histone-lysine N-methyltransferase NSD3; zinc finger, transcription, nuclear protein, transf nuclear protein complex; 1.47A {Homo sapiens} PDB: 4gnd_A 4gnf_A 4gng_A* | Back alignment and structure |
|---|
| >2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 | Back alignment and structure |
|---|
| >2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1weq_A PHD finger protein 7; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* | Back alignment and structure |
|---|
| >3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A | Back alignment and structure |
|---|
| >3rsn_A SET1/ASH2 histone methyltransferase complex subun; PHD domain, winged helix domain, binding, transcription; 2.10A {Homo sapiens} PDB: 3s32_A | Back alignment and structure |
|---|
| >2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 845 | ||||
| d1chca_ | 68 | g.44.1.1 (A:) Immediate early protein, IEEHV {Equi | 2e-10 | |
| d1iyma_ | 55 | g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati | 3e-08 | |
| d1weea_ | 72 | g.50.1.2 (A:) PHD finger protein At1g33420 {Thale | 4e-08 | |
| d1mm2a_ | 61 | g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens | 6e-08 | |
| d1bora_ | 56 | g.44.1.1 (A:) Acute promyelocytic leukaemia proto- | 1e-07 | |
| d1fbva4 | 79 | g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta | 4e-07 | |
| d3dplr1 | 88 | g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of S | 8e-07 | |
| d1wepa_ | 79 | g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus mus | 3e-06 | |
| d1we9a_ | 64 | g.50.1.2 (A:) PHD finger protein At5g26210 {Thale | 3e-06 | |
| d1f62a_ | 51 | g.50.1.2 (A:) Williams-Beuren syndrome transcripti | 5e-06 | |
| d1vyxa_ | 60 | g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal do | 6e-06 | |
| d1wema_ | 76 | g.50.1.2 (A:) Death associated transcription facto | 6e-06 | |
| d2baya1 | 56 | g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 { | 7e-06 | |
| d1rmda2 | 86 | g.44.1.1 (A:1-86) V(D)J recombination activating p | 1e-05 | |
| d1fp0a1 | 70 | g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF- | 5e-05 | |
| d1jm7a_ | 103 | g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie | 7e-05 | |
| d1g25a_ | 65 | g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi | 1e-04 | |
| d1jm7b_ | 97 | g.44.1.1 (B:) bard1 RING domain {Human (Homo sapie | 2e-04 | |
| d1wewa_ | 78 | g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale c | 5e-04 | |
| d2pnxa1 | 51 | g.50.1.2 (A:195-245) Inhibitor of growth protein 4 | 5e-04 | |
| d1ur6b_ | 52 | g.44.1.1 (B:) Not-4 N-terminal RING finger domain | 7e-04 | |
| d1weva_ | 88 | g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus mu | 0.001 | |
| d2c2la2 | 80 | g.44.1.2 (A:225-304) STIP1 homology and U box-cont | 0.002 |
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 | Back information, alignment and structure |
|---|
class: Small proteins fold: RING/U-box superfamily: RING/U-box family: RING finger domain, C3HC4 domain: Immediate early protein, IEEHV species: Equine herpesvirus 1 [TaxId: 10326]
Score = 55.3 bits (133), Expect = 2e-10
Identities = 16/61 (26%), Positives = 27/61 (44%)
Query: 26 RCGICMDVVIDRGVLDCCQHWFCFACIDNWSTITNLCPLCQGEFQLITCVPVYDTIGSNN 85
RC IC++ + + C H FC+ CI W CPLC+ + + D+ +
Sbjct: 7 RCPICLEDPSNYSMALPCLHAFCYVCITRWIRQNPTCPLCKVPVESVVHTIESDSEFGDQ 66
Query: 86 I 86
+
Sbjct: 67 L 67
|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 | Back information, alignment and structure |
|---|
| >d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 72 | Back information, alignment and structure |
|---|
| >d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Length = 61 | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 | Back information, alignment and structure |
|---|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Length = 88 | Back information, alignment and structure |
|---|
| >d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Length = 79 | Back information, alignment and structure |
|---|
| >d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 64 | Back information, alignment and structure |
|---|
| >d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Length = 51 | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Length = 60 | Back information, alignment and structure |
|---|
| >d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 76 | Back information, alignment and structure |
|---|
| >d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56 | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 | Back information, alignment and structure |
|---|
| >d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Length = 70 | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 97 | Back information, alignment and structure |
|---|
| >d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 78 | Back information, alignment and structure |
|---|
| >d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} Length = 51 | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 | Back information, alignment and structure |
|---|
| >d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Length = 88 | Back information, alignment and structure |
|---|
| >d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 80 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 845 | |||
| d1chca_ | 68 | Immediate early protein, IEEHV {Equine herpesvirus | 99.15 | |
| d1iyma_ | 55 | EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 | 99.06 | |
| d1fbva4 | 79 | CBL {Human (Homo sapiens) [TaxId: 9606]} | 98.94 | |
| d2baya1 | 56 | Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac | 98.92 | |
| d1f62a_ | 51 | Williams-Beuren syndrome transcription factor, WST | 98.89 | |
| d3dplr1 | 88 | RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase | 98.85 | |
| d1g25a_ | 65 | TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 | 98.83 | |
| d1ur6b_ | 52 | Not-4 N-terminal RING finger domain {Human (Homo s | 98.81 | |
| d1rmda2 | 86 | V(D)J recombination activating protein 1 (RAG1), d | 98.76 | |
| d1jm7b_ | 97 | bard1 RING domain {Human (Homo sapiens) [TaxId: 96 | 98.76 | |
| d1jm7a_ | 103 | brca1 RING domain {Human (Homo sapiens) [TaxId: 96 | 98.75 | |
| d1v87a_ | 114 | Deltex protein 2 RING-H2 domain {Mouse (Mus muscul | 98.74 | |
| d1fp0a1 | 70 | Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo | 98.74 | |
| d1mm2a_ | 61 | Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 | 98.67 | |
| d1bora_ | 56 | Acute promyelocytic leukaemia proto-oncoprotein PM | 98.62 | |
| d2c2la2 | 80 | STIP1 homology and U box-containing protein 1, STU | 98.61 | |
| d1t1ha_ | 78 | E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi | 98.61 | |
| d1wgma_ | 98 | Ubiquitin conjugation factor E4A {Human (Homo sapi | 98.55 | |
| d1weva_ | 88 | PHD finger protein 22 {Mouse (Mus musculus) [TaxId | 98.47 | |
| d1vyxa_ | 60 | IE1B protein (ORF K3), N-terminal domain {Kaposi's | 98.41 | |
| d1weea_ | 72 | PHD finger protein At1g33420 {Thale cress (Arabido | 98.28 | |
| d1we9a_ | 64 | PHD finger protein At5g26210 {Thale cress (Arabido | 98.2 | |
| d2pnxa1 | 51 | Inhibitor of growth protein 4, Ing4 {Homo sapiens | 98.03 | |
| d1wepa_ | 79 | PHD finger protein 8 {Mouse (Mus musculus) [TaxId: | 98.02 | |
| d1wesa_ | 71 | PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu | 98.01 | |
| d1wema_ | 76 | Death associated transcription factor 1, Datf1 (DI | 97.69 | |
| d1wima_ | 94 | UbcM4-interacting protein 4 (KIAA0161) {Human (Hom | 97.68 | |
| d1wewa_ | 78 | Sumoylation ligase E3, SIZ1 {Thale cress (Arabidop | 97.36 | |
| d1iyma_ | 55 | EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 | 90.27 | |
| d1weqa_ | 85 | PHD finger protein 7 (NYD-SP6) {Mouse (Mus musculu | 87.86 | |
| d1mm2a_ | 61 | Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 | 84.77 | |
| d1fp0a1 | 70 | Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo | 84.49 | |
| d1vyxa_ | 60 | IE1B protein (ORF K3), N-terminal domain {Kaposi's | 82.2 | |
| d1weva_ | 88 | PHD finger protein 22 {Mouse (Mus musculus) [TaxId | 81.33 |
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} | Back information, alignment and structure |
|---|
class: Small proteins fold: RING/U-box superfamily: RING/U-box family: RING finger domain, C3HC4 domain: Immediate early protein, IEEHV species: Equine herpesvirus 1 [TaxId: 10326]
Probab=99.15 E-value=1.1e-11 Score=102.65 Aligned_cols=52 Identities=29% Similarity=0.731 Sum_probs=45.6
Q ss_pred CcccccccccccccccceeecCCCCcccHhHHHhhhccCCCCCCccCcccee
Q 003132 21 NFECGRCGICMDVVIDRGVLDCCQHWFCFACIDNWSTITNLCPLCQGEFQLI 72 (845)
Q Consensus 21 ssEd~~CpICLE~f~d~~iL~~CgHtFC~sCI~~Wlk~snsCPlCR~~f~~I 72 (845)
....+.|+||++.+.+..++.+|+|.||..||..|+..+.+||+||..+..+
T Consensus 2 ~~~~d~C~IC~~~~~~~~~~~~C~H~Fc~~Ci~~w~~~~~~CP~CR~~i~~~ 53 (68)
T d1chca_ 2 ATVAERCPICLEDPSNYSMALPCLHAFCYVCITRWIRQNPTCPLCKVPVESV 53 (68)
T ss_dssp CCCCCCCSSCCSCCCSCEEETTTTEEESTTHHHHHHHHSCSTTTTCCCCCCE
T ss_pred CCCCCCCccCCcCccCCcEEeCCCCcCcHHHHHHHHHhCCcCCCCCcchHhh
Confidence 3456789999999988778888999999999999999999999999887643
|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} | Back information, alignment and structure |
|---|
| >d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d1weqa_ g.50.1.2 (A:) PHD finger protein 7 (NYD-SP6) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} | Back information, alignment and structure |
|---|
| >d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|