Citrus Sinensis ID: 003205

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------84
MANVSVAAEWQLVYNRYYRKPELYQMRWKHIDLSRNKVACAPFGGPIAVIRDDSKIVQLYAESALRKLRIFNSAGVLISETVWKNPGGRLIGMSWSEDQTLICVVQDGTVYRYNIHAELIEPNASMGKECFEENVVECVFWGNGVVCVTEANRYFCMADFATMKVCELARPEVEELPHCVAVIEPKYTMTGSVEVLIGTDAGILMLDEDGVQKVDDTLSQKMAVSPNGNFVACFTHDGRLVVNNTNFSSPVIDESCESALPPEQIAWCGMDSVLLYWNDMLVMVAPQAEPVQYFYDEPLVLIPECDGVRILSNSSMEFLQRVPASTEQIFAIGSTSPAALLYDALDHFDRRSAKADENLRLIRASLPKAVEACIDAAGHEFDISRQRTLLRAASYGQAFCSNFQRDRIQEMCKTLRVLNAARDPEIGIPLSIQQYKSLTASVLIGRLINANCHLLALRISEYLGMNQEVVIMHWACSKITASLAIPDVTLLEILLDKLKLCKGISYAAVAAHADKSGRRKLAAMLVEHEPRSSKQVPLLLSIGEEDTALVKATESGDTDLVYLVIFHIWQKRPALEFFGMIQTRPLACDLFTVYARCYKHEFLKDFFLSTGQLQEVAFLLWKESWELGKNPMASNGSALHGPRIKRIEKAHSLFSETKEHTFESKAAEEHAKLLRIQHELEVSTKQAIFVDSSISDTIRTCIVLGNHRAAMKVKTEFKVSEKRWYWLKVFALATKRDWDALERFSKEKRPPIGYRPFVEACVDADEKGEALKYIPKLVDPRERAEAYARIGMAKEAADAASQAKDGELLGRLKLTFAQNAAASSIFDTLRDRLSFQGVS
cccccccccccccccEEEEEEEccccccccccccccEEEEcccccEEEEEEccccHHHHcccccccEEEEEccccccEEEEEcccccccEEEEEEccccEEEEEEEccEEEEEcccccccccccccccccccccEEEEEEEccEEEEEEcccEEEEEEcccccEEEEcccccccccccccEEEcccccccccEEEEEEEcccEEEEEccccEEEcccccEEEEEcccccEEEEEEEccEEEEEcccccccccccccccccccccEEEEcccEEEEEEccEEEEEccccccEEEEEcccEEEcccccccEEEccccEEEEEEccHHHHHHHccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHccccccccccHHHHHHccHHHHHHHHHHHccHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHccccccccHHHHHHHHHHHccHHHHHHHHcccccccccHHHHHcccccHHHHHHHHHcccHHHHHHHHHHHHHHccHHHHHHHHHccHHHHHHHHHHHHHccHHHHHHHHHHcccHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHcccccHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHHHHHHccccccccHHHHHHHHHcccHHHHHHHHcccccHHHHHHHHHHcccHHHHHHHHHHcccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccc
cccccccccHHHcccEEEEEEEEEccccccccHHccEEEEccccccEEEEEccccEEEEcccccccEEEEEEccccEEEEEccccccccEEEEEEccccEEEEEEcccEEEEEEcccccccccccccccHHcccEEEEEEEccEEEEEEcccEEEEEEcccccccccccccccccccccEEEEcccccccccEEEEEEEccEEEEEEcccccccccccEEEEEEcccccEEEEEEcccEEEEEEcccccEEEEccccccccccEEEEccccEEEEEEccEEEEEcccccEEEEEccccEEEEEccccEEEEccccEEEHEEccHHHHHHEccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccccccccHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccccccHHHHHHHHHHccHHHHHHHHHHHcccHHHHHHHHHcccHHHHHHHHHHHcccHHHHHHHHHHHHHcccHHHHHHHHHHcHHHHHHHHHHHHHccHHHHHHHHHccccHHHHHHHHHHHHHHcccccHHHccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHcccHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHHHHHHccccccccHHHHHHHHHcccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHccccHHHHHHHHHHHHHcccccc
MANVSVAAEWQLVYNRyyrkpelyQMRWKHIdlsrnkvacapfggpiavirddsKIVQLYAESALRKLRIFNSAGVLisetvwknpggrligmswsedQTLICVVqdgtvyrynihaeliepnasmgkecfeENVVECVFWGNGVVCVTEANRYFCMADFATMKVCELarpeveelphcvaviepkytmtGSVEVLIGTdagilmldedgvqkvddtlsqkmavspngnfvacfthdgrlvvnntnfsspvidescesalppeqiawcgmdSVLLYWNDMLVMvapqaepvqyfydeplvlipecdgvrilsnSSMEflqrvpasteQIFAIGSTSPAALLYDALDHFDRRSAKADENLRLIRASLPKAVEACIDAAGHEFDISRQRTLLRAASYGQAFCSNFQRDRIQEMCKTLRVLnaardpeigiplSIQQYKSLTASVLIGRLINANCHLLALRISEYLGMNQEVVIMHWACSKitaslaipdVTLLEILLDKLKLCKGISYAAVAAHADKSGRRKLAAMLVEheprsskqvpLLLSIGEEDTALVKatesgdtdLVYLVIFHIWqkrpaleffgmiqtrplacDLFTVYARCYKHEFLKDFFLSTGQLQEVAFLLWKESWelgknpmasngsalhgpriKRIEKAHSLFSetkehtfeSKAAEEHAKLLRIQHELEVSTKQAIFVDSSISDTIRTCIVLGNHRAAMKVKTEFKVSEKRWYWLKVFALATKRDWDALERfskekrppigyrpfveACVDADEKGealkyipklvdprERAEAYARIGMAKEAADAASQAKDGELLGRLKLTFAQNAAASSIFDTLRDrlsfqgvs
MANVSVAAEWQLVYNRYYRKPELYQMRWKHIDLSRNKVACAPFGGpiavirddsKIVQLYAESALRKLRIFNSAGVLISETVWKNPGGRLIGMSWSEDQTLICVVQDGTVYRYNIHAELIEPNASMGKECFEENVVECVFWGNGVVCVTEANRYFCMADFATMKVCELARPEVEELPHCVAVIEPKYTMTGSVEVLIGTDAGILMLDEDGVQKVDDTLSQKMAVSPNGNFVACFTHDGRLVVNNTNFSSPVIDESCESALPPEQIAWCGMDSVLLYWNDMLVMVAPQAEPVQYFYDEPLVLIPECDGVRILSNSSMEFLQRVPASTEQIFAIGSTSPAALLYDALDHFDRRSAKADENLRLIRASLPKAVEACIDAAGHEFDISRQRTLLRAASYGQAFCSNFQRDRIQEMCKTLRVLNAARDPEIGIPLSIQQYKSLTASVLIGRLINANCHLLALRISEYLGMNQEVVIMHWACSKITASLAIPDVTLLEILLDKLKLCKGISYAAVAAHADKSGRRKLAAMLVEheprsskqvplLLSIGEEDTALVKATESGDTDLVYLVIFHIWQKRPALEFFGMIQTRPLACDLFTVYARCYKHEFLKDFFLSTGQLQEVAFLLWKESWELGKNPmasngsalhgprIKRIEKAHSLFSETKEHTFESKAAEEHAKLLRIQHELEVSTKQaifvdssisdtIRTCIVLgnhraamkvktefkvsekrWYWLKVFALATKRDWDALERfskekrppigyrpfVEACVDADEKGEalkyipklvdpreRAEAYARIGMAKEAADAASQAKDGELLGRLKLTFAQNAAASSIFDTLRDrlsfqgvs
MANVSVAAEWQLVYNRYYRKPELYQMRWKHIDLSRNKVACAPFGGPIAVIRDDSKIVQLYAESALRKLRIFNSAGVLISETVWKNPGGRLIGMSWSEDQTLICVVQDGTVYRYNIHAELIEPNASMGKecfeenvvecvfWGNGVVCVTEANRYFCMADFATMKVCELARPEVEELPHCVAVIEPKYTMTGSVEVLIGTDAGILMLDEDGVQKVDDTLSQKMAVSPNGNFVACFTHDGRLVVNNTNFSSPVIDESCESALPPEQIAWCGMDSVLLYWNDMLVMVAPQAEPVQYFYDEPLVLIPECDGVRILSNSSMEFLQRVPASTEQIFAIGSTSPAALLYDALDHFDRRSAKADENLRLIRASLPKAVEACIDAAGHEFDISRQRTLLRAASYGQAFCSNFQRDRIQEMCKTLRVLNAARDPEIGIPLSIQQYKSLTASVLIGRLINANCHLLALRISEYLGMNQEVVIMHWACSKITASLAIPDVTlleilldklklckGISYAAVAAHADKSGRRKLAAMLVEHEPRSSKQVPLLLSIGEEDTALVKATESGDTDLVYLVIFHIWQKRPALEFFGMIQTRPLACDLFTVYARCYKHEFLKDFFLSTGQLQEVAFLLWKESWELGKNPMASNGSALHGPRIKRIEKAHSLFSETKEHTFESKAAEEHAKLLRIQHELEVSTKQAIFVDSSISDTIRTCIVLGNHRAAMKVKTEFKVSEKRWYWLKVFALATKRDWDALERFSKEKRPPIGYRPFVEACVDADEKGEALKYIPKLVDPRERAEAYARIGMakeaadaasqakdGELLGRLKLTFAQNAAASSIFDTLRDRLSFQGVS
****SVAAEWQLVYNRYYRKPELYQMRWKHIDLSRNKVACAPFGGPIAVIRDDSKIVQLYAESALRKLRIFNSAGVLISETVWKNPGGRLIGMSWSEDQTLICVVQDGTVYRYNIHAELIEPNASMGKECFEENVVECVFWGNGVVCVTEANRYFCMADFATMKVCELARPEVEELPHCVAVIEPKYTMTGSVEVLIGTDAGILMLDEDGVQKVDDTLSQKMAVSPNGNFVACFTHDGRLVVNNTNFSSPVIDESCESALPPEQIAWCGMDSVLLYWNDMLVMVAPQAEPVQYFYDEPLVLIPECDGVRILSNSSMEFLQRVPASTEQIFAIGSTSPAALLYDALDHFDRRSAKADENLRLIRASLPKAVEACIDAAGHEFDI************************IQEMCKTLRVLNAARDPEIGIPLSIQQYKSLTASVLIGRLINANCHLLALRISEYLGMNQEVVIMHWACSKITASLAIPDVTLLEILLDKLKLCKGISYAAVAAHA************************LLLSIGEEDTALVKATESGDTDLVYLVIFHIWQKRPALEFFGMIQTRPLACDLFTVYARCYKHEFLKDFFLSTGQLQEVAFLLWKESWELG*******************************************KLLRIQHELEVSTKQAIFVDSSISDTIRTCIVLGNHRAAMKVKTEFKVSEKRWYWLKVFALATKRDWDALERFSKEKRPPIGYRPFVEACVDADEKGEALKYIPKLVD******AYARI*****************LLGRLKLTFAQNAAASSIFDTL**********
****SVA*EWQLVYNRYYRKPELYQMRWKHIDLSRNKVACAPFGGPIAVIRDDSKIVQLYAESALRKLRIFNSAGVLISETVWKNPGGRLIGMSWSEDQTLICVVQDGTVYRYNIHAELIEPNAS**KECFEENVVECVFWGNGVVCVTEANRYFCMADFATMKVCELARPEVEELPHCVAVIEPKYTMTGSVEVLIGTDAGILMLDEDGVQKVDDTLSQKMAVSPNGNFVACFTHDGRLVVNNTNFSSPVIDESCESALPPEQIAWCGMDSVLLYWNDMLVMVAPQAEPVQYFYDEPLVLIPECDGVRILSNSSMEFLQRVPASTEQIFAIGSTSPAALLYDALDHFDRRSAKADENLRLIRASLPKAVEACIDAAGHEFDISRQRTLLRAASYGQAFCSNFQRDRIQEMCKTLRVLNAARDPEIGIPLSIQQYKSLTASVLIGRLINANCHLLALRISEYLGMNQEVVIMHWACSKI**********LLEILLDKLKLCKGISYAAVAAHADKSGRRKLAAMLVEHEPRSSKQVPLLLSIGEEDTALVKATESGDTDLVYLVIFHIWQKRPALEFFGMIQTRPLACDLFTVYARCYKHEFLKDFFLSTGQLQEVAFLLWKESWELGKN***********PRIKRIEKA***FSETKEHTFESKAAEEHAKLLRIQHELEV******FVDSSISDTIRTCIVLGNHRAAMKVKTEFKVSEKRWYWLKVFALATKRDWDALERFSKEKRPPIGYRPFVEACVDADEKGEALKYIPKLVDPRERAEAYARIGMAKEAADAASQAKDGELLGRLKL*************TLRDRLSFQ***
MANVSVAAEWQLVYNRYYRKPELYQMRWKHIDLSRNKVACAPFGGPIAVIRDDSKIVQLYAESALRKLRIFNSAGVLISETVWKNPGGRLIGMSWSEDQTLICVVQDGTVYRYNIHAELIEPNASMGKECFEENVVECVFWGNGVVCVTEANRYFCMADFATMKVCELARPEVEELPHCVAVIEPKYTMTGSVEVLIGTDAGILMLDEDGVQKVDDTLSQKMAVSPNGNFVACFTHDGRLVVNNTNFSSPVIDESCESALPPEQIAWCGMDSVLLYWNDMLVMVAPQAEPVQYFYDEPLVLIPECDGVRILSNSSMEFLQRVPASTEQIFAIGSTSPAALLYDALDHFDRRSAKADENLRLIRASLPKAVEACIDAAGHEFDISRQRTLLRAASYGQAFCSNFQRDRIQEMCKTLRVLNAARDPEIGIPLSIQQYKSLTASVLIGRLINANCHLLALRISEYLGMNQEVVIMHWACSKITASLAIPDVTLLEILLDKLKLCKGISYAAVAAHADKSGRRKLAAMLVEHEPRSSKQVPLLLSIGEEDTALVKATESGDTDLVYLVIFHIWQKRPALEFFGMIQTRPLACDLFTVYARCYKHEFLKDFFLSTGQLQEVAFLLWKESWELGKNPMASNGSALHGPRIKRIEKAHSLFSETKEHTFESKAAEEHAKLLRIQHELEVSTKQAIFVDSSISDTIRTCIVLGNHRAAMKVKTEFKVSEKRWYWLKVFALATKRDWDALERFSKEKRPPIGYRPFVEACVDADEKGEALKYIPKLVDPRERAEAYARIG***********AKDGELLGRLKLTFAQNAAASSIFDTLRDRLSFQGVS
*****VAAEWQLVYNRYYRKPELYQMRWKHIDLSRNKVACAPFGGPIAVIRDDSKIVQLYAESALRKLRIFNSAGVLISETVWKNPGGRLIGMSWSEDQTLICVVQDGTVYRYNIHAELIEPNASMGKECFEENVVECVFWGNGVVCVTEANRYFCMADFATMKVCELARPEVEELPHCVAVIEPKYTMTGSVEVLIGTDAGILMLDEDGVQKVDDTLSQKMAVSPNGNFVACFTHDGRLVVNNTNFSSPVIDESCESALPPEQIAWCGMDSVLLYWNDMLVMVAPQAEPVQYFYDEPLVLIPECDGVRILSNSSMEFLQRVPASTEQIFAIGSTSPAALLYDALDHFDRRSAKADENLRLIRASLPKAVEACIDAAGHEFDISRQRTLLRAASYGQAFCSNFQRDRIQEMCKTLRVLNAARDPEIGIPLSIQQYKSLTASVLIGRLINANCHLLALRISEYLGMNQEVVIMHWACSKITASLAIPDVTLLEILLDKLKLCKGISYAAVAAHADKSGRRKLAAMLVEHEPRSSKQVPLLLSIGEEDTALVKATESGDTDLVYLVIFHIWQKRPALEFFGMIQTRPLACDLFTVYARCYKHEFLKDFFLSTGQLQEVAFLLWKESWELGKNPMASNGSALHGPRIKRIEKAHSLFSETKEHTFESKAAEEHAKLLRIQHELEVSTKQAIFVDSSISDTIRTCIVLGNHRAAMKVKTEFKVSEKRWYWLKVFALATKRDWDALERFSKEKRPPIGYRPFVEACVDADEKGEALKYIPKLVDPRERAEAYARIGMAKEAADAASQAKDGELLGRLKLTFAQNAAASSIFDTLRDRLSF****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MANVSVAAEWQLVYNRYYRKPELYQMRWKHIDLSRNKVACAPFGGPIAVIRDDSKIVQLYAESALRKLRIFNSAGVLISETVWKNPGGRLIGMSWSEDQTLICVVQDGTVYRYNIHAELIEPNASMGKECFEENVVECVFWGNGVVCVTEANRYFCMADFATMKVCELARPEVEELPHCVAVIEPKYTMTGSVEVLIGTDAGILMLDEDGVQKVDDTLSQKMAVSPNGNFVACFTHDGRLVVNNTNFSSPVIDESCESALPPEQIAWCGMDSVLLYWNDMLVMVAPQAEPVQYFYDEPLVLIPECDGVRILSNSSMEFLQRVPASTEQIFAIGSTSPAALLYDALDHFDRRSAKADENLRLIRASLPKAVEACIDAAGHEFDISRQRTLLRAASYGQAFCSNFQRDRIQEMCKTLRVLNAARDPEIGIPLSIQQYKSLTASVLIGRLINANCHLLALRISEYLGMNQEVVIMHWACSKITASLAIPDVTLLEILLDKLKLCKGISYAAVAAHADKSGRRKLAAMLVEHEPRSSKQVPLLLSIGEEDTALVKATESGDTDLVYLVIFHIWQKRPALEFFGMIQTRPLACDLFTVYARCYKHEFLKDFFLSTGQLQEVAFLLWKESWELGKNPMASNGSALHGPRIKRIEKAHSLFSETKEHTFESKAAEEHAKLLRIQHELEVSTKQAIFVDSSISDTIRTCIVLGNHRAAMKVKTEFKVSEKRWYWLKVFALATKRDWDALERFSKEKRPPIGYRPFVEACVDADEKGEALKYIPKLVDPRERAEAYARIGMAKEAADAASQAKDGELLGRLKLTFAQNAAASSIFDTLRDRLSFQGVS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query839 2.2.26 [Sep-21-2011]
Q55C58832 Vacuolar protein sorting- yes no 0.934 0.942 0.376 1e-158
Q920Q4839 Vacuolar protein sorting- yes no 0.934 0.934 0.346 1e-123
Q9H269839 Vacuolar protein sorting- yes no 0.914 0.914 0.350 1e-121
Q5E9L7839 Vacuolar protein sorting- yes no 0.911 0.911 0.352 1e-121
Q9UT38835 Probable vacuolar protein yes no 0.954 0.959 0.298 1e-102
Q03308798 Vacuolar protein sorting- yes no 0.687 0.723 0.261 1e-40
Q11182852 Vacuolar protein sorting- yes no 0.812 0.800 0.232 4e-27
Q60V75858 Vacuolar protein sorting- N/A no 0.820 0.801 0.236 5e-27
>sp|Q55C58|VPS16_DICDI Vacuolar protein sorting-associated protein 16 homolog OS=Dictyostelium discoideum GN=vps16 PE=3 SV=2 Back     alignment and function desciption
 Score =  558 bits (1439), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 312/828 (37%), Positives = 489/828 (59%), Gaps = 44/828 (5%)

Query: 6   VAAEWQLVYNRYYRKPELYQMRWKHIDLSRNKVACAPFGGPIAVIRDDSKIVQLYAESAL 65
           +AA+W+++ N  Y K E+Y M W  +DL +     +PF GPIAV+RD SK V++ +++  
Sbjct: 2   IAAQWKIIGNSTYIKKEIYSMSW-DVDLKQQVSVGSPFAGPIAVMRDSSKFVEMNSQNMK 60

Query: 66  RKLRIFNSAGVLISETVWKNPGGRLIGMSWSEDQTLICVVQDGTVYRYNIHAELIEPNAS 125
             L+IF ++G LIS+ +W +    ++ M W E + L+ V+Q+ TV  +N+  E +    S
Sbjct: 61  PYLKIFTASGDLISQMIW-DSSKNIVAMDWIEKERLVIVLQNATVLIFNVFCEQMT-QFS 118

Query: 126 MGKECFEENVVECVFWGNGVVCVTEANRYFC---MADFATMKVCELARPEVEELPHCV-- 180
           +G    EE ++EC  W +G+V +T A++ +    + DF       +  P + E P     
Sbjct: 119 LGDIVREEEILECKIWSDGIVVLTSASQLYSVPSINDFFVESGRVIRLPPLPEEPKARPE 178

Query: 181 -AVIEPKYTMTGSVEVLIGTDAGILMLDEDGVQKVDDTLS--QKMAVSPNGNFVACFTHD 237
            A++EP+++++ S+E+ +  +  + ++DED V+   +     QKM VSP G  +ACF   
Sbjct: 179 WAILEPQFSLSQSIEIFMSINGTLYLIDEDKVESQLEATEPIQKMVVSPCGKKLACFDTK 238

Query: 238 GRLVVNNTNFSSPVIDESCESALPPEQIAWCGMDSVLLYWNDMLVMVAPQAEPVQYFY-- 295
           G L++  T+ S+   D     A     + WCG D V++YW+ +        +P+ +++  
Sbjct: 239 GTLLILKTDGSTTNPDRMDTKATKSPVLKWCGSDGVMMYWDSI-------KDPILFYFSK 291

Query: 296 ---------DEPLVLIPECDGVRILSNSSMEFLQRVPASTEQIFAIGSTSPAALLYDALD 346
                    D+P+ L+ E DG+RI+S+++ EF  +V   T  IF IG+TSPA++LYDA D
Sbjct: 292 GDSWAKFTLDQPVSLVTEIDGLRIISDTTSEFFHKVSDVTIDIFKIGTTSPASILYDATD 351

Query: 347 HFDRRSAKADENLRLIRASLPKAVEACIDAAGHEFDISRQRTLLRAASYGQAFCSNFQRD 406
           HF  +S +ADE++R I   L  AV  CI AAG EF+   Q  LL+AAS+G+ F  N+   
Sbjct: 352 HFISKSPQADESIRSINDQLEDAVNDCILAAGFEFNGGEQSKLLKAASFGKCFLENYNPS 411

Query: 407 RIQEMCKTLRVLNAARDPEIGIPLSIQQYKSLTASVLIGRLINANCHLLALRISEYLGMN 466
           +   MC++LRVLNA R  EIGIPLSI+QY  +    LI RLI+   HLLA RI +YL + 
Sbjct: 412 QFVTMCRSLRVLNAVRHHEIGIPLSIKQYYHIGIEELIDRLISRRKHLLAWRICDYLKIK 471

Query: 467 QEVVIMHWACSKITASLAIPDVTLLEILLDKLKLCKGISYAAVAAHADKSGRRKLAAMLV 526
            +VV+ HWAC+K+     IPD  L +I++ KL+   GIS+A +A+ A  +GR KLA  L+
Sbjct: 472 SDVVLNHWACTKVRTD--IPDQELGKIIIKKLESVPGISFANIASAAYLAGRSKLATKLL 529

Query: 527 EHEPRSSKQVPLLLSIGEEDTALVKATESGDTDLVYLVIFHIWQKRPALEFFGMIQTRPL 586
           E+EP++++QVP L+ +GE   AL KA ESGDTDLVYLV+  + +  P  +F  +  ++ +
Sbjct: 530 EYEPKAAEQVPPLIKMGESGLALNKAIESGDTDLVYLVLLAMQRSLPLADFLELTFSKVV 589

Query: 587 ACDLFTVYARCYKHEF--LKDFFLSTGQLQEVAFLLWKESWELGKNPMASNGSALHGPRI 644
           A DL     +  K++F  L++ +    Q +E+  +  +E+       ++S+ S L   RI
Sbjct: 590 ALDLLISMCK-QKNDFPLLREIYHIKDQSKEMGNIYLQEA-------LSSHPSQLDQ-RI 640

Query: 645 KRIEKA--HSLFSETKEHTFESKAAEEHAKLLRIQHELEVSTKQAIFVDSSISDTIRTCI 702
           K   K+  H   S+ K+    SK  ++  KL  +Q ELE + +   FV  SI+DTI   I
Sbjct: 641 KAYNKSIEHYHHSKDKDDQATSKFIDDQIKLEMLQKELETNLQDESFVGISINDTIYKLI 700

Query: 703 VLGNHRAAMKVKTEFKVSEKRWYWLKVFALATKRDWDALERFSKEKRPPIGYRPFVEACV 762
            +   + A  +++EFKV +KR++W+K+ AL+   DW+ L +FSKEK+ PIGY PFVE C+
Sbjct: 701 TMNQPKKAQSIRSEFKVPDKRFWWIKIKALSIMNDWEELMKFSKEKKSPIGYEPFVEVCL 760

Query: 763 DADEKGEALKYIPKLVDPRERAEAYARIGMAKEAADAASQAKDGELLG 810
           D   + EALKYIPK+ D   + + Y +IG  +EAAD A + K+ +LL 
Sbjct: 761 DQKNQIEALKYIPKITDILPKIQFYIQIGYFREAADIAFKEKNFDLLN 808
May play a role in vesicle-mediated protein trafficking to endosomal/lysosomal compartments and in membrane docking/fusion reactions.
Dictyostelium discoideum (taxid: 44689)
>sp|Q920Q4|VPS16_MOUSE Vacuolar protein sorting-associated protein 16 homolog OS=Mus musculus GN=Vps16 PE=1 SV=3 Back     alignment and function description
>sp|Q9H269|VPS16_HUMAN Vacuolar protein sorting-associated protein 16 homolog OS=Homo sapiens GN=VPS16 PE=1 SV=2 Back     alignment and function description
>sp|Q5E9L7|VPS16_BOVIN Vacuolar protein sorting-associated protein 16 homolog OS=Bos taurus GN=VPS16 PE=2 SV=1 Back     alignment and function description
>sp|Q9UT38|VPS16_SCHPO Probable vacuolar protein sorting-associated protein 16 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vps16 PE=3 SV=1 Back     alignment and function description
>sp|Q03308|VPS16_YEAST Vacuolar protein sorting-associated protein 16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS16 PE=1 SV=2 Back     alignment and function description
>sp|Q11182|VPS16_CAEEL Vacuolar protein sorting-associated protein 16 homolog OS=Caenorhabditis elegans GN=vps-16 PE=3 SV=2 Back     alignment and function description
>sp|Q60V75|VPS16_CAEBR Vacuolar protein sorting-associated protein 16 homolog OS=Caenorhabditis briggsae GN=vps-16 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query839
224082574844 predicted protein [Populus trichocarpa] 0.998 0.992 0.826 0.0
225446811838 PREDICTED: vacuolar protein sorting-asso 0.994 0.995 0.843 0.0
356567439843 PREDICTED: vacuolar protein sorting-asso 0.997 0.992 0.814 0.0
449453776844 PREDICTED: vacuolar protein sorting-asso 1.0 0.994 0.815 0.0
356526977843 PREDICTED: vacuolar protein sorting-asso 0.997 0.992 0.811 0.0
255571398851 vacuolar protein sorting vps16, putative 0.997 0.983 0.812 0.0
224066557844 predicted protein [Populus trichocarpa] 0.998 0.992 0.811 0.0
357459003856 Vacuolar protein sorting-associated prot 1.0 0.980 0.794 0.0
18404619858 vacuoleless1 (VCL1) [Arabidopsis thalian 0.990 0.968 0.767 0.0
297827353858 hypothetical protein ARALYDRAFT_321506 [ 0.990 0.968 0.767 0.0
>gi|224082574|ref|XP_002306748.1| predicted protein [Populus trichocarpa] gi|222856197|gb|EEE93744.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score = 1468 bits (3801), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 698/845 (82%), Positives = 768/845 (90%), Gaps = 7/845 (0%)

Query: 1   MANVSVAAEWQLVYNRYYRKPELYQMRWKHIDLSRNKVACAPFGGPIAVIRDDSKIVQLY 60
           MANVSVAAEWQL+ NRYYRKPELY MRWKHIDLSRNKVACAPFGGPIA+IRDDSKIVQLY
Sbjct: 1   MANVSVAAEWQLLINRYYRKPELYPMRWKHIDLSRNKVACAPFGGPIAIIRDDSKIVQLY 60

Query: 61  AESALRKLRIFNSAGVLISETVWKNPGGRLIGMSWSEDQTLICVVQDGTVYRYNIHAELI 120
           AESALRKLRIFNSAG+L SETVWK+PGGRLIGMSW+EDQTLIC+VQDGT+YRYN+H E++
Sbjct: 61  AESALRKLRIFNSAGILFSETVWKHPGGRLIGMSWTEDQTLICIVQDGTIYRYNVHCEVL 120

Query: 121 EPNASMGKECFEENVVECVFWGNGVVCVTEANRYFCMADFATMKVCELARPEV--EELPH 178
           EPN SMGKECFE+NVV+CVFWGNGVVC+TEA + FC+ DF  +K C+LA   +  EELPH
Sbjct: 121 EPNFSMGKECFEQNVVDCVFWGNGVVCLTEAGKLFCVPDFKQIKPCKLAEVGIGAEELPH 180

Query: 179 CVAVIEPKYTMTGSVEVLIGTDAGILMLDEDGVQKVDDT----LSQKMAVSPNGNFVACF 234
           C+AVIEP+YT++G+VEVL+G  +GI+++DED V+ +D+     +  K+AVS NG F+ACF
Sbjct: 181 CMAVIEPQYTVSGNVEVLLGVGSGIVIVDEDEVRFIDEEKIGGVVLKIAVSHNGRFLACF 240

Query: 235 THDGRLVVNNTNFSSPVIDESCESALPPEQIAWCGMDSVLLYWNDMLVMVAPQAEPVQYF 294
            HDGRLVV NT F        CESALPPEQ+AWCG+DSVLLYW+D+L+MV P  + V Y 
Sbjct: 241 MHDGRLVVMNTEFRD-FFQYQCESALPPEQMAWCGLDSVLLYWDDVLLMVGPSEDSVSYI 299

Query: 295 YDEPLVLIPECDGVRILSNSSMEFLQRVPASTEQIFAIGSTSPAALLYDALDHFDRRSAK 354
           YDEP++ IPECDGVRILSN+SMEF+QRVP ST  IF IGSTSPA+LL+DALDHFDRRSAK
Sbjct: 300 YDEPVIFIPECDGVRILSNTSMEFVQRVPDSTVSIFKIGSTSPASLLFDALDHFDRRSAK 359

Query: 355 ADENLRLIRASLPKAVEACIDAAGHEFDISRQRTLLRAASYGQAFCSNFQRDRIQEMCKT 414
           ADENLRLIRASLP+AVEACIDAAGHEFD+SRQR LLRAASYGQAFCSNFQRD IQEMCKT
Sbjct: 360 ADENLRLIRASLPEAVEACIDAAGHEFDVSRQRMLLRAASYGQAFCSNFQRDHIQEMCKT 419

Query: 415 LRVLNAARDPEIGIPLSIQQYKSLTASVLIGRLINANCHLLALRISEYLGMNQEVVIMHW 474
           LRVLNA RDPEIGIPLSI+QYK L+A +LIGRLINA+ HLLALRISEY+GMNQEVVIMHW
Sbjct: 420 LRVLNAVRDPEIGIPLSIEQYKLLSAPILIGRLINAHQHLLALRISEYVGMNQEVVIMHW 479

Query: 475 ACSKITASLAIPDVTLLEILLDKLKLCKGISYAAVAAHADKSGRRKLAAMLVEHEPRSSK 534
           +C+KITASLAIPD  LLEILLDKLKLCKGISYAAVAAHAD+SGRRKLAAMLV+HEPRSSK
Sbjct: 480 SCTKITASLAIPDAALLEILLDKLKLCKGISYAAVAAHADRSGRRKLAAMLVDHEPRSSK 539

Query: 535 QVPLLLSIGEEDTALVKATESGDTDLVYLVIFHIWQKRPALEFFGMIQTRPLACDLFTVY 594
           QVPLLLSI EEDTAL+KATESGDTDLVYLV+FHIWQKRPALEFFG IQ+RPLA DLF  Y
Sbjct: 540 QVPLLLSIAEEDTALMKATESGDTDLVYLVLFHIWQKRPALEFFGTIQSRPLARDLFIAY 599

Query: 595 ARCYKHEFLKDFFLSTGQLQEVAFLLWKESWELGKNPMASNGSALHGPRIKRIEKAHSLF 654
           ARCYKHEFLKDFFLSTGQLQ+VAFLLWK+SWELGKNPM S GS LHGPRIK IEKAH+LF
Sbjct: 600 ARCYKHEFLKDFFLSTGQLQDVAFLLWKDSWELGKNPMGSKGSPLHGPRIKLIEKAHNLF 659

Query: 655 SETKEHTFESKAAEEHAKLLRIQHELEVSTKQAIFVDSSISDTIRTCIVLGNHRAAMKVK 714
           SETKEHTFESKAAEEHAKLLRIQHELEVSTKQ IFVDSSISDTIRTCI LGNHRAAM+VK
Sbjct: 660 SETKEHTFESKAAEEHAKLLRIQHELEVSTKQPIFVDSSISDTIRTCIALGNHRAAMRVK 719

Query: 715 TEFKVSEKRWYWLKVFALATKRDWDALERFSKEKRPPIGYRPFVEACVDADEKGEALKYI 774
           TEFKVSEKRWYWLKV AL T RDW+ALE+FSKEKRPP+G+RPFVEAC+D DEK EALKYI
Sbjct: 720 TEFKVSEKRWYWLKVLALVTIRDWEALEKFSKEKRPPMGFRPFVEACIDVDEKAEALKYI 779

Query: 775 PKLVDPRERAEAYARIGMAKEAADAASQAKDGELLGRLKLTFAQNAAASSIFDTLRDRLS 834
           PKL DPRERAEAYARIGMAKEAADAASQAKDGELLGRLKL+FAQN AASSIFDTLRDRLS
Sbjct: 780 PKLADPRERAEAYARIGMAKEAADAASQAKDGELLGRLKLSFAQNTAASSIFDTLRDRLS 839

Query: 835 FQGVS 839
           FQGVS
Sbjct: 840 FQGVS 844

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225446811|ref|XP_002283428.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog [Vitis vinifera] gi|302143532|emb|CBI22093.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356567439|ref|XP_003551927.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog [Glycine max] Back     alignment and taxonomy information
>gi|449453776|ref|XP_004144632.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog [Cucumis sativus] gi|449519144|ref|XP_004166595.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog [Cucumis sativus] Back     alignment and taxonomy information
>gi|356526977|ref|XP_003532091.1| PREDICTED: vacuolar protein sorting-associated protein 16 homolog [Glycine max] Back     alignment and taxonomy information
>gi|255571398|ref|XP_002526647.1| vacuolar protein sorting vps16, putative [Ricinus communis] gi|223534014|gb|EEF35735.1| vacuolar protein sorting vps16, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224066557|ref|XP_002302135.1| predicted protein [Populus trichocarpa] gi|222843861|gb|EEE81408.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357459003|ref|XP_003599782.1| Vacuolar protein sorting-associated protein-like protein [Medicago truncatula] gi|355488830|gb|AES70033.1| Vacuolar protein sorting-associated protein-like protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|18404619|ref|NP_565879.1| vacuoleless1 (VCL1) [Arabidopsis thaliana] gi|13877133|gb|AAK43713.1|AF359240_1 VCL1 [Arabidopsis thaliana] gi|15081711|gb|AAK82510.1| At2g38020/T8P21.7 [Arabidopsis thaliana] gi|22655028|gb|AAM98105.1| At2g38020/T8P21.7 [Arabidopsis thaliana] gi|330254385|gb|AEC09479.1| vacuoleless1 (VCL1) [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297827353|ref|XP_002881559.1| hypothetical protein ARALYDRAFT_321506 [Arabidopsis lyrata subsp. lyrata] gi|297327398|gb|EFH57818.1| hypothetical protein ARALYDRAFT_321506 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query839
TAIR|locus:2065674858 VCL1 "AT2G38020" [Arabidopsis 0.731 0.715 0.769 0.0
DICTYBASE|DDB_G0270754832 vps16 "Vacuolar protein sortin 0.920 0.927 0.370 2.3e-135
UNIPROTKB|G4N5E9829 MGG_05256 "Vacuolar protein so 0.921 0.932 0.351 5.8e-121
ASPGD|ASPL0000006985829 vps16 [Emericella nidulans (ta 0.923 0.934 0.347 1.2e-120
ZFIN|ZDB-GENE-050809-9835 zgc:162584 "zgc:162584" [Danio 0.907 0.911 0.351 5.4e-118
UNIPROTKB|F1MQ47839 VPS16 "Vacuolar protein sortin 0.907 0.907 0.350 8.8e-118
UNIPROTKB|Q9H269839 VPS16 "Vacuolar protein sortin 0.908 0.908 0.349 1.1e-117
UNIPROTKB|Q5E9L7839 VPS16 "Vacuolar protein sortin 0.907 0.907 0.350 1.8e-117
UNIPROTKB|E2QZL5839 VPS16 "Uncharacterized protein 0.908 0.908 0.347 3.4e-116
MGI|MGI:2136772839 Vps16 "vacuolar protein sortin 0.908 0.908 0.349 5.6e-116
TAIR|locus:2065674 VCL1 "AT2G38020" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2441 (864.3 bits), Expect = 0., Sum P(2) = 0.
 Identities = 478/621 (76%), Positives = 522/621 (84%)

Query:   220 QKMAVSPNGNFVACFTHDGRLVVNNTNFSSPVIDESCESALPPEQIAWCGMDSVLLYWND 279
             QKM VSPNG F+  FTHDGR+VV +       ID SCESALPP+Q+AWCGMDSVLLYW++
Sbjct:   244 QKMIVSPNGKFLTLFTHDGRIVVVDMETKQIAIDYSCESALPPQQMAWCGMDSVLLYWDE 303

Query:   280 MLVMVAPQAEPVQYFYDEPLVLIPECDGVRILSNSSMEFLQRVPASTEQIFAIGSTSPAA 339
              L+MV P  +PV YFYDEP++LIPECDGVRILSN+++EFLQRVP STE IF IGSTSPAA
Sbjct:   304 DLMMVGPVGDPVHYFYDEPIILIPECDGVRILSNTNLEFLQRVPDSTESIFKIGSTSPAA 363

Query:   340 LLYDALDHFDRRSAKADENLRLIRASLPKAVEACIDAAGHEFDISRQRTLLRAASYGQAF 399
             LLYDALDHFDRRSAKADENLRLIR+SL +AVE+CIDAAGHEFD++RQR LLRAASYGQAF
Sbjct:   364 LLYDALDHFDRRSAKADENLRLIRSSLSEAVESCIDAAGHEFDVTRQRALLRAASYGQAF 423

Query:   400 CSNFQRDRIQEMCKTLRVLNAARDPEIGIPLSIQQYKSLTASVLIGRLINANCHLLALRI 459
             CSNFQR+R+QE C+TLRVLNA RDP IGIPLSIQQYK LT  VLI RLINANCHLLALRI
Sbjct:   424 CSNFQRERVQETCRTLRVLNAVRDPAIGIPLSIQQYKLLTPVVLISRLINANCHLLALRI 483

Query:   460 SEYLGMNQEVVIMHWACSKITASLAIPDVTXXXXXXXXXXXXXGISYAAVAAHADKSGRR 519
             SEYL MN+EVVIMHWAC+KITAS + PD               GISYAAVA HAD  GRR
Sbjct:   484 SEYLDMNKEVVIMHWACAKITASPSTPDSHLLEILLDKLQLCKGISYAAVATHADNCGRR 543

Query:   520 KLAAMLVEHEPRSSKQVPLLLSIGEEDTALVKATESGDTDLVYLVIFHIWQKRPALEFFG 579
             KLAAMLVEHEPRS+KQVPLLLSIGEEDTALVKATESGDTDLVYLVIFHIWQKRP LEFF 
Sbjct:   544 KLAAMLVEHEPRSTKQVPLLLSIGEEDTALVKATESGDTDLVYLVIFHIWQKRPPLEFFA 603

Query:   580 MIQTRPLACDLFTVYARCYKHEFLKDFFLSTGQLQEVAFLLWKESWELGKNPMASNGSAL 639
             MIQ R LA DLF  YARC+KHEFLKDFFLSTGQ+ EVAFLLWKESW++GKNPMAS GS L
Sbjct:   604 MIQGRVLARDLFVAYARCHKHEFLKDFFLSTGQIHEVAFLLWKESWDMGKNPMASKGSPL 663

Query:   640 HGPRIKRIEKAHSLFSETKEHTFESKAAEEHAKLLRIQHELEVSTKQAIFVDSSISDTIR 699
             HGPRIK IEKA +LFS+TKEHTFESKAAEEHAKLL+IQHELE STKQAIFVDSSI+DTIR
Sbjct:   664 HGPRIKLIEKARNLFSQTKEHTFESKAAEEHAKLLKIQHELEASTKQAIFVDSSINDTIR 723

Query:   700 TCIVLGNHRAAMKVKTEFKVSEKRWYWLKVFALATKRDWDALERFSKEKRPPIGYRPFVE 759
             TCIVLGN+RAA+KVKTEFKVS+KRWYWLK FALAT +DW ALE+FSKEKRPP+G+RPFVE
Sbjct:   724 TCIVLGNNRAAIKVKTEFKVSDKRWYWLKAFALATIKDWAALEKFSKEKRPPMGFRPFVE 783

Query:   760 ACVDADEKGEALKYIPKLVDPRERAEAYARIGMXXXXXX-XXXXXXXGELLGRLKLTFAQ 818
             AC+DADEK EALKYIPKL D  ER EAYARIGM              GELL R + TF Q
Sbjct:   784 ACIDADEKAEALKYIPKLSDLVERGEAYARIGMAKEAADCAAQANDGGELLERFRKTFVQ 843

Query:   819 NAAASSIFDTLRDRLSFQGVS 839
             NA    IFDTL   + FQG S
Sbjct:   844 NA----IFDTLL--MPFQGAS 858
GO:0003674 "molecular_function" evidence=ND
GO:0005622 "intracellular" evidence=IEA
GO:0006886 "intracellular protein transport" evidence=IEA
GO:0007033 "vacuole organization" evidence=RCA;TAS
GO:0009705 "plant-type vacuole membrane" evidence=IDA
GO:0006486 "protein glycosylation" evidence=RCA
GO:0006487 "protein N-linked glycosylation" evidence=RCA
GO:0006623 "protein targeting to vacuole" evidence=RCA
GO:0007030 "Golgi organization" evidence=RCA
GO:0010228 "vegetative to reproductive phase transition of meristem" evidence=RCA
GO:0010413 "glucuronoxylan metabolic process" evidence=RCA
GO:0016926 "protein desumoylation" evidence=RCA
GO:0045492 "xylan biosynthetic process" evidence=RCA
GO:0050665 "hydrogen peroxide biosynthetic process" evidence=RCA
DICTYBASE|DDB_G0270754 vps16 "Vacuolar protein sorting-associated protein 16 homolog" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|G4N5E9 MGG_05256 "Vacuolar protein sorting-associated protein" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
ASPGD|ASPL0000006985 vps16 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050809-9 zgc:162584 "zgc:162584" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1MQ47 VPS16 "Vacuolar protein sorting-associated protein 16 homolog" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q9H269 VPS16 "Vacuolar protein sorting-associated protein 16 homolog" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q5E9L7 VPS16 "Vacuolar protein sorting-associated protein 16 homolog" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2QZL5 VPS16 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:2136772 Vps16 "vacuolar protein sorting 16 (yeast)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9H269VPS16_HUMANNo assigned EC number0.35050.91410.9141yesno
Q920Q4VPS16_MOUSENo assigned EC number0.34670.93440.9344yesno
Q5E9L7VPS16_BOVINNo assigned EC number0.35210.91170.9117yesno
Q55C58VPS16_DICDINo assigned EC number0.37680.93440.9423yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query839
pfam04841408 pfam04841, Vps16_N, Vps16, N-terminal region 9e-79
pfam04840319 pfam04840, Vps16_C, Vps16, C-terminal region 3e-60
>gnl|CDD|218287 pfam04841, Vps16_N, Vps16, N-terminal region Back     alignment and domain information 
 Score =  260 bits (665), Expect = 9e-79
 Identities = 132/410 (32%), Positives = 209/410 (50%), Gaps = 19/410 (4%)

Query: 8   AEWQLVYNRYYRKPELYQMRWKHI-DLSRNKVACAPFGGPIAVIRDDSKIVQLYAESALR 66
            EW+L+ + YYRK  L  + W    ++     A AP+GGPIAV R    +    A     
Sbjct: 3   FEWELLKDVYYRKRALGTLDWPLKYEVFDCAFAAAPYGGPIAVTRSPFNLRP--AYDQRP 60

Query: 67  KLRIFNSAGVLISETVWKNPGGRLIGMSWSEDQTLICVVQDGTVYRYNIHAELIEPNASM 126
            ++I+N +G L+ + +W +    L+ M WS+D+ LI V + G V  Y +  E      S+
Sbjct: 61  MIQIYNYSGQLLGKILWNH--EPLVKMGWSKDEELIVVQKSGIVIVYGLLGE--FHQFSI 116

Query: 127 GKECFEENVVECV-----FWGNGVVCVTEANRYFCMADFATMKVCELARPEVEEL----- 176
           G E     V EC      F  +GV  +T++ R + +       +    +PE+  L     
Sbjct: 117 GLEIESVPVQECRIFTTSFGHSGVAVLTKSGRVYLLNGVEE-PLLWRNKPEIPNLLTKNH 175

Query: 177 PHCVAVIEPKYTMTGSVEVLIGTDAGILMLDEDGVQKVDDTLSQKMAVSPNGNFVACFTH 236
             C         +    ++ +     + ++ E   Q  +     K++VS N   +A +T 
Sbjct: 176 WSCSDTSIILLLVDHVYQISLSVGELLKLITEQSSQHANTKWH-KISVSDNRRHLALYTM 234

Query: 237 DGRLVVNNTNFSSPVIDESCESALPPEQIAWCGMDSVLLYWNDMLVMVAPQAEPVQYFYD 296
            G++   + + S  + + + +    P+Q+ WCG D+V++ +  +L +V P  + VQ++YD
Sbjct: 235 TGKIWQISRDLSRKLCEFNLDDHDTPKQMCWCGNDAVVVSFESLLKLVGPDGDSVQFWYD 294

Query: 297 EPLVLIPECDGVRILSNSSMEFLQRVPASTEQIFAIGSTSPAALLYDALDHFDRRSAKAD 356
               L  E DGVRI++ SS EFL RVPA++E IFAIGST P A+L +A    +  S KAD
Sbjct: 295 FTTNLSAEVDGVRIITTSSHEFLSRVPAASENIFAIGSTEPGAMLVEAFQEMEDHSPKAD 354

Query: 357 ENLRLIRASLPKAVEACIDAAGHEFDISRQRTLLRAASYGQAFCSNFQRD 406
           E L+ I+  L KAV+ CI+AA  EF    Q++LLRAAS+G+A   N   D
Sbjct: 355 EYLKEIQDVLEKAVDDCIEAAIDEFQPELQKSLLRAASFGKASLRNKNPD 404

This protein forms part of the Class C vacuolar protein sorting (Vps) complex. Vps16 is essential for vacuolar protein sorting, which is essential for viability in plants, but not yeast. The Class C Vps complex is required for SNARE-mediated membrane fusion at the lysosome-like yeast vacuole. It is thought to play essential roles in membrane docking and fusion at the Golgi-to-endosome and endosome-to-vacuole stages of transport. The role of VPS16 in this complex is not known. Length = 408
>gnl|CDD|218286 pfam04840, Vps16_C, Vps16, C-terminal region Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 839
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 100.0
PF04841410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 100.0
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 100.0
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 99.87
KOG0271480 consensus Notchless-like WD40 repeat-containing pr 99.83
KOG0315311 consensus G-protein beta subunit-like protein (con 99.75
KOG0263707 consensus Transcription initiation factor TFIID, s 99.71
KOG0279315 consensus G protein beta subunit-like protein [Sig 99.71
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 99.68
KOG0645312 consensus WD40 repeat protein [General function pr 99.68
KOG0291893 consensus WD40-repeat-containing subunit of the 18 99.65
KOG0271480 consensus Notchless-like WD40 repeat-containing pr 99.65
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 99.62
KOG0266456 consensus WD40 repeat-containing protein [General 99.61
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.6
KOG0279315 consensus G protein beta subunit-like protein [Sig 99.59
KOG0284464 consensus Polyadenylation factor I complex, subuni 99.54
KOG0291893 consensus WD40-repeat-containing subunit of the 18 99.52
KOG0286343 consensus G-protein beta subunit [General function 99.52
KOG0266456 consensus WD40 repeat-containing protein [General 99.5
KOG0306888 consensus WD40-repeat-containing subunit of the 18 99.5
PLN00181793 protein SPA1-RELATED; Provisional 99.5
KOG0318603 consensus WD40 repeat stress protein/actin interac 99.47
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 99.47
KOG0265338 consensus U5 snRNP-specific protein-like factor an 99.46
KOG0640430 consensus mRNA cleavage stimulating factor complex 99.46
KOG0275508 consensus Conserved WD40 repeat-containing protein 99.46
KOG0286343 consensus G-protein beta subunit [General function 99.45
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.45
KOG0293519 consensus WD40 repeat-containing protein [Function 99.45
KOG0263707 consensus Transcription initiation factor TFIID, s 99.42
KOG0318603 consensus WD40 repeat stress protein/actin interac 99.41
KOG0319775 consensus WD40-repeat-containing subunit of the 18 99.4
KOG0315311 consensus G-protein beta subunit-like protein (con 99.4
KOG0973942 consensus Histone transcription regulator HIRA, WD 99.39
KOG0295406 consensus WD40 repeat-containing protein [Function 99.38
PLN00181793 protein SPA1-RELATED; Provisional 99.35
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 99.35
KOG0319775 consensus WD40-repeat-containing subunit of the 18 99.35
KOG0295406 consensus WD40 repeat-containing protein [Function 99.35
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 99.34
PTZ00421493 coronin; Provisional 99.34
PTZ00421493 coronin; Provisional 99.33
KOG0301745 consensus Phospholipase A2-activating protein (con 99.31
KOG0281499 consensus Beta-TrCP (transducin repeats containing 99.31
PTZ00420568 coronin; Provisional 99.29
KOG0277311 consensus Peroxisomal targeting signal type 2 rece 99.28
KOG0288459 consensus WD40 repeat protein TipD [General functi 99.27
KOG0296399 consensus Angio-associated migratory cell protein 99.27
KOG2096420 consensus WD40 repeat protein [General function pr 99.27
KOG0292 1202 consensus Vesicle coat complex COPI, alpha subunit 99.27
KOG0645312 consensus WD40 repeat protein [General function pr 99.26
PTZ00420568 coronin; Provisional 99.25
KOG0316307 consensus Conserved WD40 repeat-containing protein 99.23
KOG0278334 consensus Serine/threonine kinase receptor-associa 99.22
KOG0310487 consensus Conserved WD40 repeat-containing protein 99.21
KOG0285460 consensus Pleiotropic regulator 1 [RNA processing 99.21
KOG0293519 consensus WD40 repeat-containing protein [Function 99.19
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 99.18
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 99.18
KOG0289506 consensus mRNA splicing factor [General function p 99.18
KOG1407313 consensus WD40 repeat protein [Function unknown] 99.17
KOG0268433 consensus Sof1-like rRNA processing protein (conta 99.16
KOG0643327 consensus Translation initiation factor 3, subunit 99.16
KOG0299479 consensus U3 snoRNP-associated protein (contains W 99.16
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.14
KOG0292 1202 consensus Vesicle coat complex COPI, alpha subunit 99.14
KOG0313423 consensus Microtubule binding protein YTM1 (contai 99.14
KOG0973 942 consensus Histone transcription regulator HIRA, WD 99.13
KOG0288459 consensus WD40 repeat protein TipD [General functi 99.12
KOG0278334 consensus Serine/threonine kinase receptor-associa 99.11
KOG0282503 consensus mRNA splicing factor [Function unknown] 99.11
KOG1274933 consensus WD40 repeat protein [General function pr 99.11
KOG2096420 consensus WD40 repeat protein [General function pr 99.1
KOG0275508 consensus Conserved WD40 repeat-containing protein 99.09
KOG0301745 consensus Phospholipase A2-activating protein (con 99.09
KOG0284464 consensus Polyadenylation factor I complex, subuni 99.07
KOG2055514 consensus WD40 repeat protein [General function pr 99.07
KOG0772641 consensus Uncharacterized conserved protein, conta 99.07
KOG2445361 consensus Nuclear pore complex component (sc Seh1) 99.06
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 99.06
KOG0316307 consensus Conserved WD40 repeat-containing protein 99.05
KOG0265338 consensus U5 snRNP-specific protein-like factor an 99.05
KOG0310487 consensus Conserved WD40 repeat-containing protein 99.05
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 99.04
KOG0306888 consensus WD40-repeat-containing subunit of the 18 99.03
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 99.03
KOG0772641 consensus Uncharacterized conserved protein, conta 99.03
KOG0294362 consensus WD40 repeat-containing protein [Function 99.01
KOG1539910 consensus WD repeat protein [General function pred 99.01
KOG0641350 consensus WD40 repeat protein [General function pr 99.0
KOG0282503 consensus mRNA splicing factor [Function unknown] 99.0
KOG1332299 consensus Vesicle coat complex COPII, subunit SEC1 98.98
KOG1273405 consensus WD40 repeat protein [General function pr 98.97
KOG2055514 consensus WD40 repeat protein [General function pr 98.97
KOG0285460 consensus Pleiotropic regulator 1 [RNA processing 98.96
KOG1274 933 consensus WD40 repeat protein [General function pr 98.95
KOG0296399 consensus Angio-associated migratory cell protein 98.95
KOG0771398 consensus Prolactin regulatory element-binding pro 98.94
KOG0289506 consensus mRNA splicing factor [General function p 98.94
KOG0281499 consensus Beta-TrCP (transducin repeats containing 98.93
KOG0647347 consensus mRNA export protein (contains WD40 repea 98.92
PF09787511 Golgin_A5: Golgin subfamily A member 5; InterPro: 98.92
KOG0283712 consensus WD40 repeat-containing protein [Function 98.9
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 98.89
KOG0283712 consensus WD40 repeat-containing protein [Function 98.89
PRK01742429 tolB translocation protein TolB; Provisional 98.88
KOG2048691 consensus WD40 repeat protein [General function pr 98.87
KOG0646476 consensus WD40 repeat protein [General function pr 98.86
KOG1036323 consensus Mitotic spindle checkpoint protein BUB3, 98.86
KOG1332299 consensus Vesicle coat complex COPII, subunit SEC1 98.85
PRK03629429 tolB translocation protein TolB; Provisional 98.85
KOG0268433 consensus Sof1-like rRNA processing protein (conta 98.84
KOG0646476 consensus WD40 repeat protein [General function pr 98.84
KOG0307 1049 consensus Vesicle coat complex COPII, subunit SEC3 98.82
KOG1407313 consensus WD40 repeat protein [Function unknown] 98.79
PRK05137435 tolB translocation protein TolB; Provisional 98.77
PRK04922433 tolB translocation protein TolB; Provisional 98.77
PRK02889427 tolB translocation protein TolB; Provisional 98.77
PRK01742429 tolB translocation protein TolB; Provisional 98.76
KOG0643327 consensus Translation initiation factor 3, subunit 98.75
KOG0647347 consensus mRNA export protein (contains WD40 repea 98.74
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 98.74
PRK03629429 tolB translocation protein TolB; Provisional 98.73
KOG0294362 consensus WD40 repeat-containing protein [Function 98.73
KOG0270463 consensus WD40 repeat-containing protein [Function 98.72
KOG2106626 consensus Uncharacterized conserved protein, conta 98.71
KOG0277311 consensus Peroxisomal targeting signal type 2 rece 98.7
PRK05137435 tolB translocation protein TolB; Provisional 98.69
KOG0264422 consensus Nucleosome remodeling factor, subunit CA 98.69
KOG0269839 consensus WD40 repeat-containing protein [Function 98.68
KOG1036323 consensus Mitotic spindle checkpoint protein BUB3, 98.68
KOG4328498 consensus WD40 protein [Function unknown] 98.68
KOG1539910 consensus WD repeat protein [General function pred 98.66
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 98.64
KOG0640430 consensus mRNA cleavage stimulating factor complex 98.63
KOG0308735 consensus Conserved WD40 repeat-containing protein 98.63
KOG0313423 consensus Microtubule binding protein YTM1 (contai 98.63
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 98.61
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 98.61
PRK04043419 tolB translocation protein TolB; Provisional 98.59
KOG1063764 consensus RNA polymerase II elongator complex, sub 98.57
PRK04922433 tolB translocation protein TolB; Provisional 98.55
PRK02889427 tolB translocation protein TolB; Provisional 98.55
KOG2048691 consensus WD40 repeat protein [General function pr 98.55
KOG1034385 consensus Transcriptional repressor EED/ESC/FIE, r 98.55
PRK04792448 tolB translocation protein TolB; Provisional 98.55
KOG0639705 consensus Transducin-like enhancer of split protei 98.53
KOG14451012 consensus Tumor-specific antigen (contains WD repe 98.52
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 98.52
KOG2106626 consensus Uncharacterized conserved protein, conta 98.51
KOG0300481 consensus WD40 repeat-containing protein [Function 98.51
KOG1524737 consensus WD40 repeat-containing protein CHE-2 [Ge 98.51
KOG2111346 consensus Uncharacterized conserved protein, conta 98.5
PRK00178430 tolB translocation protein TolB; Provisional 98.49
KOG0267825 consensus Microtubule severing protein katanin p80 98.47
KOG1272545 consensus WD40-repeat-containing subunit of the 18 98.46
KOG0300481 consensus WD40 repeat-containing protein [Function 98.43
KOG12401431 consensus Protein kinase containing WD40 repeats [ 98.42
KOG4677554 consensus Golgi integral membrane protein [Intrace 98.41
KOG2110391 consensus Uncharacterized conserved protein, conta 98.4
KOG0641350 consensus WD40 repeat protein [General function pr 98.4
KOG4378673 consensus Nuclear protein COP1 [Signal transductio 98.39
KOG0642577 consensus Cell-cycle nuclear protein, contains WD- 98.39
KOG2919406 consensus Guanine nucleotide-binding protein [Gene 98.38
KOG0303472 consensus Actin-binding protein Coronin, contains 98.38
KOG0264422 consensus Nucleosome remodeling factor, subunit CA 98.35
PRK11028330 6-phosphogluconolactonase; Provisional 98.35
PRK01029428 tolB translocation protein TolB; Provisional 98.35
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 98.34
COG2319466 FOG: WD40 repeat [General function prediction only 98.33
KOG14081080 consensus WD40 repeat protein [Function unknown] 98.32
KOG1523361 consensus Actin-related protein Arp2/3 complex, su 98.31
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 98.3
KOG2445361 consensus Nuclear pore complex component (sc Seh1) 98.29
KOG4497447 consensus Uncharacterized conserved protein WDR8, 98.29
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 98.28
KOG14451012 consensus Tumor-specific antigen (contains WD repe 98.25
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 98.24
KOG0302440 consensus Ribosome Assembly protein [General funct 98.24
KOG2321703 consensus WD40 repeat protein [General function pr 98.24
KOG0307 1049 consensus Vesicle coat complex COPII, subunit SEC3 98.23
KOG2110391 consensus Uncharacterized conserved protein, conta 98.23
KOG0650733 consensus WD40 repeat nucleolar protein Bop1, invo 98.22
KOG0771398 consensus Prolactin regulatory element-binding pro 98.21
KOG14081080 consensus WD40 repeat protein [Function unknown] 98.2
KOG0299479 consensus U3 snoRNP-associated protein (contains W 98.18
PRK11028330 6-phosphogluconolactonase; Provisional 98.18
PRK00178430 tolB translocation protein TolB; Provisional 98.17
KOG4378673 consensus Nuclear protein COP1 [Signal transductio 98.17
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 98.16
KOG2394636 consensus WD40 protein DMR-N9 [General function pr 98.14
PRK04792448 tolB translocation protein TolB; Provisional 98.14
KOG0270463 consensus WD40 repeat-containing protein [Function 98.13
KOG0269839 consensus WD40 repeat-containing protein [Function 98.13
KOG0639705 consensus Transducin-like enhancer of split protei 98.06
KOG1063764 consensus RNA polymerase II elongator complex, sub 98.06
KOG0321720 consensus WD40 repeat-containing protein L2DTL [Fu 98.05
KOG2139445 consensus WD40 repeat protein [General function pr 98.04
KOG0267825 consensus Microtubule severing protein katanin p80 98.03
KOG1963792 consensus WD40 repeat protein [General function pr 98.03
KOG2919406 consensus Guanine nucleotide-binding protein [Gene 98.02
KOG0308735 consensus Conserved WD40 repeat-containing protein 98.01
KOG1188376 consensus WD40 repeat protein [General function pr 98.01
PF04762928 IKI3: IKI3 family; InterPro: IPR006849 Members of 98.01
KOG0302440 consensus Ribosome Assembly protein [General funct 97.96
KOG1963792 consensus WD40 repeat protein [General function pr 97.95
KOG4283397 consensus Transcription-coupled repair protein CSA 97.94
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 97.92
COG2319466 FOG: WD40 repeat [General function prediction only 97.89
KOG4328498 consensus WD40 protein [Function unknown] 97.89
KOG1034385 consensus Transcriptional repressor EED/ESC/FIE, r 97.88
KOG2066846 consensus Vacuolar assembly/sorting protein VPS41 97.88
KOG1009434 consensus Chromatin assembly complex 1 subunit B/C 97.87
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 97.85
KOG1009434 consensus Chromatin assembly complex 1 subunit B/C 97.84
KOG12401431 consensus Protein kinase containing WD40 repeats [ 97.83
KOG1587555 consensus Cytoplasmic dynein intermediate chain [C 97.81
KOG0649325 consensus WD40 repeat protein [General function pr 97.8
KOG15171387 consensus Guanine nucleotide binding protein MIP1 97.79
PRK04043419 tolB translocation protein TolB; Provisional 97.79
PRK01029428 tolB translocation protein TolB; Provisional 97.76
KOG0321720 consensus WD40 repeat-containing protein L2DTL [Fu 97.76
KOG4283397 consensus Transcription-coupled repair protein CSA 97.76
KOG0642577 consensus Cell-cycle nuclear protein, contains WD- 97.74
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 97.52
PF04762928 IKI3: IKI3 family; InterPro: IPR006849 Members of 97.52
KOG4227609 consensus WD40 repeat protein [General function pr 97.5
KOG06441113 consensus Uncharacterized conserved protein, conta 97.5
KOG2139445 consensus WD40 repeat protein [General function pr 97.5
KOG0303472 consensus Actin-binding protein Coronin, contains 97.49
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 97.48
KOG0290364 consensus Conserved WD40 repeat-containing protein 97.46
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 97.46
KOG1524737 consensus WD40 repeat-containing protein CHE-2 [Ge 97.43
KOG1354433 consensus Serine/threonine protein phosphatase 2A, 97.42
KOG0290364 consensus Conserved WD40 repeat-containing protein 97.38
KOG4497447 consensus Uncharacterized conserved protein WDR8, 97.37
PLN029191057 haloacid dehalogenase-like hydrolase family protei 97.34
KOG2394636 consensus WD40 protein DMR-N9 [General function pr 97.3
KOG1587555 consensus Cytoplasmic dynein intermediate chain [C 97.26
KOG2111346 consensus Uncharacterized conserved protein, conta 97.26
KOG1273405 consensus WD40 repeat protein [General function pr 97.24
PLN029191057 haloacid dehalogenase-like hydrolase family protei 97.23
COG4946668 Uncharacterized protein related to the periplasmic 97.21
KOG2315566 consensus Predicted translation initiation factor 97.08
KOG1007370 consensus WD repeat protein TSSC1, WD repeat super 97.05
KOG1272545 consensus WD40-repeat-containing subunit of the 18 97.03
KOG0322323 consensus G-protein beta subunit-like protein GNB1 97.03
KOG0649325 consensus WD40 repeat protein [General function pr 97.01
PLN03218 1060 maturation of RBCL 1; Provisional 97.0
KOG0974967 consensus WD-repeat protein WDR6, WD repeat superf 96.95
KOG0322323 consensus G-protein beta subunit-like protein GNB1 96.94
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 96.93
KOG1188376 consensus WD40 repeat protein [General function pr 96.87
KOG2315566 consensus Predicted translation initiation factor 96.82
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 96.8
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 96.8
KOG1310758 consensus WD40 repeat protein [General function pr 96.8
PLN03077 857 Protein ECB2; Provisional 96.74
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 96.62
KOG3914390 consensus WD repeat protein WDR4 [Function unknown 96.62
COG4946668 Uncharacterized protein related to the periplasmic 96.6
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 96.6
KOG15171387 consensus Guanine nucleotide binding protein MIP1 96.59
KOG20411189 consensus WD40 repeat protein [General function pr 96.55
COG5354561 Uncharacterized protein, contains Trp-Asp (WD) rep 96.48
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 96.39
KOG1007370 consensus WD repeat protein TSSC1, WD repeat super 96.37
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 96.35
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 96.29
KOG0974967 consensus WD-repeat protein WDR6, WD repeat superf 96.29
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 96.27
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 96.23
KOG41901034 consensus Uncharacterized conserved protein [Funct 96.22
KOG3881412 consensus Uncharacterized conserved protein [Funct 96.18
KOG2041 1189 consensus WD40 repeat protein [General function pr 96.17
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 96.17
KOG2321703 consensus WD40 repeat protein [General function pr 96.16
COG5354561 Uncharacterized protein, contains Trp-Asp (WD) rep 96.14
KOG0644 1113 consensus Uncharacterized conserved protein, conta 96.1
PLN03077 857 Protein ECB2; Provisional 96.1
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 96.09
KOG1523361 consensus Actin-related protein Arp2/3 complex, su 96.03
PF11768545 DUF3312: Protein of unknown function (DUF3312); In 95.99
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 95.96
KOG2314698 consensus Translation initiation factor 3, subunit 95.92
KOG4227609 consensus WD40 repeat protein [General function pr 95.85
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 95.82
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 95.7
PLN03218 1060 maturation of RBCL 1; Provisional 95.69
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 95.65
KOG0650733 consensus WD40 repeat nucleolar protein Bop1, invo 95.55
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 95.4
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 95.17
COG0823425 TolB Periplasmic component of the Tol biopolymer t 95.13
KOG3881412 consensus Uncharacterized conserved protein [Funct 95.1
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 94.78
KOG4640665 consensus Anaphase-promoting complex (APC), subuni 94.73
smart0032040 WD40 WD40 repeats. Note that these repeats are per 94.65
COG0823425 TolB Periplasmic component of the Tol biopolymer t 94.62
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 94.6
PRK13616591 lipoprotein LpqB; Provisional 94.53
KOG0882558 consensus Cyclophilin-related peptidyl-prolyl cis- 94.43
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 94.37
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 94.37
KOG3914390 consensus WD repeat protein WDR4 [Function unknown 94.04
KOG4532344 consensus WD40-like repeat containing protein [Gen 93.76
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 93.74
KOG0280339 consensus Uncharacterized conserved protein [Amino 93.41
KOG0280339 consensus Uncharacterized conserved protein [Amino 93.27
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 93.04
TIGR02604367 Piru_Ver_Nterm putative membrane-bound dehydrogena 92.52
KOG2066 846 consensus Vacuolar assembly/sorting protein VPS41 92.52
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 92.22
KOG4547541 consensus WD40 repeat-containing protein [General 92.06
PF10168717 Nup88: Nuclear pore component; InterPro: IPR019321 91.87
KOG3621726 consensus WD40 repeat-containing protein [General 91.8
KOG36171416 consensus WD40 and TPR repeat-containing protein [ 91.55
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 91.53
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 91.49
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 91.47
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 91.42
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 91.09
COG5170460 CDC55 Serine/threonine protein phosphatase 2A, reg 90.96
PF14727418 PHTB1_N: PTHB1 N-terminus 90.84
PRK13616591 lipoprotein LpqB; Provisional 90.82
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 90.52
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 90.45
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 90.4
KOG2314698 consensus Translation initiation factor 3, subunit 90.39
KOG1334559 consensus WD40 repeat protein [General function pr 90.37
KOG1645463 consensus RING-finger-containing E3 ubiquitin liga 89.85
smart0032040 WD40 WD40 repeats. Note that these repeats are per 89.54
smart00299140 CLH Clathrin heavy chain repeat homology. 89.51
KOG4547541 consensus WD40 repeat-containing protein [General 89.36
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 89.25
KOG1310758 consensus WD40 repeat protein [General function pr 88.89
PF11768545 DUF3312: Protein of unknown function (DUF3312); In 88.76
KOG2079 1206 consensus Vacuolar assembly/sorting protein VPS8 [ 88.69
KOG2280 829 consensus Vacuolar assembly/sorting protein VPS16 88.67
PF13934226 ELYS: Nuclear pore complex assembly 88.33
KOG1275 1118 consensus PAB-dependent poly(A) ribonuclease, subu 87.61
KOG4532344 consensus WD40-like repeat containing protein [Gen 87.54
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 87.01
PF14655415 RAB3GAP2_N: Rab3 GTPase-activating protein regulat 86.81
PF14649296 Spatacsin_C: Spatacsin C-terminus 86.78
KOG18111141 consensus Predicted Zn2+-binding protein, contains 86.46
COG3204316 Uncharacterized protein conserved in bacteria [Fun 86.3
PRK02888635 nitrous-oxide reductase; Validated 86.29
PF04841410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 86.24
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 85.4
KOG2079 1206 consensus Vacuolar assembly/sorting protein VPS8 [ 84.41
KOG1645463 consensus RING-finger-containing E3 ubiquitin liga 84.24
PRK13684334 Ycf48-like protein; Provisional 83.77
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 83.59
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 83.43
KOG10642439 consensus RAVE (regulator of V-ATPase assembly) co 83.17
KOG4714319 consensus Nucleoporin [Nuclear structure] 83.13
KOG1409404 consensus Uncharacterized conserved protein, conta 83.13
KOG10642439 consensus RAVE (regulator of V-ATPase assembly) co 82.98
PRK13684334 Ycf48-like protein; Provisional 82.95
PLN00033398 photosystem II stability/assembly factor; Provisio 82.85
KOG1354433 consensus Serine/threonine protein phosphatase 2A, 82.45
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 81.87
PF11635753 Med16: Mediator complex subunit 16; InterPro: IPR0 81.76
KOG1409404 consensus Uncharacterized conserved protein, conta 81.65
KOG2377657 consensus Uncharacterized conserved protein [Funct 81.09
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 80.71
PF05935477 Arylsulfotrans: Arylsulfotransferase (ASST); Inter 80.7
KOG3621726 consensus WD40 repeat-containing protein [General 80.52
TIGR01063800 gyrA DNA gyrase, A subunit. This model describes t 80.4
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 80.3
KOG2395644 consensus Protein involved in vacuole import and d 80.28
KOG1912 1062 consensus WD40 repeat protein [General function pr 80.28
smart00036302 CNH Domain found in NIK1-like kinases, mouse citro 80.07
KOG19121062 consensus WD40 repeat protein [General function pr 80.03
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information 
Probab=100.00  E-value=7.4e-186  Score=1525.27  Aligned_cols=804  Identities=41%  Similarity=0.679  Sum_probs=760.0

Q ss_pred             CCCCcccccccccccEEeeccccccccCCCCCCCCCEEEEcCCCCeEEEEecCchhhhhhcccCCceEEEEcCCCCceeE
Q 003205            1 MANVSVAAEWQLVYNRYYRKPELYQMRWKHIDLSRNKVACAPFGGPIAVIRDDSKIVQLYAESALRKLRIFNSAGVLISE   80 (839)
Q Consensus         1 m~~~~~~~~W~~Lg~~~yr~~e~y~m~w~~~~l~~~~va~sp~Gg~IA~~~d~~k~~~~~~~~~~~~I~iy~~~G~ll~t   80 (839)
                      |++.+|+++|++|+|+|||++|+|.|+|+-.|+.+..+++||+|||||++|+|+|+++..  +..+.|+|||.+|+++++
T Consensus         1 ~a~~~p~~eWell~d~fYrk~eiy~~~W~l~dl~~~~fa~Ap~gGpIAV~r~p~~~~~~~--~a~~~I~If~~sG~lL~~   78 (829)
T KOG2280|consen    1 MAMKYPTAEWELLLDVFYRKQEIYFMKWPLTDLYYVYFACAPFGGPIAVTRSPSKLVPLY--SARPYIRIFNISGQLLGR   78 (829)
T ss_pred             CCCcCcccchhhhHhhhhhhhhhcccCCcccccceeEEEecccCCceEEEeccccccccc--ccceeEEEEeccccchHH
Confidence            788999999999999999999999999986689999999999999999999999999875  468999999999999999


Q ss_pred             EEecCCCCCeEEEeecCCCeEEEEEeCCeEEEEeCCCCcccc-CCCCCccccccCeEEEEEECCeEEEEecCCeEEEEec
Q 003205           81 TVWKNPGGRLIGMSWSEDQTLICVVQDGTVYRYNIHAELIEP-NASMGKECFEENVVECVFWGNGVVCVTEANRYFCMAD  159 (839)
Q Consensus        81 i~~~~~~~~I~~~~fs~de~Lv~v~~dGtv~l~~~~G~~~~~-~~g~~~~~~~~~V~~~~~~~~G~v~~t~~~~~~~v~~  159 (839)
                      +.|+.  +++++|+||.+|+|+||+.||+|++|++.|++.++ ++|.  |++..+|.+|++|.+|++++|.+++++.+++
T Consensus        79 ~~w~~--~~lI~mgWs~~eeLI~v~k~g~v~Vy~~~ge~ie~~svg~--e~~~~~I~ec~~f~~GVavlt~~g~v~~i~~  154 (829)
T KOG2280|consen   79 ILWKH--GELIGMGWSDDEELICVQKDGTVHVYGLLGEFIESNSVGF--ESQMSDIVECRFFHNGVAVLTVSGQVILING  154 (829)
T ss_pred             HHhcC--CCeeeecccCCceEEEEeccceEEEeecchhhhccccccc--ccccCceeEEEEecCceEEEecCCcEEEEcC
Confidence            99998  99999999999999999999999999999999654 5555  5568889999999999999999999999999


Q ss_pred             CCCceEEEcCCCCCC-CCCceEEEeCCCCCCCCcEEEEEEeCCeEEEEecCCcc----cccCCCceEEEECCCCcEEEEe
Q 003205          160 FATMKVCELARPEVE-ELPHCVAVIEPKYTMTGSVEVLIGTDAGILMLDEDGVQ----KVDDTLSQKMAVSPNGNFVACF  234 (839)
Q Consensus       160 ~~~~~~~~l~~~~~~-~~~~~w~vi~~~~S~~~~~~v~~s~d~tv~l~~~~~~~----~~~~~~i~~ia~Spng~~iA~~  234 (839)
                      ++.|..+.+++.|.. .+++||++++|.++++.-..|..++.--++..+....+    ....+.|..|++|||+++||++
T Consensus       155 ~~~~~~~~~~diP~~~~~~~~Wt~~~~~~~~~~ll~v~~~v~~~~~q~~~~~~q~~~~~~~~~~~~ki~VS~n~~~laLy  234 (829)
T KOG2280|consen  155 VEEPKLRKMPDIPYNELPKSCWTVFQPHRQSTILLDVDVAVGLHICQVEESRVQLHALSWPNSSVVKISVSPNRRFLALY  234 (829)
T ss_pred             CCcchhhhCCCCCCccCCCcceeEecCCCcceeEEeechhhhhcccceecccccccccCCCCceEEEEEEcCCcceEEEE
Confidence            999999999986643 45699999999665555444443333333444433333    1224779999999999999999


Q ss_pred             ecCCeEEEEecCCCCccccccCCCCCCCCceeeecCceEEEEecCEEEEEcCCCCceEeccCCCeEEeecCCceEEEccC
Q 003205          235 THDGRLVVNNTNFSSPVIDESCESALPPEQIAWCGMDSVLLYWNDMLVMVAPQAEPVQYFYDEPLVLIPECDGVRILSNS  314 (839)
Q Consensus       235 ~~~g~i~i~ssd~~~~l~e~~~~~~~~p~~~~WcG~d~vv~~~~~~l~lig~~~~~v~f~~~~~~~l~~E~DGvRIit~~  314 (839)
                      |.+|.||+.+.|+++++|||++....+|.||+|||||+|+++|++.+.++||.|++|.|+||..+++++|+|||||||++
T Consensus       235 t~~G~i~~vs~D~~~~lce~~~~~~~~p~qm~WcgndaVvl~~e~~l~lvgp~gd~V~f~yd~t~~l~~E~DGVRI~t~t  314 (829)
T KOG2280|consen  235 TETGKIWVVSIDLSQILCEFNCTDHDPPKQMAWCGNDAVVLSWEVNLMLVGPPGDSVQFYYDETAILSAEVDGVRIITST  314 (829)
T ss_pred             ecCCcEEEEecchhhhhhccCCCCCCchHhceeecCCceEEEEeeeEEEEcCCCCccccccCCCceeeeccCeeEEeccc
Confidence            99999999999999999999988888999999999999999999999999999999999999999999999999999999


Q ss_pred             cceeeeccchhhHhhhccCCCChhhhHHHHHHHHhccChhhHHHHHHhhhhHHHHHHHHHHHccccCCHHHHHHHHHHhc
Q 003205          315 SMEFLQRVPASTEQIFAIGSTSPAALLYDALDHFDRRSAKADENLRLIRASLPKAVEACIDAAGHEFDISRQRTLLRAAS  394 (839)
Q Consensus       315 ~~~~l~~Vp~~~~~vf~igS~~pga~L~~A~~~~~~~~~~a~e~lr~i~~~L~~AV~~CI~AA~~e~d~~~Qk~LL~AAs  394 (839)
                      ++|||++||.++++||+|||++|||+|++|+++|+.++++|||+|+.++++|.+||++||+||++||.|++||.||+|||
T Consensus       315 ~~EFl~rvp~~~enIF~igS~ePgA~L~eA~q~~e~~S~kade~L~~~~e~L~~aV~~CI~aA~~ef~pe~QK~LL~AAs  394 (829)
T KOG2280|consen  315 SHEFLQRVPAETENIFKIGSTEPGALLYEAFQKMEQKSGKADEYLSEIREDLYKAVDDCIEAACDEFQPEEQKSLLRAAS  394 (829)
T ss_pred             hHHHHHhCChhhhhHhhcCCCCchHHHHHHHHHHhhcchhhHHHHHHHHHHHHHHHHHHHHHhhhccCHHHHHHHHHHHh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhcccccccChhHHHHHhhhhhhhhccCCCCCcccccHHHHHhCChHHHHHHHHHcCChHHHHHHHHHhCCCh---hhHH
Q 003205          395 YGQAFCSNFQRDRIQEMCKTLRVLNAARDPEIGIPLSIQQYKSLTASVLIGRLINANCHLLALRISEYLGMNQ---EVVI  471 (839)
Q Consensus       395 fGk~f~~~~~~~~fv~~c~~LRvLn~lr~~~igi~lT~~Q~~~l~~~~li~rL~~r~~~~lA~~I~~~l~~~~---~~I~  471 (839)
                      |||.|+.++|+++|+.+|+.|||||++|.+.+|||||++||.+|+.+++|+||+.|++|.+|++||++|+.|.   ++||
T Consensus       395 fGk~~l~~~~~d~~~~v~~~lrVln~~r~~~~gIplT~~qy~~l~~~~vi~Rl~~r~~Y~vaIQva~~l~~p~~~~~~Vl  474 (829)
T KOG2280|consen  395 FGKASLRTPNPDEYMRVCRELRVLNALRDVRIGIPLTHEQYRHLSEEVVIDRLVDRHLYSVAIQVAKLLNLPESQGDRVL  474 (829)
T ss_pred             hcccccccCChHHHHHHHHHHHHHhhhcccccCccccHHHHhhhchhhhhHHHHhcchhHHHHHHHHHhCCccccccHHH
Confidence            9999999999999999999999999999999999999999999999999999999999999999999999999   8999


Q ss_pred             HHhHhhhhhhcCCCChHHHHHHHHHHhcc--CCCCCHHHHHHHHHHhCcHHHHHHHHhcCCCCCCchhhhhccCchHHHH
Q 003205          472 MHWACSKITASLAIPDVTLLEILLDKLKL--CKGISYAAVAAHADKSGRRKLAAMLVEHEPRSSKQVPLLLSIGEEDTAL  549 (839)
Q Consensus       472 ~~WA~~kI~~~~~~~D~~l~~~I~~kl~~--~~~is~~~IA~~A~~~gR~~LA~~Ll~~E~~~~~qV~lLl~~~~~~~AL  549 (839)
                      .|||+.|| ++++.+|+++++.|.+||+.  .|+|||++||++|+++||++||++|+++||+...|||+||+|++++.||
T Consensus       475 ~~Wa~~kI-~~~d~~d~~vld~I~~kls~~~~~~iSy~~iA~~Ay~~GR~~LA~kLle~E~~~~~qV~lLL~m~~~~~AL  553 (829)
T KOG2280|consen  475 LEWARRKI-KQSDKMDEEVLDKIDEKLSAKLTPGISYAAIARRAYQEGRFELARKLLELEPRSGEQVPLLLKMKDSSLAL  553 (829)
T ss_pred             HHHHHHHH-hccCccchHHHHHHHHHhcccCCCceeHHHHHHHHHhcCcHHHHHHHHhcCCCccchhHHHhccchHHHHH
Confidence            99999999 55689999999999999998  9999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHcCCchHHHHHHHHHHhhCChhHHHHHHhcChhHHHHHHHHHHhcCHHHHHHHHHhcCChhHHHHHHHHHHHhcCC
Q 003205          550 VKATESGDTDLVYLVIFHIWQKRPALEFFGMIQTRPLACDLFTVYARCYKHEFLKDFFLSTGQLQEVAFLLWKESWELGK  629 (839)
Q Consensus       550 ~~Ai~S~D~dLI~~vll~l~~~l~~~~f~~~l~~~p~a~~~~~~y~~~~~~~~L~~~~~~~~~~~e~a~~~l~~~~~~~~  629 (839)
                      .||++|||+|||++||+||++++..++|+++|+..|.|.++|..|+|+++...|+|||+|+|++.++|.++++..+..+.
T Consensus       554 ~kaies~d~~Li~~Vllhlk~~~~~s~l~~~l~~~p~a~~lY~~~~r~~~~~~l~d~y~q~dn~~~~a~~~~q~~~~~~~  633 (829)
T KOG2280|consen  554 KKAIESGDTDLIIQVLLHLKNKLNRSSLFMTLRNQPLALSLYRQFMRHQDRATLYDFYNQDDNHQALASFHLQASYAAET  633 (829)
T ss_pred             HHHHhcCCchhHHHHHHHHHHHHHHHHHHHHHHhchhhhHHHHHHHHhhchhhhhhhhhcccchhhhhhhhhhhhhhhhh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999887766


Q ss_pred             CCCCCCCCCCcchHHHHHHHHHhhhhhccccchHHHHHHHHHHHHHHHHHHHhhhccccccCCCHHHHHHHHHHcCCcch
Q 003205          630 NPMASNGSALHGPRIKRIEKAHSLFSETKEHTFESKAAEEHAKLLRIQHELEVSTKQAIFVDSSISDTIRTCIVLGNHRA  709 (839)
Q Consensus       630 ~~~~~~~~~~~~~k~~~L~~a~~~~~~~~~~~f~~~~~~~~~~Ll~~Q~~Le~~~~~~~f~~~Sl~~ti~~l~~~~~~k~  709 (839)
                      .+          +|...|+.|.+.|.++++..|++++++++++|+.+|..|+.+++. +|+|+||+|||.+|+..|+.+.
T Consensus       634 ~~----------~r~~~lk~~a~~~a~sk~~s~e~ka~ed~~kLl~lQ~~Le~q~~~-~f~dlSl~dTv~~li~~g~~k~  702 (829)
T KOG2280|consen  634 IE----------GRIPALKTAANAFAKSKEKSFEAKALEDQMKLLKLQRTLEDQFGG-SFVDLSLHDTVTTLILIGQNKR  702 (829)
T ss_pred             hc----------ccchhHHHHHHHHhhhhhhhhHHHHHHHHHHHHHHHHHHHHHhcc-ccccCcHHHHHHHHHHccchHH
Confidence            66          899999999999999999999999999999999999999999998 8999999999999999999999


Q ss_pred             HHhHHhHcCCChHHHHHHHHHHHHhCCChhHHHHhhccCCCCCCchHHHHHHHhcCCHHHHHHhhccCCCHHHHHHHHHH
Q 003205          710 AMKVKTEFKVSEKRWYWLKVFALATKRDWDALERFSKEKRPPIGYRPFVEACVDADEKGEALKYIPKLVDPRERAEAYAR  789 (839)
Q Consensus       710 a~~l~k~fkvsdkr~~~~kl~ala~~~~w~~L~~f~~~KKspIgyepfv~~~~~~~~~~ea~~yI~~i~d~~~r~~~~~~  789 (839)
                      |++|+++||||||||||+||.+|++.++|++|++|+++|||||||+|||++|+++||++||.|||+||++..+|+++|++
T Consensus       703 a~ql~~~FkipdKr~~wLk~~aLa~~~kweeLekfAkskksPIGy~PFVe~c~~~~n~~EA~KYiprv~~l~ekv~ay~~  782 (829)
T KOG2280|consen  703 AEQLKSDFKIPDKRLWWLKLTALADIKKWEELEKFAKSKKSPIGYLPFVEACLKQGNKDEAKKYIPRVGGLQEKVKAYLR  782 (829)
T ss_pred             HHHHHHhcCCcchhhHHHHHHHHHhhhhHHHHHHHHhccCCCCCchhHHHHHHhcccHHHHhhhhhccCChHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999998999999999


Q ss_pred             cCCHHHHHHHHHhcCCHHHHHHHHHHhcCChhH
Q 003205          790 IGMAKEAADAASQAKDGELLGRLKLTFAQNAAA  822 (839)
Q Consensus       790 ~~~~~~A~~~a~~~kd~~~L~~i~~~~~~~~~~  822 (839)
                      +|++++|+++|.++||...|.+++.+++.+++.
T Consensus       783 ~~~~~eAad~A~~~rd~~~L~ev~~~~~~~~~~  815 (829)
T KOG2280|consen  783 VGDVKEAADLAAEHRDGAELSEVLSKCTGAPDG  815 (829)
T ss_pred             hccHHHHHHHHHHhcChHHHHHHHHhcCCCCcc
Confidence            999999999999999999999999999755543

>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0645 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>KOG2096 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0645 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] Back     alignment and domain information
>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2096 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] Back     alignment and domain information
>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>KOG0294 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>KOG0641 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1273 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>PF09787 Golgin_A5: Golgin subfamily A member 5; InterPro: IPR019177 This entry represents a family of proteins involved in maintaining Golgi structure Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] Back     alignment and domain information
>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0294 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0270 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] Back     alignment and domain information
>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0269 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4328 consensus WD40 protein [Function unknown] Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription] Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] Back     alignment and domain information
>KOG0300 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only] Back     alignment and domain information
>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1272 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0300 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>KOG4677 consensus Golgi integral membrane protein [Intracellular trafficking, secretion, and vesicular transport; General function prediction only] Back     alignment and domain information
>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG0641 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0642 consensus Cell-cycle nuclear protein, contains WD-40 repeats [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only] Back     alignment and domain information
>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton] Back     alignment and domain information
>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG1408 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only] Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>KOG0302 consensus Ribosome Assembly protein [General function prediction only] Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1408 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only] Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0270 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0269 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown] Back     alignment and domain information
>KOG2139 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1963 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only] Back     alignment and domain information
>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1188 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>KOG0302 consensus Ribosome Assembly protein [General function prediction only] Back     alignment and domain information
>KOG1963 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair] Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG4328 consensus WD40 protein [Function unknown] Back     alignment and domain information
>KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription] Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton] Back     alignment and domain information
>KOG0649 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown] Back     alignment and domain information
>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0642 consensus Cell-cycle nuclear protein, contains WD-40 repeats [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>KOG4227 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only] Back     alignment and domain information
>KOG2139 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton] Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown] Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only] Back     alignment and domain information
>KOG1354 consensus Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown] Back     alignment and domain information
>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only] Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only] Back     alignment and domain information
>KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton] Back     alignment and domain information
>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG1273 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown] Back     alignment and domain information
>KOG1272 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0322 consensus G-protein beta subunit-like protein GNB1L, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG0649 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>KOG0322 consensus G-protein beta subunit-like protein GNB1L, contains WD repeats [General function prediction only] Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>KOG1188 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG3914 consensus WD repeat protein WDR4 [Function unknown] Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown] Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG4190 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3881 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only] Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton] Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG4227 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG3881 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>KOG4640 consensus Anaphase-promoting complex (APC), subunit 4 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3914 consensus WD repeat protein WDR4 [Function unknown] Back     alignment and domain information
>KOG4532 consensus WD40-like repeat containing protein [General function prediction only] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0280 consensus Uncharacterized conserved protein [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0280 consensus Uncharacterized conserved protein [Amino acid transport and metabolism] Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>KOG4547 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>KOG3621 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>PF14727 PHTB1_N: PTHB1 N-terminus Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1334 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>KOG4547 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>KOG2079 consensus Vacuolar assembly/sorting protein VPS8 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13934 ELYS: Nuclear pore complex assembly Back     alignment and domain information
>KOG1275 consensus PAB-dependent poly(A) ribonuclease, subunit PAN2 [Replication, recombination and repair] Back     alignment and domain information
>KOG4532 consensus WD40-like repeat containing protein [General function prediction only] Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus Back     alignment and domain information
>PF14649 Spatacsin_C: Spatacsin C-terminus Back     alignment and domain information
>KOG1811 consensus Predicted Zn2+-binding protein, contains FYVE domain [General function prediction only] Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>KOG2079 consensus Vacuolar assembly/sorting protein VPS8 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG1064 consensus RAVE (regulator of V-ATPase assembly) complex subunit RAV1/DMX protein, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>KOG4714 consensus Nucleoporin [Nuclear structure] Back     alignment and domain information
>KOG1409 consensus Uncharacterized conserved protein, contains WD40 repeats and FYVE domains [Function unknown] Back     alignment and domain information
>KOG1064 consensus RAVE (regulator of V-ATPase assembly) complex subunit RAV1/DMX protein, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>PLN00033 photosystem II stability/assembly factor; Provisional Back     alignment and domain information
>KOG1354 consensus Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>PF11635 Med16: Mediator complex subunit 16; InterPro: IPR021665 Mediator is a large complex of up to 33 proteins that is conserved from plants through fungi to humans - the number and representation of individual subunits varying with species [],[] Back     alignment and domain information
>KOG1409 consensus Uncharacterized conserved protein, contains WD40 repeats and FYVE domains [Function unknown] Back     alignment and domain information
>KOG2377 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF05935 Arylsulfotrans: Arylsulfotransferase (ASST); InterPro: IPR010262 This family consists of several bacterial arylsulphotransferase proteins Back     alignment and domain information
>KOG3621 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR01063 gyrA DNA gyrase, A subunit Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>KOG2395 consensus Protein involved in vacuole import and degradation [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1912 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>smart00036 CNH Domain found in NIK1-like kinases, mouse citron and yeast ROM1, ROM2 Back     alignment and domain information
>KOG1912 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query839
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-10
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 61.8 bits (149), Expect = 8e-10
 Identities = 88/608 (14%), Positives = 173/608 (28%), Gaps = 162/608 (26%)

Query: 291 VQYFYDEPL-VLIP------ECDGV-----RILSNSSMEFLQRVPASTEQIFAIGSTSPA 338
            QY Y + L V         +C  V      ILS   ++ +     +             
Sbjct: 14  HQYQYKDILSVFEDAFVDNFDCKDVQDMPKSILSKEEIDHIIMSKDAVSGTL-------- 65

Query: 339 ALLYDALDHFDRRSAKADENLRLIRASLPKAVEACIDAAGHEFDISRQRTLLRAASYGQA 398
             L+  L        +             K VE  +    ++F +S  +T  R  S    
Sbjct: 66  -RLFWTLLSKQEEMVQ-------------KFVEE-VLRINYKFLMSPIKTEQRQPS-MMT 109

Query: 399 FCSNFQRDRIQEMCKTLRVLNAARDPEIGIPLSIQQYKSLTASVLIGRLINANCHLLALR 458
                QRDR+              D ++    ++ + +         +L  A   LL LR
Sbjct: 110 RMYIEQRDRLY------------NDNQVFAKYNVSRLQ------PYLKLRQA---LLELR 148

Query: 459 ISEYL---GMNQEVVIMHWACSKITASLAIPDVTLLEILLDKLKLCK---GISYAAVA-A 511
            ++ +   G+            K    +A      L++ L     CK    I +  +   
Sbjct: 149 PAKNVLIDGVL--------GSGK--TWVA------LDVCLSYKVQCKMDFKIFWLNLKNC 192

Query: 512 HADKSGRRKLAAMLVEHEP----RSSKQVPLLLSIGEEDTALVKATESGDTDLVYLVIFH 567
           ++ ++    L  +L + +P    RS     + L I      L +  +S   +   LV+ +
Sbjct: 193 NSPETVLEMLQKLLYQIDPNWTSRSDHSSNIKLRIHSIQAELRRLLKSKPYENCLLVLLN 252

Query: 568 IWQKRPALEFFG-----MIQTRPLACDLFTVYARCYKHEFLKDFF--LSTGQLQEVAFLL 620
           +   + A   F      ++ TR        + A    H  L      L+  +++ +  L 
Sbjct: 253 VQNAK-AWNAFNLSCKILLTTRF-KQVTDFLSAATTTHISLDHHSMTLTPDEVKSL-LLK 309

Query: 621 W--KESWEL-----GKNPMASN--GSALHGPRIKRIEKAHSLFSETKEHTFESKAAEEHA 671
           +      +L       NP   +    ++    +   +    +  +      ES       
Sbjct: 310 YLDCRPQDLPREVLTTNPRRLSIIAESIR-DGLATWDNWKHVNCDKLTTIIESSLNVLEP 368

Query: 672 KLLRIQ-HELEVSTKQAIFVDSSISDTIRTCIVLGNHRAAMKVKTEFKVSEKRWYWLK-- 728
              R     L      ++F  S                          +    W+ +   
Sbjct: 369 AEYRKMFDRL------SVFPPS--------------------AHIPTILLSLIWFDVIKS 402

Query: 729 -VFALATK-RDWDALERFSKEKRPPIGYRPFVEACVDADEKGEALKYIPKLVDPRERAEA 786
            V  +  K   +  +E+  KE    I    ++E  V  + +    +    +VD     + 
Sbjct: 403 DVMVVVNKLHKYSLVEKQPKESTISI-PSIYLELKVKLENEYALHR---SIVDHYNIPKT 458

Query: 787 YARIGMAKEAAD------------AASQAKDGELLGR--LKLTFAQN---------AAAS 823
           +    +     D                 +   L     L   F +           A+ 
Sbjct: 459 FDSDDLIPPYLDQYFYSHIGHHLKNIEHPERMTLFRMVFLDFRFLEQKIRHDSTAWNASG 518

Query: 824 SIFDTLRD 831
           SI +TL+ 
Sbjct: 519 SILNTLQQ 526

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query839
2ymu_A577 WD-40 repeat protein; unknown function, two domain 99.86
2ymu_A577 WD-40 repeat protein; unknown function, two domain 99.86
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 99.83
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 99.83
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 99.82
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 99.81
3ow8_A321 WD repeat-containing protein 61; structural genomi 99.81
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 99.81
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 99.81
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 99.8
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 99.79
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 99.79
4g56_B357 MGC81050 protein; protein arginine methyltransfera 99.78
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 99.78
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 99.78
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 99.78
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 99.77
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 99.76
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 99.76
3ow8_A321 WD repeat-containing protein 61; structural genomi 99.76
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 99.75
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 99.75
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 99.74
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 99.74
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 99.74
4e54_B435 DNA damage-binding protein 2; beta barrel, double 99.74
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 99.74
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 99.73
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 99.73
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 99.73
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 99.73
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 99.73
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 99.72
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 99.72
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 99.72
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 99.72
2j04_A588 TAU60, YPL007P, hypothetical protein YPL007C; beta 99.72
2pm7_B297 Protein transport protein SEC13, protein transport 99.71
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 99.71
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 99.71
2j04_A588 TAU60, YPL007P, hypothetical protein YPL007C; beta 99.71
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 99.71
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 99.71
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 99.7
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 99.7
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 99.7
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 99.7
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 99.69
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 99.69
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 99.69
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 99.69
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 99.69
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 99.69
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 99.69
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 99.68
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 99.68
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 99.68
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 99.67
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 99.67
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 99.67
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 99.67
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 99.66
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 99.66
3jrp_A379 Fusion protein of protein transport protein SEC13 99.65
4g56_B357 MGC81050 protein; protein arginine methyltransfera 99.64
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 99.64
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 99.64
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 99.64
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 99.63
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 99.63
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 99.62
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 99.62
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 99.61
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 99.61
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 99.6
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 99.6
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 99.6
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 99.59
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 99.59
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 99.59
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.57
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 99.57
3jro_A753 Fusion protein of protein transport protein SEC13 99.56
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 99.56
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 99.56
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.55
2oaj_A902 Protein SNI1; WD40 repeat, beta propeller, endocyt 99.54
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 99.54
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.53
2pm7_B297 Protein transport protein SEC13, protein transport 99.52
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 99.51
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 99.51
2xyi_A430 Probable histone-binding protein CAF1; transcripti 99.5
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 99.5
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 99.5
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 99.49
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 99.49
4e54_B435 DNA damage-binding protein 2; beta barrel, double 99.49
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 99.49
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 99.49
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 99.49
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 99.49
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 99.49
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 99.48
3jrp_A379 Fusion protein of protein transport protein SEC13 99.47
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.47
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.45
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.45
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 99.44
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.44
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 99.43
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 99.42
2oaj_A902 Protein SNI1; WD40 repeat, beta propeller, endocyt 99.42
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 99.42
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 99.41
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.4
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.4
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 99.39
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 99.39
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 99.38
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.34
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 99.33
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.32
2xyi_A430 Probable histone-binding protein CAF1; transcripti 99.3
3jro_A753 Fusion protein of protein transport protein SEC13 99.3
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.29
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.28
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.24
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.21
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.21
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.19
1xfd_A723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.16
1k32_A 1045 Tricorn protease; protein degradation, substrate g 99.16
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.16
1k32_A1045 Tricorn protease; protein degradation, substrate g 99.13
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.13
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.12
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 99.1
1z68_A719 Fibroblast activation protein, alpha subunit; sepr 99.1
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.09
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.09
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 99.08
1xfd_A723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.04
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.03
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.01
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 98.98
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 98.93
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 98.93
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 98.92
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 98.92
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 98.91
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 98.9
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 98.9
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 98.86
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 98.82
1z68_A719 Fibroblast activation protein, alpha subunit; sepr 98.82
4a5s_A740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 98.82
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 98.81
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 98.81
4a5s_A740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 98.78
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 98.77
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 98.75
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 98.74
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 98.73
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 98.73
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 98.71
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 98.68
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 98.68
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 98.67
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 98.64
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 98.6
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 98.57
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 98.56
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 98.55
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 98.54
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 98.52
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 98.52
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 98.51
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 98.49
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 98.49
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 98.42
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 98.36
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 98.34
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 98.3
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 98.3
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 98.29
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 98.23
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 98.2
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 98.18
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 98.17
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 98.17
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 98.16
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 98.15
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 98.14
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 98.12
1xip_A388 Nucleoporin NUP159; beta-propeller, transport prot 98.09
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 98.05
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 98.02
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 97.93
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 97.92
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 97.88
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 97.88
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 97.83
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 97.81
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 97.8
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 97.77
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 97.76
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 97.61
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 97.56
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 97.52
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 97.48
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 97.45
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 97.39
2qe8_A343 Uncharacterized protein; structural genomics, join 97.31
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 97.24
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 97.18
1xip_A388 Nucleoporin NUP159; beta-propeller, transport prot 97.17
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 97.16
2p4o_A306 Hypothetical protein; putative lactonase, structur 97.12
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 97.12
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 97.09
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 97.07
2fp8_A322 Strictosidine synthase; six bladed beta propeller 97.0
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 96.93
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 96.92
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 96.9
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 96.81
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 96.76
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 96.45
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 96.37
2hz6_A369 Endoplasmic reticulum to nucleus signalling 1 isof 96.33
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 96.32
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 96.19
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 96.06
2qe8_A343 Uncharacterized protein; structural genomics, join 95.99
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 95.97
2ece_A462 462AA long hypothetical selenium-binding protein; 95.69
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 95.67
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 95.61
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 95.61
3v65_B386 Low-density lipoprotein receptor-related protein; 95.59
3v65_B386 Low-density lipoprotein receptor-related protein; 95.31
3p5b_L400 Low density lipoprotein receptor variant; B-propel 94.92
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 94.84
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 94.81
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 94.68
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 94.57
2xe4_A751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 94.42
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 94.0
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 93.91
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 93.72
2fp8_A322 Strictosidine synthase; six bladed beta propeller 93.67
3p5b_L400 Low density lipoprotein receptor variant; B-propel 93.65
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 93.56
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 93.53
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 93.52
2ece_A462 462AA long hypothetical selenium-binding protein; 93.47
3pbp_A452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 93.25
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 92.32
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 92.28
1kb0_A677 Quinohemoprotein alcohol dehydrogenase; beta-prope 92.07
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 91.98
2p4o_A306 Hypothetical protein; putative lactonase, structur 91.87
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 91.61
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 91.61
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 90.9
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 90.21
1yiq_A689 Quinohemoprotein alcohol dehydrogenase; electron t 90.2
2g8s_A353 Glucose/sorbosone dehydrogenases; bladed beta-prop 89.99
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 89.85
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 89.63
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 88.91
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 88.88
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 88.53
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 87.7
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 87.48
3das_A347 Putative oxidoreductase; aldose sugar dehydrogenas 87.37
1kb0_A677 Quinohemoprotein alcohol dehydrogenase; beta-prope 87.36
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 87.12
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 86.91
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 86.48
4a2l_A795 BT_4663, two-component system sensor histidine kin 86.3
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 86.1
4a0p_A628 LRP6, LRP-6, low-density lipoprotein receptor-rela 85.82
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 85.2
3kci_A389 Probable E3 ubiquitin-protein ligase HERC2; WD40, 84.81
2xe4_A751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 84.79
4a0p_A628 LRP6, LRP-6, low-density lipoprotein receptor-rela 84.71
1cru_A454 Protein (soluble quinoprotein glucose dehydrogena; 84.7
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 84.55
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 82.91
1yiq_A689 Quinohemoprotein alcohol dehydrogenase; electron t 81.9
2xzh_A365 Clathrin heavy chain 1; endocytosis, endocytosis i 81.73
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 81.51
1kv9_A668 Type II quinohemoprotein alcohol dehydrogenase; el 80.43
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 80.02
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
Probab=99.86  E-value=2.5e-20  Score=218.19  Aligned_cols=282  Identities=16%  Similarity=0.226  Sum_probs=223.7

Q ss_pred             CCCEEEEcCCCCeEEEEecCchhhhhhcccCCceEEEEcCCCCceeEEEecCCCCCeEEEeecCCCe-EEEEEeCCeEEE
Q 003205           34 SRNKVACAPFGGPIAVIRDDSKIVQLYAESALRKLRIFNSAGVLISETVWKNPGGRLIGMSWSEDQT-LICVVQDGTVYR  112 (839)
Q Consensus        34 ~~~~va~sp~Gg~IA~~~d~~k~~~~~~~~~~~~I~iy~~~G~ll~ti~~~~~~~~I~~~~fs~de~-Lv~v~~dGtv~l  112 (839)
                      ....++++|+|..+++..            .+++|++|+.+|+++.++..|.  +.|.++.|+|++. +++++.||+|++
T Consensus       264 ~v~~v~~~~d~~~l~~~~------------~d~~i~~w~~~~~~~~~~~~h~--~~v~~~~~~~~~~~l~t~~~d~~i~~  329 (577)
T 2ymu_A          264 SVNGVAFRPDGQTIASAS------------DDKTVKLWNRNGQLLQTLTGHS--SSVWGVAFSPDGQTIASASDDKTVKL  329 (577)
T ss_dssp             CEEEEEECTTSSEEEEEE------------TTSCEEEEETTSCEEEEECCCS--SCEEEEEECTTSSEEEEEETTSCEEE
T ss_pred             CEEEEEEcCCCCEEEEEe------------CCCEEEEEeCCCcEEEEEecCC--CCeEEEEECCCCCEEEEEeCCCeEEE
Confidence            345788999999999886            5799999999999999999998  9999999999987 579999999999


Q ss_pred             EeCCCCccccCCCCCccccccCeEEEEEECCeEEEEecCC-eEEEEecCCCceEEEcCCCCCCCCCceEEEeCCCCCCCC
Q 003205          113 YNIHAELIEPNASMGKECFEENVVECVFWGNGVVCVTEAN-RYFCMADFATMKVCELARPEVEELPHCVAVIEPKYTMTG  191 (839)
Q Consensus       113 ~~~~G~~~~~~~g~~~~~~~~~V~~~~~~~~G~v~~t~~~-~~~~v~~~~~~~~~~l~~~~~~~~~~~w~vi~~~~S~~~  191 (839)
                      |+..++......+|     ...|..+.++++|..+++... ....+++..+.....+..    ......++   .|||+|
T Consensus       330 w~~~~~~~~~~~~~-----~~~v~~~~~s~~g~~l~~~~~dg~v~~~~~~~~~~~~~~~----~~~~v~~~---~~s~dg  397 (577)
T 2ymu_A          330 WNRNGQHLQTLTGH-----SSSVWGVAFSPDGQTIASASDDKTVKLWNRNGQLLQTLTG----HSSSVRGV---AFSPDG  397 (577)
T ss_dssp             EETTSCEEEEECCC-----SSCEEEEEECTTSSEEEEEETTSEEEEEETTCCEEEEEEC----CSSCEEEE---EECTTS
T ss_pred             EeCCCCeeEEEeCC-----CCCEEEEEECCCCCEEEEEeCCCEEEEEcCCCCEEEEecC----CCCCeEEE---EECCCC
Confidence            99988876666677     677999999999988887643 344566665444444432    22222233   567799


Q ss_pred             cEEEEEEeCCeEEEEecCCcc----cccCCCceEEEECCCCcEEEEeecCCeEEEEecCCCCccccccCCCCCCCCceee
Q 003205          192 SVEVLIGTDAGILMLDEDGVQ----KVDDTLSQKMAVSPNGNFVACFTHDGRLVVNNTNFSSPVIDESCESALPPEQIAW  267 (839)
Q Consensus       192 ~~~v~~s~d~tv~l~~~~~~~----~~~~~~i~~ia~Spng~~iA~~~~~g~i~i~ssd~~~~l~e~~~~~~~~p~~~~W  267 (839)
                      +.++..+.|++|++|+.++..    ..+..+|..++|||||+++|+.+.||++.+|+.+ .+.+..+..+ ...+..++|
T Consensus       398 ~~l~~~~~d~~v~~~~~~~~~~~~~~~~~~~v~~~~~s~d~~~l~~~~~d~~v~~w~~~-~~~~~~~~~~-~~~v~~~~~  475 (577)
T 2ymu_A          398 QTIASASDDKTVKLWNRNGQLLQTLTGHSSSVWGVAFSPDDQTIASASDDKTVKLWNRN-GQLLQTLTGH-SSSVRGVAF  475 (577)
T ss_dssp             SCEEEEETTSEEEEECTTCCEEEEEECCSSCEEEEEECTTSSEEEEEETTSEEEEEETT-SCEEEEEECC-SSCEEEEEE
T ss_pred             CEEEEEeCCCEEEEEeCCCCEEEEecCCCCCeEEEEECCCCCEEEEEcCCCEEEEEECC-CCEEEEEcCC-CCCEEEEEE
Confidence            999999999999999988764    5688899999999999999999999999999865 4444445444 234555666


Q ss_pred             e---------cCceEEEEecC----EEEEEcCCCC--ceEeccCCCeEEeecCCc-eEEEccCcceeeeccchhhHhhhc
Q 003205          268 C---------GMDSVLLYWND----MLVMVAPQAE--PVQYFYDEPLVLIPECDG-VRILSNSSMEFLQRVPASTEQIFA  331 (839)
Q Consensus       268 c---------G~d~vv~~~~~----~l~lig~~~~--~v~f~~~~~~~l~~E~DG-vRIit~~~~~~l~~Vp~~~~~vf~  331 (839)
                      +         ++|..+..|+.    ...+.|+.+.  .+.|.+++..+++...|| ||||+.+ .+.++.+..|...|..
T Consensus       476 spd~~~las~~~d~~i~iw~~~~~~~~~~~~h~~~v~~l~~s~dg~~l~s~~~dg~v~lwd~~-~~~~~~~~~h~~~v~~  554 (577)
T 2ymu_A          476 SPDGQTIASASDDKTVKLWNRNGQLLQTLTGHSSSVRGVAFSPDGQTIASASDDKTVKLWNRN-GQLLQTLTGHSSSVWG  554 (577)
T ss_dssp             CTTSCEEEEEETTSEEEEEETTSCEEEEEECCSSCEEEEEECTTSSCEEEEETTSEEEEECTT-SCEEEEEECCSSCEEE
T ss_pred             cCCCCEEEEEeCCCEEEEEcCCCCEEEEEeCCCCCEEEEEEcCCCCEEEEEECcCEEEEEeCC-CCEEEEEcCCCCCEEE
Confidence            4         56777777863    3456777765  788999999999999999 9999975 7889999999999999


Q ss_pred             cCCCChhhhHHHH
Q 003205          332 IGSTSPAALLYDA  344 (839)
Q Consensus       332 igS~~pga~L~~A  344 (839)
                      +..++.|.+|+.+
T Consensus       555 ~~fs~dg~~l~s~  567 (577)
T 2ymu_A          555 VAFSPDGQTIASA  567 (577)
T ss_dssp             EEECTTSSCEEEE
T ss_pred             EEEcCCCCEEEEE
Confidence            9888888777654
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>3kci_A Probable E3 ubiquitin-protein ligase HERC2; WD40, RCC1, structural genomics consortium, SGC, coiled coil, metal-binding, phosphoprotein; 1.80A {Homo sapiens} Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query839
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 99.77
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 99.75
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 99.75
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 99.73
d1tbga_340 beta1-subunit of the signal-transducing G protein 99.72
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 99.71
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 99.71
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 99.69
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 99.68
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 99.67
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 99.67
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.63
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 99.62
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 99.54
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.54
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 99.53
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.52
d1tbga_340 beta1-subunit of the signal-transducing G protein 99.5
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.47
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.43
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.37
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.35
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.35
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.29
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 99.26
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.18
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.16
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.12
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.08
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.0
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.0
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 98.97
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 98.96
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 98.96
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 98.88
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 98.83
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 98.77
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 98.76
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 98.68
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 98.68
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 98.57
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 98.56
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 98.45
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 98.42
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 98.41
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 98.36
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 98.26
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 98.17
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 97.92
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 97.86
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 97.84
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 97.73
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 97.71
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 97.52
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 97.52
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 97.43
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 97.3
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 97.18
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 96.82
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 96.56
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 96.53
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 96.45
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 96.39
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 96.36
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 96.1
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 95.96
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 95.21
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 95.08
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 94.93
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 93.28
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 92.81
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 91.92
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 90.88
d1wp5a_323 Topoisomerase IV subunit A, ParC, C-terminal domai 86.15
d1suua_304 DNA gyrase A C-terminal domain {Lyme disease spiro 81.55
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Groucho/tle1, C-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.77  E-value=6.9e-17  Score=173.46  Aligned_cols=251  Identities=10%  Similarity=0.073  Sum_probs=180.7

Q ss_pred             CCCEEEEcCCCCeEEEEecCchhhhhhcccCCceEEEEcCCC----CceeEEE--ecCCCCCeEEEeecCCCe-EEEEEe
Q 003205           34 SRNKVACAPFGGPIAVIRDDSKIVQLYAESALRKLRIFNSAG----VLISETV--WKNPGGRLIGMSWSEDQT-LICVVQ  106 (839)
Q Consensus        34 ~~~~va~sp~Gg~IA~~~d~~k~~~~~~~~~~~~I~iy~~~G----~ll~ti~--~~~~~~~I~~~~fs~de~-Lv~v~~  106 (839)
                      ....++++|+|..||+..             ++.|+||+...    +.+....  .|.  +.|.++.|+||++ |++++.
T Consensus        53 ~V~~v~fs~~g~~latg~-------------dg~V~iWd~~~~~~~~~~~~~~~~~h~--~~I~~v~~s~dg~~l~s~~~  117 (337)
T d1gxra_          53 VVCAVTISNPTRHVYTGG-------------KGCVKVWDISHPGNKSPVSQLDCLNRD--NYIRSCKLLPDGCTLIVGGE  117 (337)
T ss_dssp             CCCEEEECSSSSEEEEEC-------------BSEEEEEETTSTTCCSCSEEEECSCTT--SBEEEEEECTTSSEEEEEES
T ss_pred             cEEEEEECCCCCEEEEEE-------------CCEEEEEEccCCcccceeEEeeecCCC--CcEEEEEEcCCCCEEEEeec
Confidence            567999999999999874             57899998532    3444443  344  7899999999997 679999


Q ss_pred             CCeEEEEeCCCC---ccccCCCCCccccccCeEEEEEECCeEEEEecCC-eEEEEecCCCceEEEcCCCCCCCCCceEEE
Q 003205          107 DGTVYRYNIHAE---LIEPNASMGKECFEENVVECVFWGNGVVCVTEAN-RYFCMADFATMKVCELARPEVEELPHCVAV  182 (839)
Q Consensus       107 dGtv~l~~~~G~---~~~~~~g~~~~~~~~~V~~~~~~~~G~v~~t~~~-~~~~v~~~~~~~~~~l~~~~~~~~~~~w~v  182 (839)
                      ||+|++|++...   ......+|     ...|..+.+.++|..+++.+. ....+++..+........   +.....+++
T Consensus       118 dg~i~iwd~~~~~~~~~~~~~~~-----~~~v~~~~~~~~~~~l~s~~~d~~i~~~~~~~~~~~~~~~---~~~~~v~~l  189 (337)
T d1gxra_         118 ASTLSIWDLAAPTPRIKAELTSS-----APACYALAISPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQ---GHTDGASCI  189 (337)
T ss_dssp             SSEEEEEECCCC--EEEEEEECS-----SSCEEEEEECTTSSEEEEEETTSCEEEEETTTTEEEEEEC---CCSSCEEEE
T ss_pred             ccccccccccccccccccccccc-----cccccccccccccccccccccccccccccccccccccccc---ccccccccc
Confidence            999999987532   33334445     556888888888877777543 234455555444333221   122233333


Q ss_pred             eCCCCCCCCcEEEEEEeCCeEEEEecCCcc----cccCCCceEEEECCCCcEEEEeecCCeEEEEecCCCCccccccCCC
Q 003205          183 IEPKYTMTGSVEVLIGTDAGILMLDEDGVQ----KVDDTLSQKMAVSPNGNFVACFTHDGRLVVNNTNFSSPVIDESCES  258 (839)
Q Consensus       183 i~~~~S~~~~~~v~~s~d~tv~l~~~~~~~----~~~~~~i~~ia~Spng~~iA~~~~~g~i~i~ssd~~~~l~e~~~~~  258 (839)
                         .|++++..++..+.|+++++|+.....    ..+.++|..++++|+|+++|+++.+|.+.+|+.+..+....+ .+ 
T Consensus       190 ---~~s~~~~~~~~~~~d~~v~i~d~~~~~~~~~~~~~~~i~~l~~~~~~~~l~~~~~d~~i~i~d~~~~~~~~~~-~~-  264 (337)
T d1gxra_         190 ---DISNDGTKLWTGGLDNTVRSWDLREGRQLQQHDFTSQIFSLGYCPTGEWLAVGMESSNVEVLHVNKPDKYQLH-LH-  264 (337)
T ss_dssp             ---EECTTSSEEEEEETTSEEEEEETTTTEEEEEEECSSCEEEEEECTTSSEEEEEETTSCEEEEETTSSCEEEEC-CC-
T ss_pred             ---cccccccccccccccccccccccccceeecccccccceEEEEEcccccccceecccccccccccccccccccc-cc-
Confidence               456699999999999999999977543    456788999999999999999999999999997755554322 22 


Q ss_pred             CCCCCceeee---------cCceEEEEecC----EEEEEcCCCC--ceEeccCCCeEEeecCCc-eEEEc
Q 003205          259 ALPPEQIAWC---------GMDSVLLYWND----MLVMVAPQAE--PVQYFYDEPLVLIPECDG-VRILS  312 (839)
Q Consensus       259 ~~~p~~~~Wc---------G~d~vv~~~~~----~l~lig~~~~--~v~f~~~~~~~l~~E~DG-vRIit  312 (839)
                      ...+..+.|.         |.|..+..|+-    .+...++.+.  ++.|.+++..+++..-|| ||||.
T Consensus       265 ~~~i~~v~~s~~g~~l~s~s~Dg~i~iwd~~~~~~~~~~~~~~~v~~~~~s~d~~~l~t~s~D~~I~vWd  334 (337)
T d1gxra_         265 ESCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISVDDKYIVTGSGDKKATVYE  334 (337)
T ss_dssp             SSCEEEEEECTTSSEEEEEETTSEEEEEETTTCCEEEEEECSSCEEEEEECTTSCEEEEEETTSCEEEEE
T ss_pred             ccccceEEECCCCCEEEEEeCCCeEEEEECCCCCEEEEccCCCCEEEEEEeCCCCEEEEEeCCCeEEEEE
Confidence            2345566664         56777777852    5666666655  678988898888888999 99995
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wp5a_ b.68.10.1 (A:) Topoisomerase IV subunit A, ParC, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1suua_ b.68.10.1 (A:) DNA gyrase A C-terminal domain {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]} Back     information, alignment and structure