Citrus Sinensis ID: 003200


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840
MSGILVFACLLLELLVISISFFRGSSYHVGCLETERRALLRFKQDLQDPSNRLASWTGDGDCCTWAGVACGNVTGHILELNLRNPSTSNPRSMLVGKVNPALLDLKHLSYLDLSSNDFQGVQIPRFIGSMRNLRYLNLSDTQFVGMIPPQLGNLSDLQFLDLSSNYLYVDNVWWLSGLSFLEHLDLRSVNLSKASDWLMATNTLPSLLELRLSNCSLHHFPTLASPIPRGLQNLTSLKHLDLDSNHFNSSIPDWLYKFSPLECLNLRNNSLQGTISDAIGNLTSVSWLDLSINIGLQGRIPRSMANFCNLKSVNLRGVHLSQEISEILDIFSGCVSNGLESLDMRSSSIYGHLTDQLGQFRNLVTLNLANNSIVGLIPESFGQLSTLRELQIYDNKLNGTLSEFHFANLTKLSWFRVGGNQLTFEVKHDWIPPFQLVALGLHNCYVGSRFPQWLHSQKHLQYLNLLNSRISDIFPIRFLKSASQLKFLDVGLNQFHGKISNLTKNTQLLFLSVNSNNMSGPLPLVSSNLVYLDFSNNSFSGSISHFLCYRVNETKSLEGLKLTDNYLQGEIPDCWMSYQNLKVLKLSNNKFSGNLPNSLGSITSLVWLYLRKNRLSGKIPISLKNCTALASLDVDENEFVGNIPTWFGERFSRMLVLILRSNQFHGPLPKTICDLAFLQILDLADNNLSGAIPKCISNLTGMVTVKSFTGSVVYREILPLVSLLDISRNNFSGEILSEVTNLKALQSINFSFNTFTGRIPESIGTMRALESVDFSVNQLSGEIPQSMSSLTFLNHLNLSNNNLTGKIPLSTQLQSFNASSFAGNDLCGAPLPKNCTMFMK
ccHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHcccccccccccccccccccccccEEEccccccEEEEEccccccccccccccEEEcccccccccccEEEccccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccccccHHHHHccccccEEEcccccccccccHHHHHcccccccEEEcccccccccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccEEEccccccccccccEEEEEcccccccHHHHHHHHcccccccccEEEccccccEEEccccccccccccEEEcccccccccccccccccccccEEEccccccEEEEcHHHccccccccEEEccccEEEEEEcccccccccccEEEcccccccccccccccccccccEEEcccccccccccHHHHHccccccEEEccccEEccccccccccccccEEEccccccccccccccccccEEEcccccccccccHHHHHcccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccHHHHHcccccEEEcccccccccccHHHHHccccccEEEcccccccccccccccccccccEEEcccccccccccHHHHHHHHcccccccccEEEEEEcccccEEEEcccccccccccHHHHccccccccccccccccccccccccccccccEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
ccHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHccccccccccccccccccccEEEEEEcccccEEEEEEEcccccccccccccccccHHHHccccccEEEccccccccccccHHHcccccccEEEcccccccccccccHccccccEEEEccccccccccHHHHHccccccEEEcccccccccccHHHHcccccccHEEEcccccccccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHccccccEEEEccccccccccccHHHcccccccEEEEccccccccccHHHHccHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHHcHccccEEEcccccccccccHHHHHccccccEEEcccccccccccHccccccccEEEEEccccccccccHHHcccccccEEEcccccccccccHHHHHHcccccEEEcccccccccccccccccccEEEEccccccccccccccccccHHHHHHccccccccccccHHHcccccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccHHHccccccEEEEcccccccccccHHHHHHcccccEEEEccccccccccHHHccccccEEEEcccccccccccHHHHcHHHHHHHHcccccccccccccEEEEEEcccccccccccHHHHcccccEEEEcccccccccccHHccccccccEEEccccccEEcccHHHHHcccccEEEccccEEEEEccccccHHHccHHHccccccccccccHHHccccc
MSGILVFACLLLELLVISISffrgssyhvgcLETERRALLRFKQdlqdpsnrlaswtgdgdcctwagvacgnVTGHILelnlrnpstsnprsmlvgkvnpalldlkhlsyldlssndfqgvqiprfigsmrnlrylnlsdtqfvgmippqlgnlsdlqfldlssnylyvdnvwwlsglsflehldlrsVNLSKASDWLMATNTLPSLLELRlsncslhhfptlaspiprglqnltslkhldldsnhfnssipdwlykfspleclnlrnnslQGTISDAIGNLTSVSWLDLSIniglqgriprsmanfcnlksvnlrgvHLSQEISEILDIFSGcvsnglesldmrsssiyghltdQLGQFRNLVTLNlannsivglipesfgqlsTLRELQIYDNKLNGTLSEFHFAnltklswfrvggnqltfevkhdwippfqLVALGlhncyvgsrfpqwlhsqKHLQYLNLLnsrisdifpirflksasqlkFLDVGLNQFhgkisnltkNTQLLFLSVnsnnmsgplplvssnlvyldfsnnsfsgsISHFLCYRVNetksleglkltdnylqgeipdcwmsyQNLKVLKLsnnkfsgnlpnslgsITSLVWLYLRKNrlsgkipislknctalasldvdenefvgniptwFGERFSRMLVLILRsnqfhgplpktICDLAFLQILDLAdnnlsgaipkcisnltgmvtvkSFTGSVVYREILPLVSlldisrnnfsGEILSEVTNLKALQSINFSFntftgripesigtMRALESvdfsvnqlsgeipqsmsslTFLNHLnlsnnnltgkiplstqlqsfnassfagndlcgaplpknctmfmk
MSGILVFACLLLELLVISISFFRGSSYHVGCLETERRALLRFKQDLQDPSNRLASWTGDGDCCTWAGVACGNVTGHILELNLRNPSTSNPRSMLVGKVNPALLDLKHLSYLDLSSNDFQGVQIPRFIGSMRNLRYLNLSDTQFVGMIPPQLGNLSDLQFLDLSSNYLYVDNVWWLSGLSFLEHLDLRSVNLSKASDWLMATNTLPSLLELRLSNCSLHHFPTLASPIPRGLQNLTSLKHLDLDSNHFNSSIPDWLYKFSPLECLNLRNNSLQGTISDAIGNLTSVSWLDLSINIGLQGRIPRSMANFCNLKSVNLRGVHLSQEISEILDIFSGCVSNGLESLDMRSSSIYGHLTDQLGQFRNLVTLNLANNSIVGLIPESFGQLSTLRELQIYDNKLNGTLSEFHFANLTKLSWFRVGGNQLTFEVKHDWIPPFQLVALGLHNCYVGSRFPQWLHSQKHLQYLNLLNSRISDIFPIRFLKSASQLKFLDVGLNQFHGKISNLTKNTQLLFLSVNSNNMSGPLPLVSSNLVYLDFSNNSFSGSISHFLCYRVNETKSLEGLKLTDNYLQGEIPDCWMSYQNLKVLKLSNNKFSGNLPNSLGSITSLVWLYLRKNRLSGKIPISLKNCTALASLDVDENEFVGNIPTWFGERFSRMLVLILRSNQFHGPLPKTICDLAFLQILDLADNNLSGAIPKCISNLTGMVTVKSFTGSVVYREILPLVSLLDISRNNFSGEILSEVTNLKALQSINFSFNTFTGRIPESIGTMRALESVDFSVNQLSGEIPQSMSSLTFLNHLNLSNNNLTGKIPLSTQLQSFNASSFAGNDLCgaplpknctmfmk
MSGILVFAClllellVISISFFRGSSYHVGCLETERRALLRFKQDLQDPSNRLASWTGDGDCCTWAGVACGNVTGHILELNLRNPSTSNPRSMLVGKVNPAlldlkhlsyldlssNDFQGVQIPRFIGSMRNLRYLNLSDTQFVGMIPPQLGNLSDLQFLDLSSNYLYVDNVWWLSGLSFLEHLDLRSVNLSKASDWLMATNTLPSLLELRLSNCSLHHFPTLASPIPRGLQNLTSLKHLDLDSNHFNSSIPDWLYKFSPLECLNLRNNSLQGTISDAIGNLTSVSWLDLSINIGLQGRIPRSMANFCNLKSVNLRGVHLSQEISEILDIFSGCVSNGLESLDMRSSSIYGHLTDQLGQFRNLVTLNLANNSIVGLIPESFGQLSTLRELQIYDNKLNGTLSEFHFANLTKLSWFRVGGNQLTFEVKHDWIPPFQLVALGLHNCYVGSRFPQWLHSQKHLQYLNLLNSRISDIFPIRFLKSASQLKFLDVGLNQFHGKISNLTKNTQLLFLSVNSNNMSGPLPLVSSNLVYLDFSNNSFSGSISHFLCYRVNETKSLEGLKLTDNYLQGEIPDCWMSYQNLKVLKLSNNKFSGNLPNSLGSITSLVWLYLRKNRLSGKIPISLKNCTALASLDVDENEFVGNIPTWFGERFSRMLVLILRSNQFHGPLPKTICDLAFLQILDLADNNLSGAIPKCISNLTGMVTVKSFTGSVVYREILPLVSLLDISRNNFSGEILSEVTNLKALQSINFSFNTFTGRIPESIGTMRALESVDFSVNQLSGEIPQSMssltflnhlnlsnnnlTGKIPLSTQLQSFNASSFAGNDLCGAPLPKNCTMFMK
***ILVFACLLLELLVISISFFRGSSYHVGCLETERRALLRFKQDLQDPSNRLASWTGDGDCCTWAGVACGNVTGHILELNLR*********MLVGKVNPALLDLKHLSYLDLSSNDFQGVQIPRFIGSMRNLRYLNLSDTQFVGMIPPQLGNLSDLQFLDLSSNYLYVDNVWWLSGLSFLEHLDLRSVNLSKASDWLMATNTLPSLLELRLSNCSLHHFPTLASPIPRGLQNLTSLKHLDLDSNHFNSSIPDWLYKFSPLECLNLRNNSLQGTISDAIGNLTSVSWLDLSINIGLQGRIPRSMANFCNLKSVNLRGVHLSQEISEILDIFSGCVSNGLESLDMRSSSIYGHLTDQLGQFRNLVTLNLANNSIVGLIPESFGQLSTLRELQIYDNKLNGTLSEFHFANLTKLSWFRVGGNQLTFEVKHDWIPPFQLVALGLHNCYVGSRFPQWLHSQKHLQYLNLLNSRISDIFPIRFLKSASQLKFLDVGLNQFHGKISNLTKNTQLLFLSVNSNNMSGPLPLVSSNLVYLDFSNNSFSGSISHFLCYRVNETKSLEGLKLTDNYLQGEIPDCWMSYQNLKVLKLSNNKFSGNLPNSLGSITSLVWLYLRKNRLSGKIPISLKNCTALASLDVDENEFVGNIPTWFGERFSRMLVLILRSNQFHGPLPKTICDLAFLQILDLADNNLSGAIPKCISNLTGMVTVKSFTGSVVYREILPLVSLLDISRNNFSGEILSEVTNLKALQSINFSFNTFTGRIPESIGTMRALESVDFSVNQL*********SLTFLNHLNLSNNNLTGKIPLSTQLQSFNASSFAGNDLCGA***********
**GILVFACLLLELLVISISFFRGSS*****LETERRALLRFKQDLQDPSNRLASWTGDGDCCTWAGVACGNVTGHILELNLRNPSTSNPRSMLVGKVNPALLDLKHLSYLDLSSNDFQGVQIPRFIGSMRNLRYLNLSDTQFVGMIPPQLGNLSDLQFLDLSSNYLYVDNVWWLSGLSFLEHLDLRSVNLSKASDWLMATNTLPSLLELRLSNCSLHHFPTLASPIPRGLQNLTSLKHLDLDSNHFNSSIPDWLYKFSPLECLNLRNNSLQGTISDAIGNLTSVSWLDLSINIGLQGRIPRSMANFCNLKSVNLRGVHLSQEISEILDIFSGCVSNGLESLDMRSSSIYGHLTDQLGQFRNLVTLNLANNSIVGLIPESFGQLSTLRELQIYDNKLNGTLSEFHFANLTKLSWFRVGGNQLTFEVKHDWIPPFQLVALGLHNCYVGSRFPQWLHSQKHLQYLNLLNSRISDIFPIRFLKSASQLKFLDVGLNQFHGKISNLTKNTQLLFLSVNSNNMSGPLPLVSSNLVYLDFSNNSFSGSISHFLCYRVNETKSLEGLKLTDNYLQGEIPDCWMSYQNLKVLKLSNNKFSGNLPNSLGSITSLVWLYLRKNRLSGKIPISLKNCTALASLDVDENEFVGNIPTWFGERFSRMLVLILRSNQFHGPLPKTICDLAFLQILDLADNNLSGAIPKCISNLTGMVTVKSFTGSVVYREILPLVSLLDISRNNFSGEILSEVTNLKALQSINFSFNTFTGRIPESIGTMRALESVDFSVNQLSGEIPQSMSSLTFLNHLNLSNNNLTGKIPLSTQLQSFNASSFAGNDLCGAPLPKNCT****
MSGILVFACLLLELLVISISFFRGSSYHVGCLETERRALLRFKQDLQDPSNRLASWTGDGDCCTWAGVACGNVTGHILELNLRNPSTSNPRSMLVGKVNPALLDLKHLSYLDLSSNDFQGVQIPRFIGSMRNLRYLNLSDTQFVGMIPPQLGNLSDLQFLDLSSNYLYVDNVWWLSGLSFLEHLDLRSVNLSKASDWLMATNTLPSLLELRLSNCSLHHFPTLASPIPRGLQNLTSLKHLDLDSNHFNSSIPDWLYKFSPLECLNLRNNSLQGTISDAIGNLTSVSWLDLSINIGLQGRIPRSMANFCNLKSVNLRGVHLSQEISEILDIFSGCVSNGLESLDMRSSSIYGHLTDQLGQFRNLVTLNLANNSIVGLIPESFGQLSTLRELQIYDNKLNGTLSEFHFANLTKLSWFRVGGNQLTFEVKHDWIPPFQLVALGLHNCYVGSRFPQWLHSQKHLQYLNLLNSRISDIFPIRFLKSASQLKFLDVGLNQFHGKISNLTKNTQLLFLSVNSNNMSGPLPLVSSNLVYLDFSNNSFSGSISHFLCYRVNETKSLEGLKLTDNYLQGEIPDCWMSYQNLKVLKLSNNKFSGNLPNSLGSITSLVWLYLRKNRLSGKIPISLKNCTALASLDVDENEFVGNIPTWFGERFSRMLVLILRSNQFHGPLPKTICDLAFLQILDLADNNLSGAIPKCISNLTGMVTVKSFTGSVVYREILPLVSLLDISRNNFSGEILSEVTNLKALQSINFSFNTFTGRIPESIGTMRALESVDFSVNQLSGEIPQSMSSLTFLNHLNLSNNNLTGKIPLSTQLQSFNASSFAGNDLCGAPLPKNCTMFMK
*SGILVFACLLLELLVISISFFRGSSYHVGCLETERRALLRFKQDLQDPSNRLASWTGDGDCCTWAGVACGNVTGHILELNLRNPSTSNPRSMLVGKVNPALLDLKHLSYLDLSSNDFQGVQIPRFIGSMRNLRYLNLSDTQFVGMIPPQLGNLSDLQFLDLSSNYLYVDNVWWLSGLSFLEHLDLRSVNLSKASDWLMATNTLPSLLELRLSNCSLHHFPTLASPIPRGLQNLTSLKHLDLDSNHFNSSIPDWLYKFSPLECLNLRNNSLQGTISDAIGNLTSVSWLDLSINIGLQGRIPRSMANFCNLKSVNLRGVHLSQEISEILDIFSGCVSNGLESLDMRSSSIYGHLTDQLGQFRNLVTLNLANNSIVGLIPESFGQLSTLRELQIYDNKLNGTLSEFHFANLTKLSWFRVGGNQLTFEVKHDWIPPFQLVALGLHNCYVGSRFPQWLHSQKHLQYLNLLNSRISDIFPIRFLKSASQLKFLDVGLNQFHGKISNLTKNTQLLFLSVNSNNMSGPLPLVSSNLVYLDFSNNSFSGSISHFLCYRVNETKSLEGLKLTDNYLQGEIPDCWMSYQNLKVLKLSNNKFSGNLPNSLGSITSLVWLYLRKNRLSGKIPISLKNCTALASLDVDENEFVGNIPTWFGERFSRMLVLILRSNQFHGPLPKTICDLAFLQILDLADNNLSGAIPKCISNLTGMVTVKSFTGSVVYREILPLVSLLDISRNNFSGEILSEVTNLKALQSINFSFNTFTGRIPESIGTMRALESVDFSVNQLSGEIPQSMSSLTFLNHLNLSNNNLTGKIPLSTQLQSFNASSFAGNDLCGAPLPKNC*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSGILVFACLLLELLVISISFFRGSSYHVGCLETERRALLRFKQDLQDPSNRLASWTGDGDCCTWAGVACGNVTGHILELNLRNPSTSNPRSMLVGKVNPALLDLKHLSYLDLSSNDFQGVQIPRFIGSMRNLRYLNLSDTQFVGMIPPQLGNLSDLQFLDLSSNYLYVDNVWWLSGLSFLEHLDLRSVNLSKASDWLMATNTLPSLLELRLSNCSLHHFPTLASPIPRGLQNLTSLKHLDLDSNHFNSSIPDWLYKFSPLECLNLRNNSLQGTISDAIGNLTSVSWLDLSINIGLQGRIPRSMANFCNLKSVNLRGVHLSQEISEILDIFSGCVSNGLESLDMRSSSIYGHLTDQLGQFRNLVTLNLANNSIVGLIPESFGQLSTLRELQIYDNKLNGTLSEFHFANLTKLSWFRVGGNQLTFEVKHDWIPPFQLVALGLHNCYVGSRFPQWLHSQKHLQYLNLLNSRISDIFPIRFLKSASQLKFLDVGLNQFHGKISNLTKNTQLLFLSVNSNNMSGPLPLVSSNLVYLDFSNNSFSGSISHFLCYRVNETKSLEGLKLTDNYLQGEIPDCWMSYQNLKVLKLSNNKFSGNLPNSLGSITSLVWLYLRKNRLSGKIPISLKNCTALASLDVDENEFVGNIPTWFGERFSRMLVLILRSNQFHGPLPKTICDLAFLQILDLADNNLSGAIPKCISNLTGMVTVKSFTGSVVYREILPLVSLLDISRNNFSGEILSEVTNLKALQSINFSFNTFTGRIPESIGTMRALESVDFSVNQLSGEIPQSMSSLTFLNHLNLSNNNLTGKIPLSTQLQSFNASSFAGNDLCGAPLPKNCTMFMK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query840 2.2.26 [Sep-21-2011]
C0LGQ5 1249 LRR receptor-like serine/ no no 0.917 0.617 0.333 6e-85
Q9FL28 1173 LRR receptor-like serine/ no no 0.895 0.641 0.311 4e-81
Q9FIZ3 1252 LRR receptor-like serine/ no no 0.865 0.580 0.313 8e-77
Q9LYN8 1192 Leucine-rich repeat recep no no 0.883 0.622 0.298 2e-63
Q9SHI2 1101 Leucine-rich repeat recep no no 0.688 0.524 0.323 1e-58
Q9LP24 1120 Probable leucine-rich rep no no 0.834 0.625 0.294 2e-58
Q9C9H7847 Receptor-like protein 12 no no 0.672 0.667 0.306 2e-58
O49318 1124 Probable leucine-rich rep no no 0.745 0.556 0.298 6e-57
Q9LVP0 1102 Probable leucine-rich rep no no 0.704 0.537 0.309 8e-56
C0LGS2 1136 Probable LRR receptor-lik no no 0.838 0.619 0.290 1e-55
>sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 Back     alignment and function desciption
 Score =  316 bits (809), Expect = 6e-85,   Method: Compositional matrix adjust.
 Identities = 290/870 (33%), Positives = 431/870 (49%), Gaps = 99/870 (11%)

Query: 30  GCLETERRALLRFKQDL------QDPSNRLASWTGDG-DCCTWAGVACGNVTG--HILEL 80
           G +  + + LL  K+ L       DP   L  W  D  + C+W GV C N TG   ++ L
Sbjct: 21  GIINNDLQTLLEVKKSLVTNPQEDDP---LRQWNSDNINYCSWTGVTCDN-TGLFRVIAL 76

Query: 81  NLRNPSTSNPRSMLVGKVNPALLDLKHLSYLDLSSNDFQGVQIPRFIGSMRNLRYLNLSD 140
           NL           L G ++P      +L +LDLSSN+  G  IP  + ++ +L  L L  
Sbjct: 77  NLTGLG-------LTGSISPWFGRFDNLIHLDLSSNNLVG-PIPTALSNLTSLESLFLFS 128

Query: 141 TQFVGMIPPQLGNLSDLQFLDLSSNYLYVDNVWWLSGLSFLEHLDLRSVNLSKASDWLMA 200
            Q  G IP QLG+L +++ L +  N L  D    L  L  L+ L L S  L         
Sbjct: 129 NQLTGEIPSQLGSLVNIRSLRIGDNELVGDIPETLGNLVNLQMLALASCRL--------- 179

Query: 201 TNTLPSLLE--LRLSNCSLHHFPTLASPIPRGLQNLTSLKHLDLDSNHFNSSIPDWLYKF 258
           T  +PS L   +R+ +  L     L  PIP  L N + L       N  N +IP  L + 
Sbjct: 180 TGPIPSQLGRLVRVQSLILQD-NYLEGPIPAELGNCSDLTVFTAAENMLNGTIPAELGRL 238

Query: 259 SPLECLNLRNNSLQGTISDAIGNLTSVSWLDLSINIGLQGRIPRSMANFCNLKSVNLRGV 318
             LE LNL NNSL G I   +G ++ + +L L  N  LQG IP+S+A+  NL++++L   
Sbjct: 239 ENLEILNLANNSLTGEIPSQLGEMSQLQYLSLMAN-QLQGLIPKSLADLGNLQTLDLSAN 297

Query: 319 HLSQEI-------SEILDIF------------SGCVSN-GLESLDMRSSSIYGHLTDQLG 358
           +L+ EI       S++LD+             S C +N  LE L +  + + G +  +L 
Sbjct: 298 NLTGEIPEEFWNMSQLLDLVLANNHLSGSLPKSICSNNTNLEQLVLSGTQLSGEIPVELS 357

Query: 359 QFRNLVTLNLANNSIVGLIPESFGQLSTLRELQIYDNKLNGTLSEFHFANLTKLSWFRVG 418
           + ++L  L+L+NNS+ G IPE+  +L  L +L +++N L GTLS    +NLT L W  + 
Sbjct: 358 KCQSLKQLDLSNNSLAGSIPEALFELVELTDLYLHNNTLEGTLSP-SISNLTNLQWLVLY 416

Query: 419 GNQLTFEVKHDWIPPFQLVALGLHNCYVGSRFPQWLH---------------------SQ 457
            N L  ++  +     +L  L L+        PQ +                      S 
Sbjct: 417 HNNLEGKLPKEISALRKLEVLFLYENRFSGEIPQEIGNCTSLKMIDMFGNHFEGEIPPSI 476

Query: 458 KHLQYLNLLNSRISDI---FPIRFLKSASQLKFLDVGLNQFHGKISN---LTKNTQLLFL 511
             L+ LNLL+ R +++    P   L +  QL  LD+  NQ  G I +     K  + L L
Sbjct: 477 GRLKELNLLHLRQNELVGGLPAS-LGNCHQLNILDLADNQLSGSIPSSFGFLKGLEQLML 535

Query: 512 SVNSNNMSGPLPLVS-SNLVYLDFSNNSFSGSISHFLCYRVNETKSLEGLKLTDNYLQGE 570
             NS   + P  L+S  NL  ++ S+N  +G+I H LC     + S     +T+N  + E
Sbjct: 536 YNNSLQGNLPDSLISLRNLTRINLSHNRLNGTI-HPLC----GSSSYLSFDVTNNGFEDE 590

Query: 571 IPDCWMSYQNLKVLKLSNNKFSGNLPNSLGSITSLVWLYLRKNRLSGKIPISLKNCTALA 630
           IP    + QNL  L+L  N+ +G +P +LG I  L  L +  N L+G IP+ L  C  L 
Sbjct: 591 IPLELGNSQNLDRLRLGKNQLTGKIPWTLGKIRELSLLDMSSNALTGTIPLQLVLCKKLT 650

Query: 631 SLDVDENEFVGNIPTWFGERFSRMLVLILRSNQFHGPLPKTICDLAFLQILDLADNNLSG 690
            +D++ N   G IP W G + S++  L L SNQF   LP  + +   L +L L  N+L+G
Sbjct: 651 HIDLNNNFLSGPIPPWLG-KLSQLGELKLSSNQFVESLPTELFNCTKLLVLSLDGNSLNG 709

Query: 691 AIPKCISNLTGM----VTVKSFTGSVVYR-EILPLVSLLDISRNNFSGEILSEVTNLKAL 745
           +IP+ I NL  +    +    F+GS+      L  +  L +SRN+ +GEI  E+  L+ L
Sbjct: 710 SIPQEIGNLGALNVLNLDKNQFSGSLPQAMGKLSKLYELRLSRNSLTGEIPVEIGQLQDL 769

Query: 746 QS-INFSFNTFTGRIPESIGTMRALESVDFSVNQLSGEIPQSMSSLTFLNHLNLSNNNLT 804
           QS ++ S+N FTG IP +IGT+  LE++D S NQL+GE+P S+  +  L +LN+S NNL 
Sbjct: 770 QSALDLSYNNFTGDIPSTIGTLSKLETLDLSHNQLTGEVPGSVGDMKSLGYLNVSFNNLG 829

Query: 805 GKIPLSTQLQSFNASSFAGN-DLCGAPLPK 833
           GK  L  Q   + A SF GN  LCG+PL +
Sbjct: 830 GK--LKKQFSRWPADSFLGNTGLCGSPLSR 857




Together with GSO2, receptor-like serine/threonine-kinase required during the development of the epidermal surface in embryos and cotyledons.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function description
>sp|Q9FIZ3|GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2 Back     alignment and function description
>sp|Q9LYN8|EXS_ARATH Leucine-rich repeat receptor protein kinase EXS OS=Arabidopsis thaliana GN=EXS PE=1 SV=1 Back     alignment and function description
>sp|Q9SHI2|Y1723_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230 OS=Arabidopsis thaliana GN=At1g17230 PE=2 SV=2 Back     alignment and function description
>sp|Q9LP24|Y1571_ARATH Probable leucine-rich repeat receptor-like protein kinase At1g35710 OS=Arabidopsis thaliana GN=At1g35710 PE=2 SV=1 Back     alignment and function description
>sp|Q9C9H7|RLP12_ARATH Receptor-like protein 12 OS=Arabidopsis thaliana GN=RLP12 PE=2 SV=2 Back     alignment and function description
>sp|O49318|Y2317_ARATH Probable leucine-rich repeat receptor-like protein kinase At2g33170 OS=Arabidopsis thaliana GN=At2g33170 PE=2 SV=1 Back     alignment and function description
>sp|Q9LVP0|Y5639_ARATH Probable leucine-rich repeat receptor-like protein kinase At5g63930 OS=Arabidopsis thaliana GN=At5g63930 PE=1 SV=1 Back     alignment and function description
>sp|C0LGS2|Y4361_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g36180 OS=Arabidopsis thaliana GN=At4g36180 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query840
224072885 1024 predicted protein [Populus trichocarpa] 0.970 0.795 0.480 0.0
315436720 1020 verticillium wilt resistance-like protei 0.985 0.811 0.448 0.0
255543977 1075 serine/threonine-protein kinase bri1, pu 0.989 0.773 0.446 0.0
350284739 978 receptor-like protein [Malus x domestica 0.951 0.816 0.459 0.0
350284749 980 receptor-like protein [Malus baccata] 0.982 0.841 0.450 0.0
350284751 980 receptor-like protein [Malus baccata] 0.95 0.814 0.455 0.0
14330716 980 HcrVf2 protein [Malus floribunda] gi|350 0.95 0.814 0.455 0.0
350284753915 receptor-like protein [Malus micromalus] 0.951 0.873 0.454 0.0
209970631 962 HcrVf4 [Malus floribunda] 0.951 0.830 0.454 0.0
350284761915 receptor-like protein [Malus micromalus] 0.951 0.873 0.453 0.0
>gi|224072885|ref|XP_002303927.1| predicted protein [Populus trichocarpa] gi|222841359|gb|EEE78906.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  770 bits (1988), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 447/931 (48%), Positives = 582/931 (62%), Gaps = 116/931 (12%)

Query: 22  FRGSSYHVGCLETERRALLRFKQDLQDPSNRLASWTG-DGDCCTWAGVACGNVTGHILEL 80
           F   S+  GC + ER ALL+FK DL+DPSNRLASW G  GDCCTW GV C NVTGH++EL
Sbjct: 28  FSYGSFTQGCSQIERDALLKFKHDLKDPSNRLASWAGFGGDCCTWRGVICDNVTGHVIEL 87

Query: 81  NLRNPSTSNP--------------RSMLVGKVNPALLDLKHLSYLDLSSNDFQGVQIPRF 126
            LR+ S ++               + +L G++NP+L+ LKHL YLDL +NDF GVQIP+F
Sbjct: 88  RLRSISFADYLASSGASTQYEDYLKLILSGRINPSLVSLKHLRYLDLRNNDFGGVQIPKF 147

Query: 127 IGSMRNLRYLNLSDTQFVGMIPPQLGNLSDLQFLDLSSNY--LYVDNVWWLSGLSFLEHL 184
           IG + +L++L+LSD  F G IP  LGNLSDL +L+L   Y    V+N+ WLS LS LE L
Sbjct: 148 IGLIGSLKHLDLSDAGFAGTIPHGLGNLSDLNYLNLHDYYSQFNVENLNWLSQLSSLEFL 207

Query: 185 DLRSVNLSKASDWLMATNTLPSLLELRLSNC----------------------------- 215
           DL  V+L    +WL   NTLPSL+EL LS C                             
Sbjct: 208 DLSLVHLGNVFNWLEVINTLPSLVELHLSYCQLPPVPPILYVNFSSLSILDLSSNYVDES 267

Query: 216 --SLHHFPTLAS-----------------PIPRGLQNLTSLKHLDLDSNHFNSSIPDWLY 256
             S+ +FP   S                 PIP GLQNLT LK LDL  NHF+SSIP+WLY
Sbjct: 268 AISMLNFPRWVSHLKTLLSLNLANNNFQGPIPNGLQNLTLLKALDLSINHFSSSIPEWLY 327

Query: 257 KFSPLECLNLRNNSLQGTISDAIGNLTSVSWLDLSIN--IGLQGRIPRSMANFCNLKSVN 314
            F  L+ LNL +N+LQG +S AIGN+TS+  LDLS+N  +  +G IP S    CNL++++
Sbjct: 328 GFEHLKLLNLGSNNLQGVLSSAIGNMTSLISLDLSLNHELKFEGGIPGSFKKLCNLRTLS 387

Query: 315 LRGVHLSQEISEILDIFSGCVSNGLESLDMRSSSIYGHLTDQLGQFRNLVTLNLANNSIV 374
           L  V L+Q+I+E+L++  GCVS  +ESLD+    ++G LT+ LG+FRNL  L L +NSI 
Sbjct: 388 LSNVKLNQDIAEVLEVLLGCVSEEVESLDLAGCLLFGQLTNHLGKFRNLAYLGLRSNSIS 447

Query: 375 GLIPESFGQLSTLRELQIYDNKLNGTL------------------------SEFHFANLT 410
           G IP + G+L +LR L + DNKLNGTL                        SE HFANL 
Sbjct: 448 GPIPMALGELVSLRSLVLSDNKLNGTLPKSFGELTKLEEMDISHNLFQGEVSEVHFANLK 507

Query: 411 KLSWFRVGGNQLTFEVKHDWIPPFQLVALGLHNCYVGSRFPQWLHSQKHLQYLNLLNSRI 470
            L  F   GNQL   V  DWIPP QLV + L +  VG +FP+W+   +HL YL++ NS I
Sbjct: 508 NLRNFSAAGNQLNLRVSPDWIPP-QLVFIDLRSWNVGPQFPKWVRPLEHLSYLDISNSSI 566

Query: 471 SDIFPIRFLKSASQLKFLDVGLNQFHGKISNLTK---NTQLLFLSVNSNNMSGPLPLVSS 527
           S   PI F   + ++++L++  NQ  G I +  K         + ++SN   GPLP + S
Sbjct: 567 SSTIPIWFWTMSFRMEYLNLSHNQIQGVIPSKLKLDFTASYPLVDLSSNQFKGPLPSIFS 626

Query: 528 NLVYLDFSNNSFSGSISHFLCYRVNETKSLEGLKLTDNYLQGEIPDCWMSYQNLKVLKLS 587
           N+  LD SNNSFSGS+ +FLC++++E K+++ L L +N L G IPDCW S+Q L  +KLS
Sbjct: 627 NVGALDLSNNSFSGSMLNFLCHKIDELKNMQVLNLGENLLSGVIPDCWSSWQYLVAIKLS 686

Query: 588 NNKFSGNLPNSLGSITSLVWLYLRKNRLSGKIPISLKNCTALASLDVDENEFVGNIPTWF 647
           NNK SGN+P+S+G+++ L  L++R + LSGK+PISLKNCT L +LDV ENE VG++P W 
Sbjct: 687 NNKLSGNIPDSIGALSLLESLHIRNSSLSGKLPISLKNCTKLITLDVAENELVGSMPAWI 746

Query: 648 GERFSRMLVLILRSNQFHGPLPKTICDLAFLQILDLADNNLSGAIPKCISNLTGMVTVKS 707
           G+RFS M+VL +R+N+FHG +P+ +C+LA LQILDLA N LS +IP C + L+ M T   
Sbjct: 747 GKRFSSMVVLNMRANKFHGRIPRELCNLASLQILDLAHNRLSWSIPTCFNKLSAMATRND 806

Query: 708 FTGS---------------------VVYREILPLVSLLDISRNNFSGEILSEVTNLKALQ 746
             G                      V Y  IL  V  +D+S N   GEI  EVT L  LQ
Sbjct: 807 SLGKIYLDSGSSTFDNVLLVMKGKVVEYSTILKFVRSIDLSSNALCGEIPEEVTRLSELQ 866

Query: 747 SINFSFNTFTGRIPESIGTMRALESVDFSVNQLSGEIPQSMSSLTFLNHLNLSNNNLTGK 806
           S+N S N+ TGRIPE IG++R LES+DFSVNQLSGEIPQSMS LTFL+HLNLS+N L G+
Sbjct: 867 SLNLSQNSLTGRIPEGIGSLRYLESMDFSVNQLSGEIPQSMSDLTFLSHLNLSDNRLRGR 926

Query: 807 IPLSTQLQSFNASSFAGNDLCGAPLPKNCTM 837
           IP  TQLQSF  SSF+GN+LCG PL KNC++
Sbjct: 927 IPSGTQLQSFGPSSFSGNELCGPPLSKNCSV 957




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|315436720|gb|ADU18533.1| verticillium wilt resistance-like protein [Gossypium barbadense] Back     alignment and taxonomy information
>gi|255543977|ref|XP_002513051.1| serine/threonine-protein kinase bri1, putative [Ricinus communis] gi|223548062|gb|EEF49554.1| serine/threonine-protein kinase bri1, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|350284739|gb|AEQ27741.1| receptor-like protein [Malus x domestica] Back     alignment and taxonomy information
>gi|350284749|gb|AEQ27746.1| receptor-like protein [Malus baccata] Back     alignment and taxonomy information
>gi|350284751|gb|AEQ27747.1| receptor-like protein [Malus baccata] Back     alignment and taxonomy information
>gi|14330716|emb|CAC40826.1| HcrVf2 protein [Malus floribunda] gi|350284757|gb|AEQ27750.1| receptor-like protein [Malus micromalus] Back     alignment and taxonomy information
>gi|350284753|gb|AEQ27748.1| receptor-like protein [Malus micromalus] Back     alignment and taxonomy information
>gi|209970631|gb|ACJ03074.1| HcrVf4 [Malus floribunda] Back     alignment and taxonomy information
>gi|350284761|gb|AEQ27752.1| receptor-like protein [Malus micromalus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query840
TAIR|locus:2044767905 AT2G34930 "AT2G34930" [Arabido 0.940 0.872 0.323 5.3e-95
TAIR|locus:2120362 1249 GSO1 "GASSHO1" [Arabidopsis th 0.854 0.574 0.324 7.7e-73
TAIR|locus:2156349 1252 GSO2 "GASSHO 2" [Arabidopsis t 0.909 0.610 0.307 5.7e-72
TAIR|locus:2129246891 RLP50 "receptor like protein 5 0.922 0.869 0.287 3.1e-67
TAIR|locus:2085537894 RLP34 "AT3G11010" [Arabidopsis 0.827 0.777 0.307 2.2e-66
TAIR|locus:2101943 891 RLP45 "AT3G53240" [Arabidopsis 0.644 0.607 0.288 2.6e-64
TAIR|locus:2182870 1192 EMS1 "EXCESS MICROSPOROCYTES1" 0.928 0.654 0.282 5.2e-62
TAIR|locus:2144392957 RLP53 "receptor like protein 5 0.930 0.817 0.278 4e-61
TAIR|locus:2170483 1173 FLS2 "FLAGELLIN-SENSITIVE 2" [ 0.827 0.592 0.295 1.2e-60
TAIR|locus:2040075 935 RLP21 "AT2G25470" [Arabidopsis 0.921 0.827 0.272 3.3e-59
TAIR|locus:2044767 AT2G34930 "AT2G34930" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 945 (337.7 bits), Expect = 5.3e-95, P = 5.3e-95
 Identities = 274/848 (32%), Positives = 428/848 (50%)

Query:    24 GSSYHVGCLETERRALLRFKQDLQDPSNRLASWTGDGDCCTWAGVACGNVTGHILELNLR 83
             GS+    C+ TER+ALL F+  L D S+RL SW+G  DCC W GV C   T H+++++LR
Sbjct:    26 GSAASPKCISTERQALLTFRAALTDLSSRLFSWSGP-DCCNWPGVLCDARTSHVVKIDLR 84

Query:    84 NPSTS-----NPRSMLVGKVNPAXXXXXXXXXXXXXXNDFQGVQIPRFIGSMRNLRYLNL 138
             NPS         R  L GK++P+              NDF  ++IP FIG + +LRYLNL
Sbjct:    85 NPSQDVRSDEYKRGSLRGKIHPSLTQLKFLSYLDLSSNDFNELEIPEFIGQIVSLRYLNL 144

Query:   139 SDTQFVGMIPPQLGNLSDLQFLDL-SSNY-------LYVDNVWWLSGLSF-LEHLDLRSV 189
             S + F G IP  LGNLS L+ LDL + ++       L   N+ WLS LS  L++L++  V
Sbjct:   145 SSSSFSGEIPTSLGNLSKLESLDLYAESFGDSGTLSLRASNLRWLSSLSSSLKYLNMGYV 204

Query:   190 NLSKASD-WLMATNTLPSLLELRLSNCSLHHFP-TLASPIPRGLQNLTSLKHLDLDSNHF 247
             NLS A + WL   + + +L EL L N  L + P TL+S       +L  L+ LDL  N  
Sbjct:   205 NLSGAGETWLQDFSRISALKELHLFNSELKNLPPTLSSSA-----DLKLLEVLDLSENSL 259

Query:   248 NSSIPDWLYKFSPLECLNLRNNSLQGTISDAIGNLTSVSWLDLSINIGLQGRIPRSMANF 307
             NS IP+WL+  + L  L LR + LQG+I     NL  +  LDLS N+ LQG IP  + + 
Sbjct:   260 NSPIPNWLFGLTNLRKLFLRWDFLQGSIPTGFKNLKLLETLDLSNNLALQGEIPSVLGDL 319

Query:   308 CNLKSVNLRGVHLSQEISEILDIFSGCVSNGLESLDMRSSSIYGHLTDQLGQFRNLVTLN 367
               LK ++L    L+ +I   LD FS    N L  LD+ S+ + G L + LG  RNL TL+
Sbjct:   320 PQLKFLDLSANELNGQIHGFLDAFSRNKGNSLVFLDLSSNKLAGTLPESLGSLRNLQTLD 379

Query:   368 LANNSIVGLIPESFGQLSTLRELQIYDNKLNGTLSEF--HFANLTKLSWF-RVGGNQLTF 424
             L++NS  G +P S G +++L++L + +N +NGT++E     A L  L+      G  L  
Sbjct:   380 LSSNSFTGSVPSSIGNMASLKKLDLSNNAMNGTIAESLGQLAELVDLNLMANTWGGVLQ- 438

Query:   425 EVKHDWIPPFQLVALGLHNCYVGS---RFPQ-WLHSQKHLQYLNLLNSRISDIFPIRFLK 480
               K  ++    L ++ L      S   + P  W+   + L+ + + N RI  +FP+ +L+
Sbjct:   439 --KSHFVNLRSLKSIRLTTEPYRSLVFKLPSTWIPPFR-LELIQIENCRIG-LFPM-WLQ 493

Query:   481 SASQLKFLDVGLNQFHGKISNLTKN---TQLLFLSVNSNNMSGPLP--LVSSNLVYLDFS 535
               ++L F+ +        I +   +   +++ +L + +N + G LP  L    L  +D S
Sbjct:   494 VQTKLNFVTLRNTGIEDTIPDSWFSGISSKVTYLILANNRIKGRLPQKLAFPKLNTIDLS 553

Query:   536 NNSFSGSISHFLCYRVNETKSLEGLKLTDNYLQGEIP-DCWMSYQNLKVLKLSNNKFSGN 594
             +N+F G+   F  +  N T+    L+L +N   G +P +  +    ++ + L +N F+GN
Sbjct:   554 SNNFEGT---FPLWSTNATE----LRLYENNFSGSLPQNIDVLMPRMEKIYLFSNSFTGN 606

Query:   595 LPNSLGSITSLVWLYLRKNRLSGKIPISLKNCTALASLDVDENEFVGNIPTWFGERFSRM 654
             +P+SL  ++ L  L LRKN  SG  P        L  +DV EN   G IP   G     +
Sbjct:   607 IPSSLCEVSGLQILSLRKNHFSGSFPKCWHRQFMLWGIDVSENNLSGEIPESLG-MLPSL 665

Query:   655 LVLILRSNQFHGPLPKTICDLAFLQILDLADNNLSGAIPKCISNLTGMVTVK----SFTG 710
              VL+L  N   G +P+++ + + L  +DL  N L+G +P  +  L+ +  ++    SFTG
Sbjct:   666 SVLLLNQNSLEGKIPESLRNCSGLTNIDLGGNKLTGKLPSWVGKLSSLFMLRLQSNSFTG 725

Query:   711 SVVYREI-LPLVSLLDISRNNFSGEILSEVTNLKALQ--SINFSFNTFTGRIPESIGTMR 767
              +      +P + +LD+S N  SG I   ++NL A+   + N  F      +  +     
Sbjct:   726 QIPDDLCNVPNLRILDLSGNKISGPIPKCISNLTAIARGTNNEVFQNLVFIVTRAREYEA 785

Query:   768 ALESVDFSVNQLSGEIPQSMXXXXXXXXXXXXXXXXTGKIPLS-TQLQSFNASSFAGNDL 826
                S++ S N +SGEIP+ +                 G IP   ++L        + N  
Sbjct:   786 IANSINLSGNNISGEIPREILGLLYLRILNLSRNSMAGSIPEKISELSRLETLDLSKNKF 845

Query:   827 CGAPLPKN 834
              GA +P++
Sbjct:   846 SGA-IPQS 852


GO:0006952 "defense response" evidence=ISS
GO:0007165 "signal transduction" evidence=IC
GO:0005618 "cell wall" evidence=IDA
GO:0050832 "defense response to fungus" evidence=IEP;IMP
TAIR|locus:2120362 GSO1 "GASSHO1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2156349 GSO2 "GASSHO 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2129246 RLP50 "receptor like protein 50" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2085537 RLP34 "AT3G11010" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2101943 RLP45 "AT3G53240" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2182870 EMS1 "EXCESS MICROSPOROCYTES1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2144392 RLP53 "receptor like protein 53" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2170483 FLS2 "FLAGELLIN-SENSITIVE 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2040075 RLP21 "AT2G25470" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query840
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-61
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-56
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-19
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-17
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-13
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-10
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-10
pfam0826342 pfam08263, LRRNT_2, Leucine rich repeat N-terminal 7e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-06
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 2e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 4e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 9e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-04
COG5238388 COG5238, RNA1, Ran GTPase-activating protein (RanG 3e-04
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 3e-04
COG4886 394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 7e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.001
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.001
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 0.001
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.002
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.003
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score =  225 bits (574), Expect = 1e-61
 Identities = 208/661 (31%), Positives = 309/661 (46%), Gaps = 104/661 (15%)

Query: 35  ERRALLRFKQDLQDPSNRLASWTGDGDCCTWAGVACGNVTGHILELNLRNPSTSNPRSML 94
           E   LL FK  + DP   L++W    D C W G+ C N +  ++ ++L   + S      
Sbjct: 30  ELELLLSFKSSINDPLKYLSNWNSSADVCLWQGITCNNSS-RVVSIDLSGKNIS------ 82

Query: 95  VGKVNPALLDLKHLSYLDLSSNDFQGVQIPRFI-GSMRNLRYLNLSDTQFVGMIPPQLGN 153
            GK++ A+  L ++  ++LS+N   G  IP  I  +  +LRYLNLS+  F G IP   G+
Sbjct: 83  -GKISSAIFRLPYIQTINLSNNQLSG-PIPDDIFTTSSSLRYLNLSNNNFTGSIPR--GS 138

Query: 154 LSDLQFLDLSSNYLYVDNVWWLSGLSFLEHLDLRSVNLSKASDWLMATNTLPSLLELRLS 213
           + +L+ LDLS+N L  +    +   S L+ LDL                           
Sbjct: 139 IPNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGG------------------------- 173

Query: 214 NCSLHHFPTLASPIPRGLQNLTSLKHLDLDSNHFNSSIPDWLYKFSPLECLNLRNNSLQG 273
                    L   IP  L NLTSL+ L L SN     IP  L +   L+ + L  N+L G
Sbjct: 174 -------NVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSG 226

Query: 274 TISDAIGNLTSVSWLDLSINIGLQGRIPRSMANFCNLKSVNLRGVHLSQEISEILDIFSG 333
            I   IG LTS++ LDL  N  L G IP S+ N  NL+ + L    LS  I     IFS 
Sbjct: 227 EIPYEIGGLTSLNHLDLVYN-NLTGPIPSSLGNLKNLQYLFLYQNKLSGPIPP--SIFS- 282

Query: 334 CVSNGLESLDMRSSSIYGHLTDQLGQFRNLVTLNLANNSIVGLIPESFGQLSTLRELQIY 393
                L SLD+  +S+ G + + + Q +NL  L+L +N+  G IP +   L  L+ LQ++
Sbjct: 283 --LQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFTGKIPVALTSLPRLQVLQLW 340

Query: 394 DNKLNGTLSEFHFANLTKLSWFRVGGNQLTFEVKHDWIPPFQLVALGLHNCYVGSRFPQW 453
            NK +G +      NL K        N LT               L L    +    P+ 
Sbjct: 341 SNKFSGEIP----KNLGK-------HNNLT--------------VLDLSTNNLTGEIPEG 375

Query: 454 LHSQKHLQYLNLLNSRISDIFPIRFLKSASQLKFLDVGLNQFHGKISN-LTKNTQLLFLS 512
           L S  +L  L L ++ +    P + L +   L+ + +  N F G++ +  TK        
Sbjct: 376 LCSSGNLFKLILFSNSLEGEIP-KSLGACRSLRRVRLQDNSFSGELPSEFTK-------- 426

Query: 513 VNSNNMSGPLPLVSSNLVYLDFSNNSFSGSISHFLCYRVNETKSLEGLKLTDNYLQGEIP 572
                    LPLV     +LD SNN+  G I+     R  +  SL+ L L  N   G +P
Sbjct: 427 ---------LPLVY----FLDISNNNLQGRINS----RKWDMPSLQMLSLARNKFFGGLP 469

Query: 573 DCWMSYQNLKVLKLSNNKFSGNLPNSLGSITSLVWLYLRKNRLSGKIPISLKNCTALASL 632
           D + S + L+ L LS N+FSG +P  LGS++ L+ L L +N+LSG+IP  L +C  L SL
Sbjct: 470 DSFGS-KRLENLDLSRNQFSGAVPRKLGSLSELMQLKLSENKLSGEIPDELSSCKKLVSL 528

Query: 633 DVDENEFVGNIPTWFGERFSRMLVLILRSNQFHGPLPKTICDLAFLQILDLADNNLSGAI 692
           D+  N+  G IP  F E    +  L L  NQ  G +PK + ++  L  ++++ N+L G++
Sbjct: 529 DLSHNQLSGQIPASFSE-MPVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHLHGSL 587

Query: 693 P 693
           P
Sbjct: 588 P 588


Length = 968

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|219766 pfam08263, LRRNT_2, Leucine rich repeat N-terminal domain Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227563 COG5238, RNA1, Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 840
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 100.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.97
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.97
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.96
KOG4237498 consensus Extracellular matrix protein slit, conta 99.9
KOG4237498 consensus Extracellular matrix protein slit, conta 99.89
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.88
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.88
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.87
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.87
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.81
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.8
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.74
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.7
KOG0617264 consensus Ras suppressor protein (contains leucine 99.69
KOG0617264 consensus Ras suppressor protein (contains leucine 99.69
PLN03150623 hypothetical protein; Provisional 99.51
PLN03150623 hypothetical protein; Provisional 99.38
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.35
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.31
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.27
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.25
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.17
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 99.13
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.13
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.11
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.1
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.08
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.03
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.99
PF0826343 LRRNT_2: Leucine rich repeat N-terminal domain; In 98.88
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.88
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.81
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.8
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.8
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.76
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.73
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.49
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.46
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.46
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.38
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.36
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.31
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.3
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.24
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.23
PRK15386 426 type III secretion protein GogB; Provisional 98.17
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.01
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.99
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.97
KOG4341483 consensus F-box protein containing LRR [General fu 97.84
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.83
PRK15386 426 type III secretion protein GogB; Provisional 97.8
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.67
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.65
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.62
KOG4341483 consensus F-box protein containing LRR [General fu 97.57
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.45
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.12
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.0
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.95
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.42
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.19
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.01
KOG1947482 consensus Leucine rich repeat proteins, some prote 95.94
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.73
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.41
KOG4308478 consensus LRR-containing protein [Function unknown 93.74
KOG4308478 consensus LRR-containing protein [Function unknown 93.64
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 92.62
KOG0473 326 consensus Leucine-rich repeat protein [Function un 92.13
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 91.34
KOG0473 326 consensus Leucine-rich repeat protein [Function un 89.41
smart0037026 LRR Leucine-rich repeats, outliers. 88.89
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 88.89
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 86.0
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 85.25
smart0037026 LRR Leucine-rich repeats, outliers. 84.7
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 84.7
KOG3864221 consensus Uncharacterized conserved protein [Funct 82.23
KOG3864221 consensus Uncharacterized conserved protein [Funct 82.0
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=100.00  E-value=2.5e-71  Score=677.77  Aligned_cols=583  Identities=36%  Similarity=0.572  Sum_probs=417.2

Q ss_pred             cHHHHHHHHHhhhcCCCCCCCCCCCCCCCCCccccceecCCCCCCEEEEEcCCCCCCCCCccccccccccccCCCCCCEE
Q 003200           32 LETERRALLRFKQDLQDPSNRLASWTGDGDCCTWAGVACGNVTGHILELNLRNPSTSNPRSMLVGKVNPALLDLKHLSYL  111 (840)
Q Consensus        32 ~~~~~~~ll~~k~~~~~~~~~l~~W~~~~~~c~w~gv~c~~~~~~v~~L~L~~~~~~~~~~~~~~~~~~~~~~l~~L~~L  111 (840)
                      .++|+.||++||+++.+|.+.+.+|..+.+||.|.||+|+. .++|+.|+|+++       .+.|.+++++..+++|++|
T Consensus        27 ~~~~~~~l~~~~~~~~~~~~~~~~w~~~~~~c~w~gv~c~~-~~~v~~L~L~~~-------~i~~~~~~~~~~l~~L~~L   98 (968)
T PLN00113         27 HAEELELLLSFKSSINDPLKYLSNWNSSADVCLWQGITCNN-SSRVVSIDLSGK-------NISGKISSAIFRLPYIQTI   98 (968)
T ss_pred             CHHHHHHHHHHHHhCCCCcccCCCCCCCCCCCcCcceecCC-CCcEEEEEecCC-------CccccCChHHhCCCCCCEE
Confidence            56899999999999988888899998778999999999985 579999999997       7788889999999999999


Q ss_pred             eCCCCCCCCCCcccccc-CCCCCcEEeccCCcccCCCCCCCCCCCCCCeEeccCccccCCCcccccCCCCCCEEEccCcC
Q 003200          112 DLSSNDFQGVQIPRFIG-SMRNLRYLNLSDTQFVGMIPPQLGNLSDLQFLDLSSNYLYVDNVWWLSGLSFLEHLDLRSVN  190 (840)
Q Consensus       112 ~Ls~n~~~~~~~p~~l~-~l~~L~~L~Ls~n~i~~~~p~~l~~l~~L~~L~Ls~n~~~~~~~~~~~~l~~L~~L~Ls~n~  190 (840)
                      +|++|.+.+. +|..+. .+++|++|+|++|++++.+|.  +.+++|++|++++|.+....+..++++++|++|++++|.
T Consensus        99 ~Ls~n~~~~~-ip~~~~~~l~~L~~L~Ls~n~l~~~~p~--~~l~~L~~L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~  175 (968)
T PLN00113         99 NLSNNQLSGP-IPDDIFTTSSSLRYLNLSNNNFTGSIPR--GSIPNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNV  175 (968)
T ss_pred             ECCCCccCCc-CChHHhccCCCCCEEECcCCccccccCc--cccCCCCEEECcCCcccccCChHHhcCCCCCEEECccCc
Confidence            9999999874 777654 899999999999999988875  467788888888877654444444444444444444443


Q ss_pred             CCCCcchhhhcCCCCCCCEEEcCCCCCCcCCCCCCCCCCcccCCCCCCEEECcCCCCCCCCcccccCCCCCcEEEcccCc
Q 003200          191 LSKASDWLMATNTLPSLLELRLSNCSLHHFPTLASPIPRGLQNLTSLKHLDLDSNHFNSSIPDWLYKFSPLECLNLRNNS  270 (840)
Q Consensus       191 l~~~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~l~~~l~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~L~~L~L~~n~  270 (840)
                      +.+                          ..      |..++++++|++|++++|.+.+.+|..++++++|++|++++|.
T Consensus       176 l~~--------------------------~~------p~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~  223 (968)
T PLN00113        176 LVG--------------------------KI------PNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNN  223 (968)
T ss_pred             ccc--------------------------cC------ChhhhhCcCCCeeeccCCCCcCcCChHHcCcCCccEEECcCCc
Confidence            322                          11      1445555555555555555555555555555555555555555


Q ss_pred             cccccchhhhcCCCCcEEecccccCccccCcccccCCCCCcEEEcCCCcccccchHHHHhhccCCCCCCCEEEccCCccc
Q 003200          271 LQGTISDAIGNLTSVSWLDLSINIGLQGRIPRSMANFCNLKSVNLRGVHLSQEISEILDIFSGCVSNGLESLDMRSSSIY  350 (840)
Q Consensus       271 l~~~~~~~l~~l~~L~~L~L~~n~~~~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~~L~~L~l~~n~l~  350 (840)
                      +++.+|..++++++|++|++++ +.+.+.+|..++++++|+.|+++                             +|.+.
T Consensus       224 l~~~~p~~l~~l~~L~~L~L~~-n~l~~~~p~~l~~l~~L~~L~L~-----------------------------~n~l~  273 (968)
T PLN00113        224 LSGEIPYEIGGLTSLNHLDLVY-NNLTGPIPSSLGNLKNLQYLFLY-----------------------------QNKLS  273 (968)
T ss_pred             cCCcCChhHhcCCCCCEEECcC-ceeccccChhHhCCCCCCEEECc-----------------------------CCeee
Confidence            5555555555555555555555 34444445444444444444444                             44444


Q ss_pred             ccCccccCCCCCCCEEEccCCcccccccccccCCCCCCEEEccCCccccccChhhhccCCCCCEEEccCcccceeccCCC
Q 003200          351 GHLTDQLGQFRNLVTLNLANNSIVGLIPESFGQLSTLRELQIYDNKLNGTLSEFHFANLTKLSWFRVGGNQLTFEVKHDW  430 (840)
Q Consensus       351 ~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~i~~~~~~~l~~L~~L~L~~n~l~~~~~~~~  430 (840)
                      +.+|..+..+++|++|++++|.+.+.+|..+.++++|+.|++++|.+.+.++. .+..+                     
T Consensus       274 ~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~l~~n~~~~~~~~-~~~~l---------------------  331 (968)
T PLN00113        274 GPIPPSIFSLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFTGKIPV-ALTSL---------------------  331 (968)
T ss_pred             ccCchhHhhccCcCEEECcCCeeccCCChhHcCCCCCcEEECCCCccCCcCCh-hHhcC---------------------
Confidence            44555555566666666666666666666666666777777766666544433 22222                     


Q ss_pred             CCccCccEEecccccCCCCCCccccCCCCCcEEEccCCCCCCCcchHHHhccCCccEEEccCcccccccccccCCCcccE
Q 003200          431 IPPFQLVALGLHNCYVGSRFPQWLHSQKHLQYLNLLNSRISDIFPIRFLKSASQLKFLDVGLNQFHGKISNLTKNTQLLF  510 (840)
Q Consensus       431 ~~~~~L~~L~l~~~~~~~~~~~~l~~l~~L~~L~Ls~n~i~~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~~~L~~  510 (840)
                                                 ++|+.|++++|++.+..|..+                                
T Consensus       332 ---------------------------~~L~~L~L~~n~l~~~~p~~l--------------------------------  352 (968)
T PLN00113        332 ---------------------------PRLQVLQLWSNKFSGEIPKNL--------------------------------  352 (968)
T ss_pred             ---------------------------CCCCEEECcCCCCcCcCChHH--------------------------------
Confidence                                       223333333333222222111                                


Q ss_pred             EEcccCcCCCCCCCCCCCCcEEEccCCcCcccCCchhhhccCCCCcccEEeccCCcCccccCccccCCCCcCEEEccCCc
Q 003200          511 LSVNSNNMSGPLPLVSSNLVYLDFSNNSFSGSISHFLCYRVNETKSLEGLKLTDNYLQGEIPDCWMSYQNLKVLKLSNNK  590 (840)
Q Consensus       511 L~l~~n~l~~~~~~~~~~L~~L~l~~n~~~~~~~~~~~~~~~~~~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~Ls~n~  590 (840)
                                                               ..+++|+.|++++|.+++.+|..+..+++|+.|++++|+
T Consensus       353 -----------------------------------------~~~~~L~~L~Ls~n~l~~~~p~~~~~~~~L~~L~l~~n~  391 (968)
T PLN00113        353 -----------------------------------------GKHNNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNS  391 (968)
T ss_pred             -----------------------------------------hCCCCCcEEECCCCeeEeeCChhHhCcCCCCEEECcCCE
Confidence                                                     112345555555555555555555556666666666666


Q ss_pred             CCCCCCcccCCCCcccEEEccCCcCcCCCCcccccCCCCcEEeCCCCcccccCChhhhhccCCccEEEccCCcccccCCc
Q 003200          591 FSGNLPNSLGSITSLVWLYLRKNRLSGKIPISLKNCTALASLDVDENEFVGNIPTWFGERFSRMLVLILRSNQFHGPLPK  670 (840)
Q Consensus       591 l~~~~~~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~ls~N~l~~~~p~~~~~~l~~L~~L~l~~n~l~~~~p~  670 (840)
                      +.+.+|..+..+++|+.|++++|++++..|..+.++++|+.|++++|.+++.+|..+. .+++|+.|++++|++.+.+|.
T Consensus       392 l~~~~p~~~~~~~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~~~~~~-~l~~L~~L~L~~n~~~~~~p~  470 (968)
T PLN00113        392 LEGEIPKSLGACRSLRRVRLQDNSFSGELPSEFTKLPLVYFLDISNNNLQGRINSRKW-DMPSLQMLSLARNKFFGGLPD  470 (968)
T ss_pred             ecccCCHHHhCCCCCCEEECcCCEeeeECChhHhcCCCCCEEECcCCcccCccChhhc-cCCCCcEEECcCceeeeecCc
Confidence            6666666666666666666666666666666666666777777777777666666655 567777777777777766666


Q ss_pred             cccCccccceeecccccccccCCccccccccCcccccccCcccccccCCcceEEeCCCCcccccCcccccCCCCCCeEeC
Q 003200          671 TICDLAFLQILDLADNNLSGAIPKCISNLTGMVTVKSFTGSVVYREILPLVSLLDISRNNFSGEILSEVTNLKALQSINF  750 (840)
Q Consensus       671 ~l~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~l~~~~~~~~~~~~~~~L~~L~Ls~N~l~~~~~~~l~~l~~L~~L~L  750 (840)
                      .+ ..++|+.|++++|++++.+|..+.++++|                   +.|++++|++++.+|..+.++++|++|+|
T Consensus       471 ~~-~~~~L~~L~ls~n~l~~~~~~~~~~l~~L-------------------~~L~Ls~N~l~~~~p~~~~~l~~L~~L~L  530 (968)
T PLN00113        471 SF-GSKRLENLDLSRNQFSGAVPRKLGSLSEL-------------------MQLKLSENKLSGEIPDELSSCKKLVSLDL  530 (968)
T ss_pred             cc-ccccceEEECcCCccCCccChhhhhhhcc-------------------CEEECcCCcceeeCChHHcCccCCCEEEC
Confidence            54 35788999999999998888888887777                   89999999999999999999999999999


Q ss_pred             CCCcccccCCcchhccCCCCeEeCCCCcccccCCccccCCCCCCeEeccCCcccccCCCCCcCCCcCcCCCCCC-CCCCC
Q 003200          751 SFNTFTGRIPESIGTMRALESVDFSVNQLSGEIPQSMSSLTFLNHLNLSNNNLTGKIPLSTQLQSFNASSFAGN-DLCGA  829 (840)
Q Consensus       751 s~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~ls~N~l~g~ip~~~~~~~~~~~~~~gn-~lcg~  829 (840)
                      ++|.+++.+|..++.+++|++|||++|+++|.+|..+..+++|++|++++|+++|.+|..++|.++.+++|.|| ++||.
T Consensus       531 s~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~l~ls~N~l~~~~p~~~~~~~~~~~~~~~n~~lc~~  610 (968)
T PLN00113        531 SHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHLHGSLPSTGAFLAINASAVAGNIDLCGG  610 (968)
T ss_pred             CCCcccccCChhHhCcccCCEEECCCCcccccCChhHhcCcccCEEeccCCcceeeCCCcchhcccChhhhcCCccccCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999 99986


Q ss_pred             C
Q 003200          830 P  830 (840)
Q Consensus       830 ~  830 (840)
                      +
T Consensus       611 ~  611 (968)
T PLN00113        611 D  611 (968)
T ss_pred             c
Confidence            5



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query840
3rgx_A768 Structural Insight Into Brassinosteroid Perception 1e-41
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 1e-41
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 2e-14
2omx_A462 Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX 8e-06
2id5_A477 Crystal Structure Of The Lingo-1 Ectodomain Length 9e-06
2omy_A461 Crystal Structure Of Inla S192n/hec1 Complex Length 1e-05
2z63_A570 Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 A 2e-05
2z63_A570 Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 A 2e-04
2omv_A461 Crystal Structure Of Inla S192n Y369s/hec1 Complex 2e-05
2omt_A462 Crystal Structure Of Inla G194s+sHEC1 COMPLEX Lengt 3e-05
2omz_A466 Crystal Structure Of Inla Y369a/hec1 Complex Length 4e-05
1o6s_A466 Internalin (Listeria Monocytogenes) E-Cadherin (Hum 4e-05
2omu_A462 Crystal Structure Of Inla G194s+s Y369s/hec1 Comple 5e-05
4g8a_A635 Crystal Structure Of Human Tlr4 Polymorphic Variant 1e-04
2z81_A549 Crystal Structure Of The Tlr1-tlr2 Heterodimer Indu 5e-04
4b8c_D 727 Nuclease Module Of The Yeast Ccr4-Not Complex Lengt 6e-04
3a79_A580 Crystal Structure Of Tlr2-Tlr6-Pam2csk4 Complex Len 6e-04
3fxi_A605 Crystal Structure Of The Human Tlr4-Human Md-2-E.Co 8e-04
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure

Iteration: 1

Score = 168 bits (426), Expect = 1e-41, Method: Compositional matrix adjust. Identities = 191/671 (28%), Positives = 289/671 (43%), Gaps = 85/671 (12%) Query: 230 GLQNLTSLKHLDLDSNHFNSSIPDW--LYKFSPLECLNLRNNSLQ--GTISDAIGNLTSV 285 G + SL LDL N + + L S L+ LN+ +N+L G +S + L S+ Sbjct: 95 GFKCSASLTSLDLSRNSLSGPVTTLTSLGSCSGLKFLNVSSNTLDFPGKVSGGL-KLNSL 153 Query: 286 SWLDLSIN-IGLQGRIPRSMANFC-NLKSVNLRGVHLSQEIS-------EILDIFSGCVS 336 LDLS N I + +++ C LK + + G +S ++ E LD+ S S Sbjct: 154 EVLDLSANSISGANVVGWVLSDGCGELKHLAISGNKISGDVDVSRCVNLEFLDVSSNNFS 213 Query: 337 NG---------LESLDMRSSSIYGHLTDQLGQFRNLVTLNLANNSIVGLIPESFGQLSTL 387 G L+ LD+ + + G + + L LN+++N VG IP L +L Sbjct: 214 TGIPFLGDCSALQHLDISGNKLSGDFSRAISTCTELKLLNISSNQFVGPIPPL--PLKSL 271 Query: 388 RELQIYDNKLNGTLSEFHFANLTKLSWFRVGGNQLTFEVKHDWIPPF------QLVALGL 441 + L + +NK G + +F L+ + GN + +PPF Sbjct: 272 QYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHF-----YGAVPPFFGSCSLLESLALS 326 Query: 442 HNCYVGSRFPQWLHSQKHLQYLNLLNSRISDIFPIRFLKSASQLKFLDVGLNQFHGKI-S 500 N + G L + L+ L+L + S P ++ L LD+ N F G I Sbjct: 327 SNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILP 386 Query: 501 NLTKNTQ--LLFLSVNSNNMSGPLPLVSSN---LVYLDFSNNSFSGSISHFLCYRVNETK 555 NL +N + L L + +N +G +P SN LV L S N SG+I L Sbjct: 387 NLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSL----GSLS 442 Query: 556 SLEGLKLTDNYLQGEIPDCWMSYQNLKVLKLSNNKFSGNLPNSLGSITSLVWLYLRKNRL 615 L LKL N L+GEIP M + L+ L L N +G +P+ L + T+L W+ L NRL Sbjct: 443 KLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRL 502 Query: 616 SGKIPISLKNCTALASLDVDENEFVGNIPTWFGERFSRMLVLILRSNQFHGPLPKTICDL 675 +G+IP + LA L + N F GNIP G+ S ++ L L +N F+G +P + Sbjct: 503 TGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRS-LIWLDLNTNLFNGTIPAAM--- 558 Query: 676 AFLQILDLADNNLSGAIPKCISNLTGMVTVKSFTGSV-----VYREILPLVS-------- 722 F Q +A N ++G I N GM G++ + E L +S Sbjct: 559 -FKQSGKIAANFIAGKRYVYIKN-DGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNIT 616 Query: 723 -------------------LLDISRNNFSGEILSEVTNLKALQSINFSFNTFTGRIPESI 763 LD+S N SG I E+ ++ L +N N +G IP+ + Sbjct: 617 SRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEV 676 Query: 764 GTMRALESVDFSVNQLSGEIPQSMXXXXXXXXXXXXXXXXTGKIPLSTQLQSFNASSFAG 823 G +R L +D S N+L G IPQ+M +G IP Q ++F + F Sbjct: 677 GDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEMGQFETFPPAKFLN 736 Query: 824 N-DLCGAPLPK 833 N LCG PLP+ Sbjct: 737 NPGLCGYPLPR 747
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|2OMX|A Chain A, Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2ID5|A Chain A, Crystal Structure Of The Lingo-1 Ectodomain Length = 477 Back     alignment and structure
>pdb|2OMY|A Chain A, Crystal Structure Of Inla S192n/hec1 Complex Length = 461 Back     alignment and structure
>pdb|2Z63|A Chain A, Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 570 Back     alignment and structure
>pdb|2Z63|A Chain A, Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 570 Back     alignment and structure
>pdb|2OMV|A Chain A, Crystal Structure Of Inla S192n Y369s/hec1 Complex Length = 461 Back     alignment and structure
>pdb|2OMT|A Chain A, Crystal Structure Of Inla G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMZ|A Chain A, Crystal Structure Of Inla Y369a/hec1 Complex Length = 466 Back     alignment and structure
>pdb|1O6S|A Chain A, Internalin (Listeria Monocytogenes) E-Cadherin (Human) Recognition Complex Length = 466 Back     alignment and structure
>pdb|2OMU|A Chain A, Crystal Structure Of Inla G194s+s Y369s/hec1 Complex Length = 462 Back     alignment and structure
>pdb|4G8A|A Chain A, Crystal Structure Of Human Tlr4 Polymorphic Variant D299g And T399i In Complex With Md-2 And Lps Length = 635 Back     alignment and structure
>pdb|2Z81|A Chain A, Crystal Structure Of The Tlr1-tlr2 Heterodimer Induced By Binding Of A Tri-acylated Lipopeptide Length = 549 Back     alignment and structure
>pdb|4B8C|D Chain D, Nuclease Module Of The Yeast Ccr4-Not Complex Length = 727 Back     alignment and structure
>pdb|3A79|A Chain A, Crystal Structure Of Tlr2-Tlr6-Pam2csk4 Complex Length = 580 Back     alignment and structure
>pdb|3FXI|A Chain A, Crystal Structure Of The Human Tlr4-Human Md-2-E.Coli Lps Ra Complex Length = 605 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query840
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 0.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-82
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-73
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-67
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-53
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-68
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-67
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-48
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-28
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-66
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-62
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-41
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-23
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 7e-05
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-66
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-49
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-30
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-18
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-15
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 8e-08
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 9e-58
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 6e-57
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 6e-56
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-49
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 9e-35
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 8e-33
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-28
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 7e-15
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-08
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-57
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-51
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-51
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-47
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-53
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-50
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-43
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-47
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-36
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-31
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-26
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-25
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-41
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-31
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-27
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-24
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-14
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-05
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-41
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-38
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-32
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-25
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-14
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-06
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-37
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-36
1o6v_A466 Internalin A; bacterial infection, extracellular r 6e-36
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-34
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-33
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-31
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-30
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-30
4fmz_A347 Internalin; leucine rich repeat, structural genomi 9e-30
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-08
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-30
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-21
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-20
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 9e-17
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-16
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-08
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-30
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-25
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-21
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 4e-17
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 3e-28
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-23
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 5e-21
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-18
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-27
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-25
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-24
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-24
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-22
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-19
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-16
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-14
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-13
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-27
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-26
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-25
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-24
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-23
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-20
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-09
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-08
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 8e-26
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-24
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-23
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-18
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-25
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-23
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 8e-22
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-21
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-18
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-16
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-16
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-10
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-09
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-05
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-24
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-24
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-21
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-19
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-18
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-11
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-08
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 7e-23
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-22
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-19
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 7e-19
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-17
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-17
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-06
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 9e-23
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 5e-21
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 4e-19
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-17
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 8e-11
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-09
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-08
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-21
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-19
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-17
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-14
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-14
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-19
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 7e-19
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 8e-19
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-18
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 9e-16
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-13
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-12
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-11
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-11
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-19
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-17
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 8e-15
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 5e-14
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 6e-14
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-13
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-08
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-05
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-19
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 9e-17
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-14
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-13
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 9e-11
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-10
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-19
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-19
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-17
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-10
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-10
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-09
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-19
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-17
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 7e-16
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-15
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 4e-15
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 7e-15
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-14
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-05
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 7e-19
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-17
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-13
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-12
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-11
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-10
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 7e-04
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 8e-19
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-18
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-18
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-18
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-15
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-06
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-18
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-17
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-16
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-15
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 7e-18
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 1e-16
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 1e-14
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 4e-14
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 3e-13
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 1e-10
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 7e-08
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-17
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 6e-17
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-16
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-12
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-12
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 9e-08
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-17
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 4e-16
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 1e-15
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 1e-14
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 5e-13
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 5e-12
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-16
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-15
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 7e-12
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-11
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 6e-16
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-14
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-14
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 6e-14
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-11
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-11
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 8e-10
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-05
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-15
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-13
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-13
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-13
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 6e-13
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-12
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-11
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-10
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-09
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 7e-08
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-06
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 8e-14
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-12
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-12
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-11
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-08
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-08
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 8e-07
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 6e-06
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 8e-14
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 6e-12
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-11
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-10
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 9e-09
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-05
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-13
4ezg_A197 Putative uncharacterized protein; internalin-A, le 8e-13
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 9e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-06
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-12
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 9e-12
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-09
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-08
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-06
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 6e-05
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-12
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-10
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 7e-10
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-09
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 9e-09
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-07
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 6e-07
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-11
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 6e-11
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-10
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 6e-08
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 8e-06
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-05
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-04
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 8e-11
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 8e-11
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-09
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 7e-09
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-08
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 8e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-04
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-10
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 6e-10
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 7e-10
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-09
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-08
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 5e-08
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 5e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 9e-05
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-10
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 6e-10
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-09
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 9e-06
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-05
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-04
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 3e-10
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 6e-09
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-09
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-08
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-07
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-06
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-05
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 2e-09
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 2e-05
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 1e-04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-09
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 6e-09
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-08
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 6e-08
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 8e-08
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 3e-04
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 4e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 6e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 7e-04
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 2e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 7e-06
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 1e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 9e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 4e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 9e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 6e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 8e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 4e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 7e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-05
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 8e-05
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-05
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-04
3m19_A251 Variable lymphocyte receptor A diversity region; a 4e-04
3m19_A251 Variable lymphocyte receptor A diversity region; a 5e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 9e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-04
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 2e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  556 bits (1434), Expect = 0.0
 Identities = 227/824 (27%), Positives = 351/824 (42%), Gaps = 98/824 (11%)

Query: 30  GCLETERRALLRFKQDLQDPSNRLASWTGDGDCCTWAGVACGNVTGHILELNLRNPSTSN 89
             L  E   L+ FK  L D  N L  W+ + + CT+ GV C +    +  ++L    +S 
Sbjct: 8   QSLYREIHQLISFKDVLPDK-NLLPDWSSNKNPCTFDGVTCRD--DKVTSIDL----SSK 60

Query: 90  PRSMLVGKVNPALLDLKHLSYLDLSSNDFQGVQIPRFIGSMRNLRYLNLSDTQFVGMIPP 149
           P ++    V+ +LL L  L  L LS++   G  +  F     +L  L+LS     G +  
Sbjct: 61  PLNVGFSAVSSSLLSLTGLESLFLSNSHING-SVSGF-KCSASLTSLDLSRNSLSGPVTT 118

Query: 150 --QLGNLSDLQFLDLSSNYL-YVDNVWWLSGLSFLEHLDLRSVNLSKA-SDWLMATNTLP 205
              LG+ S L+FL++SSN L +   V     L+ LE LDL + ++S A     + ++   
Sbjct: 119 LTSLGSCSGLKFLNVSSNTLDFPGKVSGGLKLNSLEVLDLSANSISGANVVGWVLSDGCG 178

Query: 206 SLLELRLSNCSLHHFPTLASPIPRGLQNLTSLKHLDLDSNHFNSSIPDWLYKFSPLECLN 265
            L  L +S   +         +   +    +L+ LD+ SN+F++ IP +L   S L+ L+
Sbjct: 179 ELKHLAISGNKIS------GDVD--VSRCVNLEFLDVSSNNFSTGIP-FLGDCSALQHLD 229

Query: 266 LRNNSLQGTISDAIGNLTSVSWLDLSINIGLQGRIPRSMANFCNLKSVNLRGVHLSQEIS 325
           +  N L G  S AI   T +  L++S N    G IP       +L+ ++L     + EI 
Sbjct: 230 ISGNKLSGDFSRAISTCTELKLLNISSN-QFVGPIPPL--PLKSLQYLSLAENKFTGEIP 286

Query: 326 EILDIFSGCVSNGLESLDMRSSSIYGHLTDQLGQFRNLVTLNLANNSIVGLIPESFGQLS 385
           + L                             G    L  L+L+ N   G +P  FG  S
Sbjct: 287 DFL----------------------------SGACDTLTGLDLSGNHFYGAVPPFFGSCS 318

Query: 386 TLRELQIYDNKLNGTLSEFHFANLTKLSWFRVGGNQLTFEVKHDWIPPFQLVALGLHNCY 445
            L  L +  N  +G L       +  L    +  N+ +       +P        L N  
Sbjct: 319 LLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFS-----GELPES------LTNL- 366

Query: 446 VGSRFPQWLHSQKHLQYLNLLNSRIS-DIFPIRFLKSASQLKFLDVGLNQFHGKI-SNLT 503
                         L  L+L ++  S  I P       + L+ L +  N F GKI   L+
Sbjct: 367 -----------SASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLS 415

Query: 504 KNTQLLFLSVNSNNMSGPLPLV---SSNLVYLDFSNNSFSGSISHFLCYRVNETKSLEGL 560
             ++L+ L ++ N +SG +P      S L  L    N   G I   L       K+LE L
Sbjct: 416 NCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELM----YVKTLETL 471

Query: 561 KLTDNYLQGEIPDCWMSYQNLKVLKLSNNKFSGNLPNSLGSITSLVWLYLRKNRLSGKIP 620
            L  N L GEIP    +  NL  + LSNN+ +G +P  +G + +L  L L  N  SG IP
Sbjct: 472 ILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIP 531

Query: 621 ISLKNCTALASLDVDENEFVGNIPTWFGERFSRMLVLILRSNQFHGPLPKTICDLAFLQI 680
             L +C +L  LD++ N F G IP    +         + +N   G     I +    + 
Sbjct: 532 AELGDCRSLIWLDLNTNLFNGTIPAAMFK-----QSGKIAANFIAGKRYVYIKNDGMKKE 586

Query: 681 LDLADN--NLSGAIPKCISNLTGMVTVK----SFTGSV-VYREILPLVSLLDISRNNFSG 733
              A N     G   + ++ L+           + G      +    +  LD+S N  SG
Sbjct: 587 CHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSG 646

Query: 734 EILSEVTNLKALQSINFSFNTFTGRIPESIGTMRALESVDFSVNQLSGEIPQSMSSLTFL 793
            I  E+ ++  L  +N   N  +G IP+ +G +R L  +D S N+L G IPQ+MS+LT L
Sbjct: 647 YIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTML 706

Query: 794 NHLNLSNNNLTGKIPLSTQLQSFNASSFAGND-LCGAPLPKNCT 836
             ++LSNNNL+G IP   Q ++F  + F  N  LCG PLP+   
Sbjct: 707 TEIDLSNNNLSGPIPEMGQFETFPPAKFLNNPGLCGYPLPRCDP 750


>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query840
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.98
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.98
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.97
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.97
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.96
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.96
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.96
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.96
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.95
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.95
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.95
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.95
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.95
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.95
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.95
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.95
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.94
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.94
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.94
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.93
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.93
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.93
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.93
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.93
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.93
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.93
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.92
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.92
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.92
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.91
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.91
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.91
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.91
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.9
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.9
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.9
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.89
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.89
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.89
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.88
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.88
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.88
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.88
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.87
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.87
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.87
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.86
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.86
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.86
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.86
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.83
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.83
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.83
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.82
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.82
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.81
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.8
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.79
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.77
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.77
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.77
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.77
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.76
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.76
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.75
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.75
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.75
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.74
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.73
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.73
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.72
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.71
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.71
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.71
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.7
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.7
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.69
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.67
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.66
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.64
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.62
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.61
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.61
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.6
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.59
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.58
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.55
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.55
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.52
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.5
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.48
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.48
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.47
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.46
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.45
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.43
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.42
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.41
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.36
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.36
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.32
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.27
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.2
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.2
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.14
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.13
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.87
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.84
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.83
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.78
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.44
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.4
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.38
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.31
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.9
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.86
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.38
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.91
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.67
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.59
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=1.5e-93  Score=850.42  Aligned_cols=710  Identities=30%  Similarity=0.445  Sum_probs=555.3

Q ss_pred             CCCcHHHHHHHHHhhhcCCCCCCCCCCCCCCCCCccccceecCCCCCCEEEEEcCCCCCCCCCcccccc---ccccccCC
Q 003200           29 VGCLETERRALLRFKQDLQDPSNRLASWTGDGDCCTWAGVACGNVTGHILELNLRNPSTSNPRSMLVGK---VNPALLDL  105 (840)
Q Consensus        29 ~~~~~~~~~~ll~~k~~~~~~~~~l~~W~~~~~~c~w~gv~c~~~~~~v~~L~L~~~~~~~~~~~~~~~---~~~~~~~l  105 (840)
                      +.+.++|++||++||+++.||. .+++|+.+++||.|+||+|+  +|||++|+|++.       .+.|.   +++++.++
T Consensus         7 ~~~~~~~~~all~~k~~~~~~~-~l~~W~~~~~~C~w~gv~C~--~~~v~~L~L~~~-------~l~g~~~~l~~~l~~L   76 (768)
T 3rgz_A            7 SQSLYREIHQLISFKDVLPDKN-LLPDWSSNKNPCTFDGVTCR--DDKVTSIDLSSK-------PLNVGFSAVSSSLLSL   76 (768)
T ss_dssp             -CCHHHHHHHHHHHHTTCSCTT-SSTTCCTTSCGGGSTTEEEE--TTEEEEEECTTS-------CCCEEHHHHHHHTTTC
T ss_pred             ccCCHHHHHHHHHHHhhCCCcc-cccCCCCCCCCcCCcceEEC--CCcEEEEECCCC-------CcCCccCccChhHhcc
Confidence            4557899999999999999988 89999888899999999998  689999999996       77888   99999999


Q ss_pred             CCCCEEeCCCCCCCCCCccccccCCCCCcEEeccCCcccCCCCC--CCCCCCCCCeEeccCccccCCCcccc-cCCCCCC
Q 003200          106 KHLSYLDLSSNDFQGVQIPRFIGSMRNLRYLNLSDTQFVGMIPP--QLGNLSDLQFLDLSSNYLYVDNVWWL-SGLSFLE  182 (840)
Q Consensus       106 ~~L~~L~Ls~n~~~~~~~p~~l~~l~~L~~L~Ls~n~i~~~~p~--~l~~l~~L~~L~Ls~n~~~~~~~~~~-~~l~~L~  182 (840)
                      ++|+.++++.+.+.  .+|..++.+++|++|+|++|.+.+.+|.  .++++++|++|++++|.+....+..+ .++++|+
T Consensus        77 ~~L~~l~~~~~~~~--~l~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~~~~~l~~L~  154 (768)
T 3rgz_A           77 TGLESLFLSNSHIN--GSVSGFKCSASLTSLDLSRNSLSGPVTTLTSLGSCSGLKFLNVSSNTLDFPGKVSGGLKLNSLE  154 (768)
T ss_dssp             TTCCEEECTTSCEE--ECCCCCCCCTTCCEEECCSSEEEEEGGGGGGGGGCTTCCEEECCSSEEECCSSCCSCCCCTTCS
T ss_pred             CcccccCCcCCCcC--CCchhhccCCCCCEEECCCCcCCCcCCChHHHhCCCCCCEEECcCCccCCcCCHHHhccCCCCC
Confidence            99999999999875  4678999999999999999999999998  99999999999999999876666554 8999999


Q ss_pred             EEEccCcCCCCCcchh-hhcCCCCCCCEEEcCCCCCCcCCCCCCCCCCcccCCCCCCEEECcCCCCCCCCcccccCCCCC
Q 003200          183 HLDLRSVNLSKASDWL-MATNTLPSLLELRLSNCSLHHFPTLASPIPRGLQNLTSLKHLDLDSNHFNSSIPDWLYKFSPL  261 (840)
Q Consensus       183 ~L~Ls~n~l~~~~~~~-~~~~~l~~L~~L~L~~n~l~~~~~~~~~l~~~l~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~L  261 (840)
                      +|++++|++++..... ..+.++++|++|++++|.+.+..+        +..+++|++|++++|.+.+.+|. ++++++|
T Consensus       155 ~L~Ls~n~l~~~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~--------~~~l~~L~~L~Ls~n~l~~~~~~-l~~l~~L  225 (768)
T 3rgz_A          155 VLDLSANSISGANVVGWVLSDGCGELKHLAISGNKISGDVD--------VSRCVNLEFLDVSSNNFSTGIPF-LGDCSAL  225 (768)
T ss_dssp             EEECCSSCCEEETHHHHHHTTCCTTCCEEECCSSEEESCCB--------CTTCTTCCEEECCSSCCCSCCCB-CTTCCSC
T ss_pred             EEECCCCccCCcCChhhhhhccCCCCCEEECCCCcccccCC--------cccCCcCCEEECcCCcCCCCCcc-cccCCCC
Confidence            9999999998754322 237889999999999999987643        47899999999999999988887 9999999


Q ss_pred             cEEEcccCccccccchhhhcCCCCcEEecccccCccccCcccccCCCCCcEEEcCCCcccccchHHHHhh-ccCCCCCCC
Q 003200          262 ECLNLRNNSLQGTISDAIGNLTSVSWLDLSINIGLQGRIPRSMANFCNLKSVNLRGVHLSQEISEILDIF-SGCVSNGLE  340 (840)
Q Consensus       262 ~~L~L~~n~l~~~~~~~l~~l~~L~~L~L~~n~~~~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~~~~~-~~~~~~~L~  340 (840)
                      ++|++++|.+++.+|..+..+++|++|++++ +.+.+.+|..  .+++|++|++++|.+.+.+|..+... +     +|+
T Consensus       226 ~~L~Ls~n~l~~~~~~~l~~l~~L~~L~Ls~-n~l~~~~~~~--~l~~L~~L~L~~n~l~~~ip~~~~~~~~-----~L~  297 (768)
T 3rgz_A          226 QHLDISGNKLSGDFSRAISTCTELKLLNISS-NQFVGPIPPL--PLKSLQYLSLAENKFTGEIPDFLSGACD-----TLT  297 (768)
T ss_dssp             CEEECCSSCCCSCHHHHTTTCSSCCEEECCS-SCCEESCCCC--CCTTCCEEECCSSEEEESCCCCSCTTCT-----TCS
T ss_pred             CEEECcCCcCCCcccHHHhcCCCCCEEECCC-CcccCccCcc--ccCCCCEEECcCCccCCccCHHHHhhcC-----cCC
Confidence            9999999999999999999999999999999 5777777664  66777777777776666555544332 2     566


Q ss_pred             EEEccCCcccccCccccCCCCCCCEEEccCCccccccccc-ccCCCCCCEEEccCCccccccChhhhccCC-CCCEEEcc
Q 003200          341 SLDMRSSSIYGHLTDQLGQFRNLVTLNLANNSIVGLIPES-FGQLSTLRELQIYDNKLNGTLSEFHFANLT-KLSWFRVG  418 (840)
Q Consensus       341 ~L~l~~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~-l~~l~~L~~L~L~~n~l~~~i~~~~~~~l~-~L~~L~L~  418 (840)
                      +|++++|++++.+|..++.+++|++|++++|.+.+.+|.. +.++++|++|++++|.+.+.+|. .+.+++ +|++|+++
T Consensus       298 ~L~Ls~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~ip~~~l~~l~~L~~L~Ls~n~l~~~~p~-~l~~l~~~L~~L~Ls  376 (768)
T 3rgz_A          298 GLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPE-SLTNLSASLLTLDLS  376 (768)
T ss_dssp             EEECCSSEEEECCCGGGGGCTTCCEEECCSSEEEEECCHHHHTTCTTCCEEECCSSEEEECCCT-THHHHTTTCSEEECC
T ss_pred             EEECcCCcCCCccchHHhcCCCccEEECCCCcccCcCCHHHHhcCCCCCEEeCcCCccCccccH-HHHhhhcCCcEEEcc
Confidence            6666666666666666666666666666666665544443 55566666666666666555554 344444 56666666


Q ss_pred             CcccceeccCCCCCccCccEEecccccCCCCCCccccCCCCCcEEEccCCCCCCCcchHHHhccCCccEEEccCcccccc
Q 003200          419 GNQLTFEVKHDWIPPFQLVALGLHNCYVGSRFPQWLHSQKHLQYLNLLNSRISDIFPIRFLKSASQLKFLDVGLNQFHGK  498 (840)
Q Consensus       419 ~n~l~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~l~~l~~L~~L~Ls~n~i~~~~~~~~~~~l~~L~~L~l~~n~l~~~  498 (840)
                      +|.+.+.....+..                      ..+++|++|++++|++++..|..+ ..+++|++|++++|.+.+.
T Consensus       377 ~N~l~~~~~~~~~~----------------------~~~~~L~~L~L~~n~l~~~~p~~l-~~l~~L~~L~Ls~N~l~~~  433 (768)
T 3rgz_A          377 SNNFSGPILPNLCQ----------------------NPKNTLQELYLQNNGFTGKIPPTL-SNCSELVSLHLSFNYLSGT  433 (768)
T ss_dssp             SSEEEEECCTTTTC----------------------STTCCCCEEECCSSEEEEECCGGG-GGCTTCCEEECCSSEEESC
T ss_pred             CCCcCCCcChhhhh----------------------cccCCccEEECCCCccccccCHHH-hcCCCCCEEECcCCcccCc
Confidence            66555444333332                      004455555555555554444433 3344455555555544443


Q ss_pred             ccc-ccCCCcccEEEcccCcCCCCCCCCCCCCcEEEccCCcCcccCCchhhhccCCCCcccEEeccCCcCccccCccccC
Q 003200          499 ISN-LTKNTQLLFLSVNSNNMSGPLPLVSSNLVYLDFSNNSFSGSISHFLCYRVNETKSLEGLKLTDNYLQGEIPDCWMS  577 (840)
Q Consensus       499 ~~~-~~~~~~L~~L~l~~n~l~~~~~~~~~~L~~L~l~~n~~~~~~~~~~~~~~~~~~~L~~L~Ls~n~l~~~~~~~~~~  577 (840)
                      ++. +...+                     +|++|++++|.+.+.+|..+    ..+++|++|++++|++++.+|..+.+
T Consensus       434 ~p~~l~~l~---------------------~L~~L~L~~n~l~~~~p~~~----~~l~~L~~L~L~~N~l~~~~p~~l~~  488 (768)
T 3rgz_A          434 IPSSLGSLS---------------------KLRDLKLWLNMLEGEIPQEL----MYVKTLETLILDFNDLTGEIPSGLSN  488 (768)
T ss_dssp             CCGGGGGCT---------------------TCCEEECCSSCCCSCCCGGG----GGCTTCCEEECCSSCCCSCCCGGGGG
T ss_pred             ccHHHhcCC---------------------CCCEEECCCCcccCcCCHHH----cCCCCceEEEecCCcccCcCCHHHhc
Confidence            332 22222                     33444444444444444332    33678888888888888888888888


Q ss_pred             CCCcCEEEccCCcCCCCCCcccCCCCcccEEEccCCcCcCCCCcccccCCCCcEEeCCCCcccccCChhhhhccCCccEE
Q 003200          578 YQNLKVLKLSNNKFSGNLPNSLGSITSLVWLYLRKNRLSGKIPISLKNCTALASLDVDENEFVGNIPTWFGERFSRMLVL  657 (840)
Q Consensus       578 l~~L~~L~Ls~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~ls~N~l~~~~p~~~~~~l~~L~~L  657 (840)
                      +++|++|++++|++++.+|..++.+++|++|++++|++++.+|..+.++++|++|++++|+++|.+|.+++ ....+..+
T Consensus       489 l~~L~~L~L~~N~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~g~ip~~~~-~~~~~~~~  567 (768)
T 3rgz_A          489 CTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMF-KQSGKIAA  567 (768)
T ss_dssp             CTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEEECCGGGGGCTTCCEEECCSSEEESBCCGGGG-TTTTCBCC
T ss_pred             CCCCCEEEccCCccCCcCChHHhcCCCCCEEECCCCcccCcCCHHHcCCCCCCEEECCCCccCCcCChHHh-cccchhhh
Confidence            88888888888888888888888888888888888888888888888888888888888888888888776 34444333


Q ss_pred             EccC---------C-------------cccccCCccccCccccceeecccccccccCCccccccccCcccccccCccccc
Q 003200          658 ILRS---------N-------------QFHGPLPKTICDLAFLQILDLADNNLSGAIPKCISNLTGMVTVKSFTGSVVYR  715 (840)
Q Consensus       658 ~l~~---------n-------------~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~l~~~~~~~~~~  715 (840)
                      ++..         +             .+.+..+..+..++.++.++++.|.+.|.+|..+..+++|             
T Consensus       568 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~~~~~g~~~~~~~~l~~L-------------  634 (768)
T 3rgz_A          568 NFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSM-------------  634 (768)
T ss_dssp             STTCSCEEEEEECCSCCTTCCSSEEEEECTTCCGGGGGGGGGTCCSCTTSCEEEEECCCSCSSSBCC-------------
T ss_pred             hccccccccccccccccccccccccccccccccchhhhccccccccccccceecccCchhhhccccc-------------
Confidence            3222         1             2445666777778888889999999999999999888877             


Q ss_pred             ccCCcceEEeCCCCcccccCcccccCCCCCCeEeCCCCcccccCCcchhccCCCCeEeCCCCcccccCCccccCCCCCCe
Q 003200          716 EILPLVSLLDISRNNFSGEILSEVTNLKALQSINFSFNTFTGRIPESIGTMRALESVDFSVNQLSGEIPQSMSSLTFLNH  795 (840)
Q Consensus       716 ~~~~~L~~L~Ls~N~l~~~~~~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~  795 (840)
                            +.|||++|+++|.+|..++++++|+.|+|++|+++|.+|..|+++++|++|||++|+++|.+|+.+..+++|++
T Consensus       635 ------~~LdLs~N~l~g~ip~~l~~l~~L~~L~Ls~N~l~g~ip~~l~~L~~L~~LdLs~N~l~g~ip~~l~~l~~L~~  708 (768)
T 3rgz_A          635 ------MFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTE  708 (768)
T ss_dssp             ------CEEECCSSCCBSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEECCCGGGGGCCCCSE
T ss_pred             ------cEEECcCCcccccCCHHHhccccCCEEeCcCCccCCCCChHHhCCCCCCEEECCCCcccCcCChHHhCCCCCCE
Confidence                  99999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EeccCCcccccCCCCCcCCCcCcCCCCCC-CCCCCCCCCCCCC
Q 003200          796 LNLSNNNLTGKIPLSTQLQSFNASSFAGN-DLCGAPLPKNCTM  837 (840)
Q Consensus       796 L~ls~N~l~g~ip~~~~~~~~~~~~~~gn-~lcg~~~~~~c~~  837 (840)
                      ||+++|+++|.||+.++|++|+..+|.|| +|||.|+. +|..
T Consensus       709 L~ls~N~l~g~iP~~~~~~~~~~~~~~gN~~Lcg~~l~-~C~~  750 (768)
T 3rgz_A          709 IDLSNNNLSGPIPEMGQFETFPPAKFLNNPGLCGYPLP-RCDP  750 (768)
T ss_dssp             EECCSSEEEEECCSSSSGGGSCGGGGCSCTEEESTTSC-CCCS
T ss_pred             EECcCCcccccCCCchhhccCCHHHhcCCchhcCCCCc-CCCC
Confidence            99999999999999999999999999999 99999997 8974



>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 840
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 9e-21
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 7e-14
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 6e-13
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-12
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-10
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 7e-15
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-14
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-12
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 8e-07
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-06
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-14
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-14
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-11
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-11
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-04
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 7e-04
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-13
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 3e-10
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 6e-10
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-09
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 3e-08
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 7e-08
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 3e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-09
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-08
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 6e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.001
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.002
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 4e-08
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 3e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 6e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.001
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 3e-07
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 5e-06
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 0.002
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 5e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.002
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 4e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 5e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.001
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.002
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 4e-05
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 2e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 6e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 7e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 5e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 2e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 4e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 5e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.003
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 3e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 4e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.002
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
 Score = 91.7 bits (226), Expect = 9e-21
 Identities = 68/307 (22%), Positives = 108/307 (35%), Gaps = 29/307 (9%)

Query: 31  CLETERRALLRFKQDLQDPSNRLASWTGDGDCC--TWAGVAC--GNVTGHILELNLRNPS 86
           C   +++ALL+ K+DL +P+  L+SW    DCC  TW GV C     T  +  L+L   +
Sbjct: 3   CNPQDKQALLQIKKDLGNPTT-LSSWLPTTDCCNRTWLGVLCDTDTQTYRVNNLDLSGLN 61

Query: 87  TSNPRSMLVGKVNPALLDLKHLSYLDLSSNDFQGVQIPRFIGSMRNLRYLNLSDTQFVGM 146
              P       +  +L +L +L++L +   +     IP  I  +  L YL ++ T   G 
Sbjct: 62  LPKPYP-----IPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGA 116

Query: 147 IPPQLGNLSDLQFLDLSSNYLYVDNVWWLSGLSFLEHLDLRSVNLSKASDWLMATNTLPS 206
           IP  L  +  L  LD S N L       +S L  L  +     N    +      +    
Sbjct: 117 IPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDG-NRISGAIPDSYGSFSKL 175

Query: 207 LLELRLSNCSLHHFPTLASPIPRGLQNLTSLKH----------------LDLDSNHFNSS 250
              + +S   L                  S                       + +  + 
Sbjct: 176 FTSMTISRNRLTGKIPPTFANLNLAFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAF 235

Query: 251 IPDWLYKFSPLECLNLRNNSLQGTISDAIGNLTSVSWLDLSINIGLQGRIPRSMANFCNL 310
               +     L  L+LRNN + GT+   +  L  +  L++S N  L G IP    N    
Sbjct: 236 DLGKVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFN-NLCGEIP-QGGNLQRF 293

Query: 311 KSVNLRG 317
                  
Sbjct: 294 DVSAYAN 300


>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query840
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.95
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.94
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.92
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.91
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.91
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.91
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.88
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.87
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.8
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.76
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.76
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.76
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.74
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.72
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.72
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.71
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.7
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.69
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.68
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.68
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.67
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.66
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.59
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.57
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.53
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.49
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.48
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.48
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.42
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.4
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.26
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.25
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.22
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.12
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.3
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.29
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.7
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.46
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.99
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.82
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=100.00  E-value=1.1e-38  Score=335.01  Aligned_cols=293  Identities=31%  Similarity=0.510  Sum_probs=202.1

Q ss_pred             CCcHHHHHHHHHhhhcCCCCCCCCCCCCCCCCCc--cccceecCCCC--CCEEEEEcCCCCCCCCCccccc--ccccccc
Q 003200           30 GCLETERRALLRFKQDLQDPSNRLASWTGDGDCC--TWAGVACGNVT--GHILELNLRNPSTSNPRSMLVG--KVNPALL  103 (840)
Q Consensus        30 ~~~~~~~~~ll~~k~~~~~~~~~l~~W~~~~~~c--~w~gv~c~~~~--~~v~~L~L~~~~~~~~~~~~~~--~~~~~~~  103 (840)
                      -|.++||+||++||+++.||. .+++|..++|||  .|+||+|+..+  +||++|+|+++       .+.|  .+|++++
T Consensus         2 ~c~~~e~~aLl~~k~~~~~~~-~l~sW~~~~d~C~~~w~gv~C~~~~~~~~v~~L~L~~~-------~l~g~~~lp~~l~   73 (313)
T d1ogqa_           2 LCNPQDKQALLQIKKDLGNPT-TLSSWLPTTDCCNRTWLGVLCDTDTQTYRVNNLDLSGL-------NLPKPYPIPSSLA   73 (313)
T ss_dssp             CSCHHHHHHHHHHHHHTTCCG-GGTTCCTTSCTTTTCSTTEEECCSSSCCCEEEEEEECC-------CCSSCEECCGGGG
T ss_pred             CCCHHHHHHHHHHHHHCCCCC-cCCCCCCCCCCCCCcCCCeEEeCCCCcEEEEEEECCCC-------CCCCCCCCChHHh
Confidence            499999999999999999875 699999889999  49999998643  48999999986       4554  5677777


Q ss_pred             CCCCCCEEeCCC-CCCCCCCccccccCCCCCcEEeccCCcccCCCCCCCCCCCCCCeEeccCccccCCCcccccCCCCCC
Q 003200          104 DLKHLSYLDLSS-NDFQGVQIPRFIGSMRNLRYLNLSDTQFVGMIPPQLGNLSDLQFLDLSSNYLYVDNVWWLSGLSFLE  182 (840)
Q Consensus       104 ~l~~L~~L~Ls~-n~~~~~~~p~~l~~l~~L~~L~Ls~n~i~~~~p~~l~~l~~L~~L~Ls~n~~~~~~~~~~~~l~~L~  182 (840)
                      ++++|++|||++ |.+.|. +|..++++++|++|+|++|++.+..|..+..+.+|+++++++|.+...            
T Consensus        74 ~L~~L~~L~Ls~~N~l~g~-iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l~l~~N~~~~~------------  140 (313)
T d1ogqa_          74 NLPYLNFLYIGGINNLVGP-IPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGT------------  140 (313)
T ss_dssp             GCTTCSEEEEEEETTEESC-CCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSEEESC------------
T ss_pred             cCccccccccccccccccc-cccccccccccchhhhccccccccccccccchhhhccccccccccccc------------
Confidence            777777777775 666663 777777777777777777777776666666666666666666543321            


Q ss_pred             EEEccCcCCCCCcchhhhcCCCCCCCEEEcCCCCCCcCCCCCCCCCCcccCCCCCCEEECcCCCCCCCCcccccCCCCC-
Q 003200          183 HLDLRSVNLSKASDWLMATNTLPSLLELRLSNCSLHHFPTLASPIPRGLQNLTSLKHLDLDSNHFNSSIPDWLYKFSPL-  261 (840)
Q Consensus       183 ~L~Ls~n~l~~~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~l~~~l~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~L-  261 (840)
                                                                  +|..+..+++|+++++++|.+.+.+|..+..+..+ 
T Consensus       141 --------------------------------------------~p~~l~~l~~L~~l~l~~n~l~~~ip~~~~~l~~l~  176 (313)
T d1ogqa_         141 --------------------------------------------LPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLF  176 (313)
T ss_dssp             --------------------------------------------CCGGGGGCTTCCEEECCSSCCEEECCGGGGCCCTTC
T ss_pred             --------------------------------------------CchhhccCcccceeeccccccccccccccccccccc
Confidence                                                        22566777777777777777777777777777665 


Q ss_pred             cEEEcccCccccccchhhhcCCCCcEEecccccCccccCcccccCCCCCcEEEcCCCcccccchHHHHhhccCCCCCCCE
Q 003200          262 ECLNLRNNSLQGTISDAIGNLTSVSWLDLSINIGLQGRIPRSMANFCNLKSVNLRGVHLSQEISEILDIFSGCVSNGLES  341 (840)
Q Consensus       262 ~~L~L~~n~l~~~~~~~l~~l~~L~~L~L~~n~~~~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~~L~~  341 (840)
                      +.+++++|++++..|..+..+..+ .+++.. +...+.+|..+..+++++.++++++.+.+.++                
T Consensus       177 ~~l~~~~n~l~~~~~~~~~~l~~~-~l~l~~-~~~~~~~~~~~~~~~~l~~l~~~~~~l~~~~~----------------  238 (313)
T d1ogqa_         177 TSMTISRNRLTGKIPPTFANLNLA-FVDLSR-NMLEGDASVLFGSDKNTQKIHLAKNSLAFDLG----------------  238 (313)
T ss_dssp             CEEECCSSEEEEECCGGGGGCCCS-EEECCS-SEEEECCGGGCCTTSCCSEEECCSSEECCBGG----------------
T ss_pred             cccccccccccccccccccccccc-cccccc-cccccccccccccccccccccccccccccccc----------------
Confidence            777788888877777777666544 577776 55666677777766666666666666554433                


Q ss_pred             EEccCCcccccCccccCCCCCCCEEEccCCcccccccccccCCCCCCEEEccCCccccccChhhhccCCCCCEEEccCcc
Q 003200          342 LDMRSSSIYGHLTDQLGQFRNLVTLNLANNSIVGLIPESFGQLSTLRELQIYDNKLNGTLSEFHFANLTKLSWFRVGGNQ  421 (840)
Q Consensus       342 L~l~~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~i~~~~~~~l~~L~~L~L~~n~  421 (840)
                                    .++.+++|+.|++++|++++.+|..|+++++|++|+|++|+++|.+|.  +.++++|+.+++++|+
T Consensus       239 --------------~~~~~~~L~~L~Ls~N~l~g~iP~~l~~L~~L~~L~Ls~N~l~g~iP~--~~~L~~L~~l~l~~N~  302 (313)
T d1ogqa_         239 --------------KVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQ--GGNLQRFDVSAYANNK  302 (313)
T ss_dssp             --------------GCCCCTTCCEEECCSSCCEECCCGGGGGCTTCCEEECCSSEEEEECCC--STTGGGSCGGGTCSSS
T ss_pred             --------------ccccccccccccCccCeecccCChHHhCCCCCCEEECcCCcccccCCC--cccCCCCCHHHhCCCc
Confidence                          234445555555555555555555555555555555555555555553  3455555555555554



>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure