Citrus Sinensis ID: 003262

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-----
MDDELNVLPISSHIRSITAVPVKEDSEGLSEAERDLKDLKEQLCDDFPVGPLIKKCSTLDQGKAVITFLDAILDKTLRSTVALLAARGRGKSAALGLAIAGAIAAGYSNIFVTAPSPENLKTLFEFVCKGFNAIEYKEHIDYDIVRSSNPDLRKPIVRINIYRQHRQTIQYMEPHEHEKLAQVELLVIDEAAAIPLPVVRSLLGPYLVFLSSTVNGYEGTGRSLSLKLLHQLEQQSHMPAKGVEGSAHGCLFKKIELSESIRYAPGDPIESWLNGLLCLDVMNSIPHINRLPPPSECDLYYVNRDTLFSYHKESELFLQRMMALYVSSHYKNSPNDLQLMADAPAHHLFVLLGPVDESKNQLPDILCVIQVCLEGQISRRSVLKSFSEGHQPSGDQIPWKFSEQFRDAVFPSLSGARIVRIATHPSAMRLGYGSTAVELLTRYYEGQLTTFSEIDVEDTVETPEVRVTEAAKKVSLLEENIKPKTNLPPLLVHLRERQPEKLNYIGVSFGLTLDLFRFWRKHKFAPFYVSQNANAVTGEHTCMVLKPLHSEDIEVNESDEWGFFGPFYRDFKQRFFWLLVQHKLQRMDYKLLMSVLDPKINFKELDPRQDNSDKFLKSLTGVFSANDILRLKDYTNGLIEHYAILDLVPRLAHLYFQEKLPVTLSYVQAAVLLYIGMLGQDISCIQEQMKLEADRIFVLFRKVMTKLTDYLYEISSEEIKTAPPRLKEGAFEPHNISLDEDLNDGAEQFEEGMKTKMEGLLNPELLQQYAIVDKNADLEKALQSGGGKIAAGGVISVKSSKSKIDKPAKHKESHQSGKKRNKDVSGSKSNKKRKS
ccccccccccccccccccccccccccccccHHHHcHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHcccccEEEEEEccccccHHHHHHHHHHHHHcccccEEEEcccHHHHHHHHHHHHHcccccccccccccccEEccccccccccEEEEEEEcccEEEEEEccccccccccccEEEEcccccccHHHHHHHHcccEEEEEEcccccccccccHHHHHHHHHHHHccccccccccccccccEEEEEEEccccccccccHHHHHHHHHcccccccccccccccccccccEEEEccccccccccccHHHHHHHHHHHHHccccccHHHHHHHHcccccEEEEEEccccccccccccEEEEEEEEccccccHHHHHHHHccccccccccHHHHHHHHHcccccccccccEEEEEEcccccccccHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHcccccccccccccHHHHHHHHHHccccccEEEEcccccHHHHHHHHHccccEEEEEccccccccccEEEEEcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHcccccccccccccccccHHHHHHHcccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHccccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHcccccccccEEEEEccccccccccccccccccccccccccccccccccccc
ccccccEEEcccccccccccccccccccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEccccccHHHHHHHHHHHHHHccccEEEEEcccHHHHHHHHHHHHHHHHHccccHccccEEEEccccccccEEEEEEEEccccEEEEEEcccHHHHHcccEEEEEHHHHHccHHHHHHHccccEEEEEEcccccccccHHHHHHHHHHHHHHcccccccccccccccEEEEEEEcccEEcccccHHHHHHHHHHccccccccccccccccccccEEEEEccccHHcccHHHHHHHHHHHHHHHHHHccccccHHHHHccccccEEEEEEccccccccccccEEEEEEEEEcccccHHHHHHHHHcccccccccccHHHHHHccccHHHcccccEEEEEEccccHcccccHHHHHHHHHHHHccccccccccccccccccccccccHHHHHccccHcccccHcccccHHHcccccccccccEEEEEccccHHHHHHHHHccccEEEEEEcccccccccEEEEEEEccccccccccccccHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHcccccccccccccccHHHHHHHccHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHccccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHcccccHHccHHHHHHHHHHHHHHHHHHHHHHHHccccccHEEEcccHHHHHHHHHHHccccccccEEEEEcccccccccccccHHHHcccccccccccccccccccc
mddelnvlpisshirsitavpvkedseglSEAERDLKDLKEqlcddfpvgplikkcstlDQGKAVITFLDAILDKTLRSTVALLAARGRGKSAALGLAIAGAIAAgysnifvtapspenlKTLFEFVCKGfnaieykehidydivrssnpdlrkpivrINIYRQHRQTiqymephehekLAQVELLVIDeaaaiplpvvrSLLGPYLVFLSStvngyegtgrSLSLKLLHQLEQqshmpakgvegsahgclfkkielsesiryapgdpieswLNGLlcldvmnsiphinrlpppsecdlyyvnrDTLFSYHKESELFLQRMMALYVSshyknspndlqlmadapAHHLFVLlgpvdesknqlpdILCVIQVCLEGQISRRSVLKsfseghqpsgdqipwkfSEQFrdavfpslsgaRIVRiathpsamrlgygSTAVELLTRYYEgqlttfseidvedtvetpeVRVTEAAKKVSLLEenikpktnlpplLVHLRERQPEKLNYIGVSFGLTLDLFRFWrkhkfapfyvsqnanavtgehtcmvlkplhsedievnesdewgffgpfyrDFKQRFFWLLVQHKLQRMDYKLLMSVldpkinfkeldprqdnsDKFLKSLtgvfsandilRLKDYTNGLIEHYAILDLVPRLAHLYFQEKLPVTLSYVQAAVLLYIGMLGQDISCIQEQMKLEADRIFVLFRKVMTKLTDYLYEISSeeiktapprlkegafephnisldedlnDGAEQFEEGMKTKMEGLLNPELLQQYAIVDKNADLEKALQsgggkiaaggvisvksskskidkpakhkeshqsgkkrnkdvsgsksnkkrks
mddelnvlpisshirsitavpvkedsegLSEAERDLKDLKEQLCDDFPVGPLIKKCSTLDQGKAVITFLDAILDKTLRSTVALLAARGRGKSAALGLAIAGAIAAGYSNIFVTAPSPENLKTLFEFVCKGFNAIEykehidydivrssnpdlrkpivrINIYRQHRQTIQYMEPHEHEKLAQVELLVIDEAAAIPLPVVRSLLGPYLVFLSSTVNGYEGTGRSLSLKLLHQLEQQSHMPAKGVEGSAHGCLFKKIELSESIRYAPGDPIESWLNGLLCLDVMNSIPHINRLPPPSECDLYYVNRDTLFSYHKESELFLQRMMALYVSSHYKNSPNDLQLMADAPAHHLFVLLGPVDESKNQLPDILCVIQVCLEGQISRRSVLKSFSEGHQPSGDQIPWKFSEQFRDAVFPSLSGARIVRiathpsamrlgYGSTAVELLTRYYEGQlttfseidvedtvetpevrVTEAAKkvslleenikpktnlpplLVHLRERQPEKLNYIGVSFGLTLDLFRFWRKHKFAPFYVSQNANAVTGEHTCMVLKPLHSEDIEVNESDEWGFFGPFYRDFKQRFFWLLVQHKLQRMDYKLLMSVLDPKINFKELDPRQDNSDKFLKSltgvfsandiLRLKDYTNGLIEHYAILDLVPRLAHLYFQEKLPVTLSYVQAAVLLYIGMLGQDISCIQEQMKLEADRIFVLFRKVMTKLTDYLYEISseeiktapprlkEGAFEPHNISLDEDLNDGAEQFEEGMKTKMEGLLNPELLQQYAIVDKNADLEKALQSgggkiaaggvisvksskskidkpakhkeshqsgkkrnkdvsgsksnkkrks
MDDELNVLPISSHIRSITAVPVKEDSEGLSEAERDLKDLKEQLCDDFPVGPLIKKCSTLDQGKAVITFLDAILDKTLRSTVALLAARGRGKSaalglaiagaiaagYSNIFVTAPSPENLKTLFEFVCKGFNAIEYKEHIDYDIVRSSNPDLRKPIVRINIYRQHRQTIQYMEPHEHEKLAQVELLVIDEAAAIPLPVVRSLLGPYLVFLSSTVNGYEGTGRSLSLKLLHQLEQQSHMPAKGVEGSAHGCLFKKIELSESIRYAPGDPIESWLNGLLCLDVMNSIPHINRLPPPSECDLYYVNRDTLFSYHKESELFLQRMMALYVSSHYKNSPNDLQLMADAPAHHLFVLLGPVDESKNQLPDILCVIQVCLEGQISRRSVLKSFSEGHQPSGDQIPWKFSEQFRDAVFPSLSGARIVRIATHPSAMRLGYGSTAVELLTRYYEGQLTTFSEIDVEDTVETPEVRVTEAAKKVSLLEENIKPKTNLPPLLVHLRERQPEKLNYIGVSFGLTLDLFRFWRKHKFAPFYVSQNANAVTGEHTCMVLKPLHSEDIEVNESDEWGFFGPFYRDFKQRFFWLLVQHKLQRMDYKLLMSVLDPKINFKELDPRQDNSDKFLKSLTGVFSANDILRLKDYTNGLIEHYAILDLVPRLAHLYFQEKLPVTLSYVQAAVLLYIGMLGQDISCIQEQMKLEADRIFVLFRKVMTKLTDYLYEISSEEIKTAPPRLKEGAFEPHNISLDEDLNDGAEQFEEGMKTKMEGLLNPELLQQYAIVDKNADLEKALQSGGGKIAAGGvisvksskskidkPAKHKESHQSGKKRNKDVSGSKSNKKRKS
****************************************EQLCDDFPVGPLIKKCSTLDQGKAVITFLDAILDKTLRSTVALLAARGRGKSAALGLAIAGAIAAGYSNIFVTAPSPENLKTLFEFVCKGFNAIEYKEHIDYDIVRSSNPDLRKPIVRINIYRQHRQTIQYMEPHEHEKLAQVELLVIDEAAAIPLPVVRSLLGPYLVFLSSTVNGYEGTGRSLSLKLLHQ*************GSAHGCLFKKIELSESIRYAPGDPIESWLNGLLCLDVMNSIPHINRLPPPSECDLYYVNRDTLFSYHKESELFLQRMMALYVSSHYKNSPNDLQLMADAPAHHLFVLLGPVDESKNQLPDILCVIQVCLEGQISRRSVL*************IPWKFSEQFRDAVFPSLSGARIVRIATHPSAMRLGYGSTAVELLTRYYEGQLTTFSEIDVEDTVETPEVRVTEAAKKVSLLEENIK*KTNLPPLLVHLRERQPEKLNYIGVSFGLTLDLFRFWRKHKFAPFYVSQNANAVTGEHTCMVLKPLHSEDIEVNESDEWGFFGPFYRDFKQRFFWLLVQHKLQRMDYKLLMSVLDPKINFKEL********KFLKSLTGVFSANDILRLKDYTNGLIEHYAI********HLYFQEKLPVTLSYVQAAVLLYIGMLGQDISCIQEQMKLEADRIFVLFRKVMTKLTDYLYEIS*********************************************LNPELLQQYAIVDKNAD**********************************************************
MDDELNVLPISSH*********************************FPVGPLIKKCSTLDQGKAVITFLDAILDKTLRSTVALLAARGRGKSAALGLAIAGAIAAGYSNIFVTAPSPENLKTLFEFVCKGFNAIEYKEHIDYDIVRSSNPDLRKPIVRINIYRQHRQTIQYMEPHEHEKLAQVELLVIDEAAAIPLPVVRSLLGPYLVFLSSTVNGYEGTGRSLSLKLLHQL***************HGCLFKKIELSESIRYAPGDPIESWLNGLLCLDVMNSIPHINRLPPPSECDLYYVNRDTLFSYHKESELFLQRMMALYVSSHYKNSPNDLQLMADAPAHHLFVLLGPVDESKNQLPDILCVIQVCLEGQISRRSVLK****GHQPSGDQIPWKFSEQFRDAVFPSLSGARIVRIATHPSAMRLGYGSTAVELLTRYYEGQLTTFSEIDVEDTVETPEV**TEA***********KPKTNLPPLLVHLRERQPEKLNYIGVSFGLTLDLFRFWRKHKFAPFYVSQNANAVTGEHTCMVLKPLHSEDIEVNESDEWGFFGPFYRDFKQRFFWLLVQHKLQRMDYKLLMSVLDPKINFKE****QDNSDKFLKSLTGVFSANDILRLKDYTNGLIEHYAILDLVPRLAHLYFQEKLPVTLSYVQAAVLLYIGMLGQDISCIQEQMKLEADRIFVLFRKVMTKLTDYLYEI***************************************************LQQYAIVDKNADL*********************************************************
MDDELNVLPISSHIRSITAV***********AERDLKDLKEQLCDDFPVGPLIKKCSTLDQGKAVITFLDAILDKTLRSTVALLAARGRGKSAALGLAIAGAIAAGYSNIFVTAPSPENLKTLFEFVCKGFNAIEYKEHIDYDIVRSSNPDLRKPIVRINIYRQHRQTIQYMEPHEHEKLAQVELLVIDEAAAIPLPVVRSLLGPYLVFLSSTVNGYEGTGRSLSLKLLHQLEQQSHMPAKGVEGSAHGCLFKKIELSESIRYAPGDPIESWLNGLLCLDVMNSIPHINRLPPPSECDLYYVNRDTLFSYHKESELFLQRMMALYVSSHYKNSPNDLQLMADAPAHHLFVLLGPVDESKNQLPDILCVIQVCLEGQISRRSVLKSFSEGHQPSGDQIPWKFSEQFRDAVFPSLSGARIVRIATHPSAMRLGYGSTAVELLTRYYEGQLTTFSEIDVEDTVETPEVRVTEAAKKVSLLEENIKPKTNLPPLLVHLRERQPEKLNYIGVSFGLTLDLFRFWRKHKFAPFYVSQNANAVTGEHTCMVLKPLHSEDIEVNESDEWGFFGPFYRDFKQRFFWLLVQHKLQRMDYKLLMSVLDPKINFKELDPRQDNSDKFLKSLTGVFSANDILRLKDYTNGLIEHYAILDLVPRLAHLYFQEKLPVTLSYVQAAVLLYIGMLGQDISCIQEQMKLEADRIFVLFRKVMTKLTDYLYEISSEEIKTAPPRLKEGAFEPHNISLDEDLNDGAEQFEEGMKTKMEGLLNPELLQQYAIVDKNADLEKALQSGGGKIAAGGVISVK*************************************
****LNVLPISSHIRSITAV********LSEAERDLKDLKEQLCDDFPVGPLIKKCSTLDQGKAVITFLDAILDKTLRSTVALLAARGRGKSAALGLAIAGAIAAGYSNIFVTAPSPENLKTLFEFVCKGFNAIEYKEHIDYDIVRSSNPDLRKPIVRINIYRQHRQTIQYMEPHEHEKLAQVELLVIDEAAAIPLPVVRSLLGPYLVFLSSTVNGYEGTGRSLSLKLLHQLEQQS************GCLFKKIELSESIRYAPGDPIESWLNGLLCLDVMNSIPHINRLPPPSECDLYYVNRDTLFSYHKESELFLQRMMALYVSSHYKNSPNDLQLMADAPAHHLFVLLGPVDESKNQLPDILCVIQVCLEGQISRRSVLKSFSEGHQPSGDQIPWKFSEQFRDAVFPSLSGARIVRIATHPSAMRLGYGSTAVELLTRYYEGQLTT*************************LLEENIKPKTNLPPLLVHLRERQPEKLNYIGVSFGLTLDLFRFWRKHKFAPFYVSQNANAVTGEHTCMVLKPLHSEDIEVNESDEWGFFGPFYRDFKQRFFWLLVQHKLQRMDYKLLMSVLDPKIN**********SDKFLKSLTGVFSANDILRLKDYTNGLIEHYAILDLVPRLAHLYFQEKLPVTLSYVQAAVLLYIGMLGQDISCIQEQMKLEADRIFVLFRKVMTKLTDYLYEISSEEIKTAPPRLKEGAFEPHNISLDEDLNDGAEQFEEGMKTKMEGLLNPELLQQYAIVDKNADLEKALQSGG*************************************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDDELNVLPISSHIRSITAVPxxxxxxxxxxxxxxxxxxxxxLCDDFPVGPLIKKCSTLDQGKAVITFLDAILDKTLRSTVALLAARGRGKSAALGLAIAGAIAAGYSNIFVTAPSPENLKTLFEFVCKGFNAIEYKEHIDYDIVRSSNPDLRKPIVRINIYRQHRQTIQYMEPHEHEKLAQVELLVIDEAAAIPLPVVRSLLGPYLVFLSSTVNGYEGTGRSLSLKLLHQLEQQSHMPAKGVEGSAHGCLFKKIELSESIRYAPGDPIESWLNGLLCLDVMNSIPHINRLPPPSECDLYYVNRDTLFSYHKESELFLQRMMALYVSSHYKNSPNDLQLMADAPAHHLFVLLGPVDESKNQLPDILCVIQVCLEGQISRRSVLKSFSEGHQPSGDQIPWKFSEQFRDAVFPSLSGARIVRIATHPSAMRLGYGSTAVELLTRYYEGQLTTFSEIDVEDTVETPEVRVTEAAKKVSLLEENIKPKTNLPPLLVHLRERQPEKLNYIGVSFGLTLDLFRFWRKHKFAPFYVSQNANAVTGEHTCMVLKPLHSEDIEVNESDEWGFFGPFYRDFKQRFFWLLVQHKLQRMDYKLLMSVLDPKINFKELDPRQDNSDKFLKSLTGVFSANDILRLKDYTNGLIEHYAILDLVPRLAHLYFQEKLPVTLSYVQAAVLLYIGMLGQDISCIQEQMKLEADRIFVLFRKVMTKLTDYLYEISSEEIKTAPPRLKEGAFEPHNISLDEDLNDGAEQFEEGMKTKMEGLLNPELLQQYAIVDKNADLEKALQSGGGKIAAGGVISVKSSKSKIDKPAKHKESHQSGKKRNKDVSGSKSNKKRKS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query835 2.2.26 [Sep-21-2011]
Q9XIK41028 UPF0202 protein At1g10490 yes no 0.991 0.805 0.700 0.0
Q9M2Q41028 UPF0202 protein At3g57940 no no 0.925 0.751 0.703 0.0
Q55EJ31057 N-acetyltransferase 10 ho yes no 0.928 0.733 0.465 0.0
P539141056 UPF0202 protein KRE33 OS= yes no 0.954 0.754 0.463 0.0
Q9H0A01025 N-acetyltransferase 10 OS yes no 0.962 0.784 0.470 0.0
Q8K2241024 N-acetyltransferase 10 OS yes no 0.974 0.794 0.470 0.0
P871151033 UPF0202 protein C20G8.09c yes no 0.960 0.776 0.462 0.0
O017571043 UPF0202 protein F55A12.8 yes no 0.952 0.762 0.426 0.0
Q9W3C11008 Polycomb protein l(1)G002 yes no 0.930 0.770 0.423 1e-174
P54008373 UPF0202 protein (Fragment N/A no 0.390 0.873 0.513 5e-90
>sp|Q9XIK4|U202A_ARATH UPF0202 protein At1g10490 OS=Arabidopsis thaliana GN=At1g10490 PE=2 SV=2 Back     alignment and function desciption
 Score = 1137 bits (2941), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 586/837 (70%), Positives = 687/837 (82%), Gaps = 9/837 (1%)

Query: 1    MDDELNVLPISSHIRSITAVPVKEDSEGLSEAERDLKDLKEQLCDDFPVGPLIKKCSTLD 60
            MDDELN+LP+SSHI+SIT VP KEDSE LSEAERDLK LK+ L DDFPVGPLI KC TLD
Sbjct: 199  MDDELNLLPLSSHIKSITKVPTKEDSEALSEAERDLKSLKDALNDDFPVGPLINKCCTLD 258

Query: 61   QGKAVITFLDAILDKTLRSTVALLAARGRGKSAALGLAIAGAIAAGYSNIFVTAPSPENL 120
            QGKAV+TF DAILDKTLRS VAL+A+RGRGKSAALGLA+AGA+AAGYSNI+VTAPSP+NL
Sbjct: 259  QGKAVVTFFDAILDKTLRSIVALIASRGRGKSAALGLAVAGAVAAGYSNIYVTAPSPDNL 318

Query: 121  KTLFEFVCKGFNAIEYKEHIDYDIVRSSNPDLRKPIVRINIYRQHRQTIQYMEPHEHEKL 180
            KT+FEFVCKGF+A+EYKEH++YD+VRS NP+  K IVRINI++QHRQTIQY++PHEHEKL
Sbjct: 319  KTVFEFVCKGFDALEYKEHLEYDVVRSVNPEFNKAIVRINIFKQHRQTIQYIQPHEHEKL 378

Query: 181  AQVELLVIDEAAAIPLPVVRSLLGPYLVFLSSTVNGYEGTGRSLSLKLLHQLEQQSHMPA 240
            +QVELLVIDEAAAIPLPVV+SLLGPYLVFLSSTV+GYEGTGRSLSLKLL QLE+QS  P 
Sbjct: 379  SQVELLVIDEAAAIPLPVVKSLLGPYLVFLSSTVSGYEGTGRSLSLKLLQQLEEQSRAPV 438

Query: 241  KGVEGSAHGCLFKKIELSESIRYAPGDPIESWLNGLLCLDVMNSIPHINRLPPPSECDLY 300
             GVEGS  GCLFKKIELSESIRYA GDPIESWLNGLLCLDV N +P+    P PS+CDLY
Sbjct: 439  TGVEGSLSGCLFKKIELSESIRYASGDPIESWLNGLLCLDVANCLPNPACHPLPSQCDLY 498

Query: 301  YVNRDTLFSYHKESELFLQRMMALYVSSHYKNSPNDLQLMADAPAHHLFVLLGPVDESKN 360
            YVNRDTLFSYHK+SELFLQRMMAL VSSHYKNSPNDLQL++DAPAHHLFVLLGPVDESKN
Sbjct: 499  YVNRDTLFSYHKDSELFLQRMMALCVSSHYKNSPNDLQLLSDAPAHHLFVLLGPVDESKN 558

Query: 361  QLPDILCVIQVCLEGQISRRSVLKSFSEGHQPSGDQIPWKFSEQFRDAVFPSLSGARIVR 420
            QLPDILCVIQVCLEGQISR+S  KS  EGH P GDQIPWKF EQFRD VFP LSGARIVR
Sbjct: 559  QLPDILCVIQVCLEGQISRKSAEKSLREGHSPHGDQIPWKFCEQFRDVVFPKLSGARIVR 618

Query: 421  IATHPSAMRLGYGSTAVELLTRYYEGQLTTFSEIDVEDTVETPEVRVTEAAKKVSLLEEN 480
            IA HP+AM++GYGS AVELLTRY+EGQL + SE D E  VE   VRVTEAA KVSLLEE 
Sbjct: 619  IAVHPNAMKMGYGSAAVELLTRYFEGQLASISEGDDELEVEPSPVRVTEAAAKVSLLEEQ 678

Query: 481  IKPKTNLPPLLVHLRERQPEKLNYIGVSFGLTLDLFRFWRKHKFAPFYVSQNANAVTGEH 540
            IKP+ NLPPLLV LR+R+PE+L+YIGVSFGLTLDLFRFWRKHKFAPFY+SQ  +AVTGEH
Sbjct: 679  IKPRANLPPLLVPLRDRRPERLHYIGVSFGLTLDLFRFWRKHKFAPFYISQIPSAVTGEH 738

Query: 541  TCMVLKP--LHSEDIEVNESDEWGFFGPFYRDFKQRFFWLLVQHKLQRMDYKLLMSVLDP 598
            TCM+LKP  L +++ EV+ESDE GFF PFY+DF+ RF  LL   K ++MDYKL MSVL+P
Sbjct: 739  TCMLLKPLTLSNDEFEVDESDELGFFAPFYKDFRIRFSKLL-SDKFKKMDYKLAMSVLNP 797

Query: 599  KINFKELDPRQDNSDKFLKSLTGVFSANDILRLKDYTNGLIEHYAILDLVPRLAHLYFQE 658
            KINF E+D   ++ D FLK L GV S  D+ R + YT  L++   + D+   LAH YFQE
Sbjct: 798  KINFPEVDLTGNSPDGFLKKLDGVLSPYDMERFRAYTANLVDFNLVYDICKTLAHHYFQE 857

Query: 659  KLPVTLSYVQAAVLLYIGMLGQDISCIQEQMKLEADRIFVLFRKVMTKLTDYLYEISSEE 718
            KLPV+LSYVQA+VLL +G+   D S I+ QM+LE  +I+ L  KV  KL  YL  I+++E
Sbjct: 858  KLPVSLSYVQASVLLCLGLQESDFSSIERQMQLERGQIYSLLLKVGKKLYKYLNGIATKE 917

Query: 719  IKTAPPRLKEGAFEPHNISLDEDLNDGAEQFEEGMKTKMEGLLNPELLQQYAIVDKNADL 778
            +++  PRLK+   EPH +S+DEDL +GA++ EE M+ ++E LL+PELL Q+AI DK A+ 
Sbjct: 918  LESTLPRLKDRVLEPHKVSVDEDLREGAKEVEEQMRARIEELLDPELLDQFAIGDKEAE- 976

Query: 779  EKALQSGGGKIAAGGVISVKSSKSKIDKPAKHKESHQSGKKRNKDVSGSKSNKKRKS 835
              ALQ    KI++ G+IS++S+K+  +K  K     +S KKR  D   S SNKKR++
Sbjct: 977  --ALQK--SKISSSGLISIESTKTD-NKKEKPSGFDKSAKKRGNDKHSSTSNKKRRA 1028

Arabidopsis thaliana (taxid: 3702)
>sp|Q9M2Q4|U202B_ARATH UPF0202 protein At3g57940 OS=Arabidopsis thaliana GN=At3g57940 PE=2 SV=2 Back     alignment and function description
>sp|Q55EJ3|NAT10_DICDI N-acetyltransferase 10 homolog OS=Dictyostelium discoideum GN=nat10 PE=3 SV=1 Back     alignment and function description
>sp|P53914|KRE33_YEAST UPF0202 protein KRE33 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KRE33 PE=1 SV=1 Back     alignment and function description
>sp|Q9H0A0|NAT10_HUMAN N-acetyltransferase 10 OS=Homo sapiens GN=NAT10 PE=1 SV=2 Back     alignment and function description
>sp|Q8K224|NAT10_MOUSE N-acetyltransferase 10 OS=Mus musculus GN=Nat10 PE=2 SV=1 Back     alignment and function description
>sp|P87115|YDK9_SCHPO UPF0202 protein C20G8.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC20G8.09c PE=3 SV=1 Back     alignment and function description
>sp|O01757|YIL8_CAEEL UPF0202 protein F55A12.8 OS=Caenorhabditis elegans GN=F55A12.8 PE=3 SV=1 Back     alignment and function description
>sp|Q9W3C1|U202_DROME Polycomb protein l(1)G0020 OS=Drosophila melanogaster GN=l(1)G0020 PE=1 SV=2 Back     alignment and function description
>sp|P54008|YXX1_ACHAM UPF0202 protein (Fragment) OS=Achlya ambisexualis PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query835
225438527 1032 PREDICTED: UPF0202 protein At1g10490 [Vi 0.984 0.796 0.767 0.0
356525549 1026 PREDICTED: UPF0202 protein At1g10490-lik 0.991 0.807 0.729 0.0
356512766 1029 PREDICTED: UPF0202 protein At1g10490-lik 0.990 0.803 0.725 0.0
449448426 1030 PREDICTED: UPF0202 protein At1g10490-lik 0.995 0.806 0.731 0.0
449515819 1030 PREDICTED: LOW QUALITY PROTEIN: UPF0202 0.995 0.806 0.730 0.0
224096374 1033 predicted protein [Populus trichocarpa] 0.988 0.798 0.735 0.0
110741536 1028 hypothetical protein [Arabidopsis thalia 0.991 0.805 0.700 0.0
15218552 1028 uncharacterized protein [Arabidopsis tha 0.991 0.805 0.700 0.0
5091541 1058 T10O24.10 [Arabidopsis thaliana] 0.991 0.782 0.675 0.0
297817124 1027 hypothetical protein ARALYDRAFT_486246 [ 0.928 0.754 0.703 0.0
>gi|225438527|ref|XP_002279361.1| PREDICTED: UPF0202 protein At1g10490 [Vitis vinifera] gi|296082521|emb|CBI21526.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score = 1272 bits (3291), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 632/823 (76%), Positives = 723/823 (87%), Gaps = 1/823 (0%)

Query: 1    MDDELNVLPISSHIRSITAVPVKEDSEGLSEAERDLKDLKEQLCDDFPVGPLIKKCSTLD 60
            MDDELN+LPISSHIRSITAVPVKEDSEGLSEAERDLK+LKEQL +DFPVGPLIKKC TLD
Sbjct: 199  MDDELNILPISSHIRSITAVPVKEDSEGLSEAERDLKNLKEQLNEDFPVGPLIKKCCTLD 258

Query: 61   QGKAVITFLDAILDKTLRSTVALLAARGRGKSAALGLAIAGAIAAGYSNIFVTAPSPENL 120
            QGKAVITFLDAILDK LRSTV  LAARGRGKSAALGLA+AGAIAAGYSNIFVTAPSP+NL
Sbjct: 259  QGKAVITFLDAILDKALRSTVVSLAARGRGKSAALGLAVAGAIAAGYSNIFVTAPSPDNL 318

Query: 121  KTLFEFVCKGFNAIEYKEHIDYDIVRSSNPDLRKPIVRINIYRQHRQTIQYMEPHEHEKL 180
            KTLFEF+CKGF+A+EYKEHIDYD+V+S+NP+ +K  VRINIYRQHRQTIQY++PHEHEKL
Sbjct: 319  KTLFEFICKGFDALEYKEHIDYDVVKSTNPEFKKATVRINIYRQHRQTIQYIQPHEHEKL 378

Query: 181  AQVELLVIDEAAAIPLPVVRSLLGPYLVFLSSTVNGYEGTGRSLSLKLLHQLEQQSHMPA 240
            +QVELLV+DEAAAIPLPVV+SLLGPYLVFLSSTVNGYEGTGRSLSLKLL QLE+QS MP 
Sbjct: 379  SQVELLVVDEAAAIPLPVVKSLLGPYLVFLSSTVNGYEGTGRSLSLKLLQQLEEQSQMPT 438

Query: 241  KGVEGSAHGCLFKKIELSESIRYAPGDPIESWLNGLLCLDVMNSIPHINRLPPPSECDLY 300
            K VE S  G LFKKIELSESIRYA GDPIESWLN LLCLDV NSIP+I+RLPPPSECDLY
Sbjct: 439  KSVENSLSGRLFKKIELSESIRYASGDPIESWLNTLLCLDVANSIPNISRLPPPSECDLY 498

Query: 301  YVNRDTLFSYHKESELFLQRMMALYVSSHYKNSPNDLQLMADAPAHHLFVLLGPVDESKN 360
            YVNRDTLFSYHK+SELFLQRMMALYV+SHYKNSPNDLQLMADAPAHHLFVLLGPVDESKN
Sbjct: 499  YVNRDTLFSYHKDSELFLQRMMALYVASHYKNSPNDLQLMADAPAHHLFVLLGPVDESKN 558

Query: 361  QLPDILCVIQVCLEGQISRRSVLKSFSEGHQPSGDQIPWKFSEQFRDAVFPSLSGARIVR 420
             LPDILCVIQVCLEG ISR+S +KS S+G QP GDQIPWKF EQF+D VFP+LSGARIVR
Sbjct: 559  HLPDILCVIQVCLEGHISRKSAIKSLSDGRQPFGDQIPWKFCEQFQDTVFPTLSGARIVR 618

Query: 421  IATHPSAMRLGYGSTAVELLTRYYEGQLTTFSEIDVEDTVETPEVRVTEAAKKVSLLEEN 480
            IATHPSAMRLGYGS AVELLTRY+EGQLT  SEIDVE+TVETP VRVTEAA+KVSLLEEN
Sbjct: 619  IATHPSAMRLGYGSAAVELLTRYFEGQLTPISEIDVENTVETPHVRVTEAAEKVSLLEEN 678

Query: 481  IKPKTNLPPLLVHLRERQPEKLNYIGVSFGLTLDLFRFWRKHKFAPFYVSQNANAVTGEH 540
            IKP+T+LP LLVHL ERQPEKL+YIGVSFGLTLDLFRFWR+HKFAPFY+ Q  + VTGEH
Sbjct: 679  IKPRTDLPHLLVHLHERQPEKLHYIGVSFGLTLDLFRFWRRHKFAPFYIGQIQSTVTGEH 738

Query: 541  TCMVLKPLHSEDIEVNESDEWGFFGPFYRDFKQRFFWLLVQHKLQRMDYKLLMSVLDPKI 600
            TCMVLKPL++++IEV+ SD+WGFFGPFY+DFK+RF  LL     + M+YKL MS+LDPKI
Sbjct: 739  TCMVLKPLNNDEIEVSGSDQWGFFGPFYQDFKRRFARLL-GASFRTMEYKLAMSILDPKI 797

Query: 601  NFKELDPRQDNSDKFLKSLTGVFSANDILRLKDYTNGLIEHYAILDLVPRLAHLYFQEKL 660
            NF++++P    S+ FL SL G+FS +D+ RL+ YTN L + + ILDLVP L H Y+QEKL
Sbjct: 798  NFQDVEPTMPPSNGFLTSLNGIFSPHDMKRLEAYTNNLADFHMILDLVPILVHQYYQEKL 857

Query: 661  PVTLSYVQAAVLLYIGMLGQDISCIQEQMKLEADRIFVLFRKVMTKLTDYLYEISSEEIK 720
            PVTLSY QA+VLL IG+  Q+IS I+ ++KLE  +I  LF K M KL  YLY I+S+EI+
Sbjct: 858  PVTLSYAQASVLLCIGLQNQNISYIEGEIKLERQQILSLFIKSMKKLHKYLYGIASKEIE 917

Query: 721  TAPPRLKEGAFEPHNISLDEDLNDGAEQFEEGMKTKMEGLLNPELLQQYAIVDKNADLEK 780
            +  PRL+E   EPH IS+DEDLND A+Q E+GMK K E LL+P+ LQQYAI D+ AD EK
Sbjct: 918  STLPRLREIVMEPHTISVDEDLNDAAKQVEDGMKAKTESLLDPDFLQQYAIADREADFEK 977

Query: 781  ALQSGGGKIAAGGVISVKSSKSKIDKPAKHKESHQSGKKRNKD 823
            ALQ+GGGK+ + G+ISVKSS++K++K  K ++SH+SG+KR+KD
Sbjct: 978  ALQNGGGKLPSSGLISVKSSRTKMEKHGKQEKSHKSGEKRSKD 1020

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356525549|ref|XP_003531387.1| PREDICTED: UPF0202 protein At1g10490-like [Glycine max] Back     alignment and taxonomy information
>gi|356512766|ref|XP_003525087.1| PREDICTED: UPF0202 protein At1g10490-like [Glycine max] Back     alignment and taxonomy information
>gi|449448426|ref|XP_004141967.1| PREDICTED: UPF0202 protein At1g10490-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449515819|ref|XP_004164945.1| PREDICTED: LOW QUALITY PROTEIN: UPF0202 protein At1g10490-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224096374|ref|XP_002310611.1| predicted protein [Populus trichocarpa] gi|222853514|gb|EEE91061.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|110741536|dbj|BAE98717.1| hypothetical protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|15218552|ref|NP_172519.1| uncharacterized protein [Arabidopsis thaliana] gi|322510079|sp|Q9XIK4.2|U202A_ARATH RecName: Full=UPF0202 protein At1g10490 gi|332190464|gb|AEE28585.1| uncharacterized protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|5091541|gb|AAD39570.1|AC007067_10 T10O24.10 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297817124|ref|XP_002876445.1| hypothetical protein ARALYDRAFT_486246 [Arabidopsis lyrata subsp. lyrata] gi|297322283|gb|EFH52704.1| hypothetical protein ARALYDRAFT_486246 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query835
TAIR|locus:21945791028 AT1G10490 [Arabidopsis thalian 0.989 0.803 0.680 5.5e-299
TAIR|locus:20958281028 AT3G57940 "AT3G57940" [Arabido 0.989 0.803 0.661 1.8e-293
ZFIN|ZDB-GENE-040426-15431025 nat10 "N-acetyltransferase 10" 0.919 0.749 0.474 6.5e-193
UNIPROTKB|E7ESU4953 NAT10 "N-acetyltransferase 10" 0.974 0.854 0.450 1.1e-192
UNIPROTKB|Q9H0A01025 NAT10 "N-acetyltransferase 10" 0.974 0.794 0.450 1.1e-192
UNIPROTKB|E2RBB41025 NAT10 "Uncharacterized protein 0.974 0.794 0.454 1.4e-192
UNIPROTKB|F1MPG71026 NAT10 "Uncharacterized protein 0.974 0.793 0.452 1.2e-191
SGD|S0000050761056 KRE33 "Protein required for bi 0.622 0.492 0.440 2.1e-191
UNIPROTKB|F1SGS71028 NAT10 "Uncharacterized protein 0.973 0.790 0.448 1.1e-190
MGI|MGI:21389391024 Nat10 "N-acetyltransferase 10" 0.922 0.751 0.469 1.4e-190
TAIR|locus:2194579 AT1G10490 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2870 (1015.3 bits), Expect = 5.5e-299, P = 5.5e-299
 Identities = 571/839 (68%), Positives = 664/839 (79%)

Query:     1 MDDELNVLPISSHIRSITAVPVKEDSEGLSEAERDLKDLKEQLCDDFPVGPLIKKCSTLD 60
             MDDELN+LP+SSHI+SIT VP KEDSE LSEAERDLK LK+ L DDFPVGPLI KC TLD
Sbjct:   199 MDDELNLLPLSSHIKSITKVPTKEDSEALSEAERDLKSLKDALNDDFPVGPLINKCCTLD 258

Query:    61 QGKAVITFLDAILDKTLRSTVALLAARGRGKSXXXXXXXXXXXXXXYSNIFVTAPSPENL 120
             QGKAV+TF DAILDKTLRS VAL+A+RGRGKS              YSNI+VTAPSP+NL
Sbjct:   259 QGKAVVTFFDAILDKTLRSIVALIASRGRGKSAALGLAVAGAVAAGYSNIYVTAPSPDNL 318

Query:   121 KTLFEFVCKGFNAIEYKEHIDYDIVRSSNPDLRKPIVRINIYRQHRQTIQYMEPHEHEKL 180
             KT+FEFVCKGF+A+EYKEH++YD+VRS NP+  K IVRINI++QHRQTIQY++PHEHEKL
Sbjct:   319 KTVFEFVCKGFDALEYKEHLEYDVVRSVNPEFNKAIVRINIFKQHRQTIQYIQPHEHEKL 378

Query:   181 AQVELLVIDEAAAIPLPVVRSLLGPYLVFLSSTVNGYEGTGRSLSLKLLHQLEQQSHMPA 240
             +QVELLVIDEAAAIPLPVV+SLLGPYLVFLSSTV+GYEGTGRSLSLKLL QLE+QS  P 
Sbjct:   379 SQVELLVIDEAAAIPLPVVKSLLGPYLVFLSSTVSGYEGTGRSLSLKLLQQLEEQSRAPV 438

Query:   241 KGVEGSAHGCLFKKIELSESIRYAPGDPIESWLNGLLCLDVMNSIPHINRLPPPSECDLY 300
              GVEGS  GCLFKKIELSESIRYA GDPIESWLNGLLCLDV N +P+    P PS+CDLY
Sbjct:   439 TGVEGSLSGCLFKKIELSESIRYASGDPIESWLNGLLCLDVANCLPNPACHPLPSQCDLY 498

Query:   301 YVNRDTLFSYHKESELFLQRMMALYVSSHYKNSPNDLQLMADAPAHHLFVLLGPVDESKN 360
             YVNRDTLFSYHK+SELFLQRMMAL VSSHYKNSPNDLQL++DAPAHHLFVLLGPVDESKN
Sbjct:   499 YVNRDTLFSYHKDSELFLQRMMALCVSSHYKNSPNDLQLLSDAPAHHLFVLLGPVDESKN 558

Query:   361 QLPDILCVIQVCLEGQISRRSVLKSFSEGHQPSGDQIPWKFSEQFRDAVFPSLSGARIVR 420
             QLPDILCVIQVCLEGQISR+S  KS  EGH P GDQIPWKF EQFRD VFP LSGARIVR
Sbjct:   559 QLPDILCVIQVCLEGQISRKSAEKSLREGHSPHGDQIPWKFCEQFRDVVFPKLSGARIVR 618

Query:   421 IATHPSAMRLGYGSTAVELLTRYYEGQLTTFSEIDVEDTVETPEVRVTEAAKKVSLLEEN 480
             IA HP+AM++GYGS AVELLTRY+EGQL + SE D E  VE   VRVTEAA KVSLLEE 
Sbjct:   619 IAVHPNAMKMGYGSAAVELLTRYFEGQLASISEGDDELEVEPSPVRVTEAAAKVSLLEEQ 678

Query:   481 IKPKTNLPPLLVHLRERQPEKLNYIGVSFGLTLDLFRFWRKHKFAPFYVSQNANAVTGEH 540
             IKP+ NLPPLLV LR+R+PE+L+YIGVSFGLTLDLFRFWRKHKFAPFY+SQ  +AVTGEH
Sbjct:   679 IKPRANLPPLLVPLRDRRPERLHYIGVSFGLTLDLFRFWRKHKFAPFYISQIPSAVTGEH 738

Query:   541 TCMVLKPL--HSEDIEVNESDEWGFFGPFYRDFKQRFFWLLVQHKLQRMDYKLLMSVLDP 598
             TCM+LKPL   +++ EV+ESDE GFF PFY+DF+ RF  LL   K ++MDYKL MSVL+P
Sbjct:   739 TCMLLKPLTLSNDEFEVDESDELGFFAPFYKDFRIRFSKLL-SDKFKKMDYKLAMSVLNP 797

Query:   599 KINFKELDPRQDNSDKFLKSLTGVFSANDILRLKDYTNGLIEHYAILDLVPRLAHLYFQE 658
             KINF E+D   ++ D FLK L GV S  D+ R + YT  L++   + D+   LAH YFQE
Sbjct:   798 KINFPEVDLTGNSPDGFLKKLDGVLSPYDMERFRAYTANLVDFNLVYDICKTLAHHYFQE 857

Query:   659 KLPVTLSYVQAAVLLYIGMLGQDISCIQEQMKLEADRIFVLFRKVMTKLTDYLYEISSEE 718
             KLPV+LSYVQA+VLL +G+   D S I+ QM+LE  +I+ L  KV  KL  YL  I+++E
Sbjct:   858 KLPVSLSYVQASVLLCLGLQESDFSSIERQMQLERGQIYSLLLKVGKKLYKYLNGIATKE 917

Query:   719 IKTAPPRLKEGAFEPHNISLDEDLNDGAEQFEEGMKTKMEGLLNPELLQQYAIVDKNADL 778
             +++  PRLK+   EPH +S+DEDL +GA++ EE M+ ++E LL+PELL Q+AI DK A+ 
Sbjct:   918 LESTLPRLKDRVLEPHKVSVDEDLREGAKEVEEQMRARIEELLDPELLDQFAIGDKEAE- 976

Query:   779 EKALQSGGGKIAAGGXXXXXXXXXXXXXPAKHKES--HQSGKKRNKDVSGSKSNKKRKS 835
               ALQ    KI++ G               K K S   +S KKR  D   S SNKKR++
Sbjct:   977 --ALQKS--KISSSGLISIESTKTDNK---KEKPSGFDKSAKKRGNDKHSSTSNKKRRA 1028
GO:0005634 "nucleus" evidence=ISM
TAIR|locus:2095828 AT3G57940 "AT3G57940" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-1543 nat10 "N-acetyltransferase 10" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E7ESU4 NAT10 "N-acetyltransferase 10" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q9H0A0 NAT10 "N-acetyltransferase 10" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2RBB4 NAT10 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1MPG7 NAT10 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
SGD|S000005076 KRE33 "Protein required for biogenesis of the small ribosomal subunit" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
UNIPROTKB|F1SGS7 NAT10 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:2138939 Nat10 "N-acetyltransferase 10" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9XIK4U202A_ARATHNo assigned EC number0.70010.99160.8054yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query835
COG1444758 COG1444, COG1444, Predicted P-loop ATPase fused to 1e-110
pfam13718169 pfam13718, GNAT_acetyltr_2, GNAT acetyltransferase 5e-82
pfam05127160 pfam05127, Helicase_RecD, Helicase 1e-62
COG1444758 COG1444, COG1444, Predicted P-loop ATPase fused to 1e-23
pfam13725102 pfam13725, tRNA_bind_2, Possible tRNA binding doma 2e-10
>gnl|CDD|224361 COG1444, COG1444, Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only] Back     alignment and domain information 
 Score =  353 bits (907), Expect = e-110
 Identities = 157/421 (37%), Positives = 209/421 (49%), Gaps = 43/421 (10%)

Query: 30  SEAERDLKDLKEQLCDDFPVGPLIKKCSTLDQGKAVITFLDAILDKTLRSTVALLAARGR 89
             A    K+ K+   D      L + C T DQ +A+      +LD   +  + L A RGR
Sbjct: 185 VSANEPSKERKKPPLDPVFPRELYELCLTEDQAEALEILER-LLDAP-KRALVLTADRGR 242

Query: 90  GKSAALGLAIAGAIA-AGYSNIFVTAPSPENLKTLFEFVCKGFNAIEYKEHIDYDIVRSS 148
           GKSAALG+A+A A   AG   I VTAP+P N++TLFEF  KG   + YK  +  D +   
Sbjct: 243 GKSAALGIALAAAARLAGSVRIIVTAPTPANVQTLFEFAGKGLEFLGYKRKVAPDALGEI 302

Query: 149 NPDLRKPIVRINIYRQHRQTIQYMEPHEHEKLAQVELLVIDEAAAIPLPVVRSLLGPY-L 207
                               I+Y+ P + ++ A  +LLV+DEAAAIPLP++  LL  +  
Sbjct: 303 REVSGDGFR-----------IEYVPPDDAQEEA--DLLVVDEAAAIPLPLLHKLLRRFPR 349

Query: 208 VFLSSTVNGYEGTGRSLSLKLLHQLEQQSHMPAKGVEGSAHGCLFKKIELSESIRYAPGD 267
           V  S+T++GYEGTGR  SLK L +L +Q                  ++EL E IRYAPGD
Sbjct: 350 VLFSTTIHGYEGTGRGFSLKFLARLRKQRDT------------TLHELELEEPIRYAPGD 397

Query: 268 PIESWLNGLLCLDVMNSIPHINRLPPPSECDLYYVNRDTLFSYHKESELFLQRMMALYVS 327
           PIE WL   L LD   +      L   S   L    RD LF      E  L+++  L VS
Sbjct: 398 PIEKWLYDALLLDAEPAELEPEDLRG-SLEILEVDQRDLLFD-----EELLRQVYGLLVS 451

Query: 328 SHYKNSPNDLQLMADAPAHHLFVLLGPVDESKNQLPDILCVIQVCLEGQISRRSVLKSFS 387
           +HY+NSPNDL+ + DAP HH+F L  P           + V QV  EG +S   +   + 
Sbjct: 452 AHYRNSPNDLRRLLDAPHHHIFALRAPE-------GKPVAVWQVAEEGGLSDELIDI-WL 503

Query: 388 EGHQPSGDQIPWKFSEQFRDAVFPSLSGARIVRIATHPSAMRLGYGSTAVELLTRYYEGQ 447
            G +P G+ IP   ++  RD  F  L G RIVRIA HP   R+G GS  + LL       
Sbjct: 504 GGRRPRGNLIPDLLAKHHRDPEFAKLVGWRIVRIAVHPELQRMGIGSRLLALLIEEARKG 563

Query: 448 L 448
           L
Sbjct: 564 L 564

Length = 758
>gnl|CDD|222340 pfam13718, GNAT_acetyltr_2, GNAT acetyltransferase 2 Back     alignment and domain information
>gnl|CDD|218449 pfam05127, Helicase_RecD, Helicase Back     alignment and domain information
>gnl|CDD|224361 COG1444, COG1444, Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only] Back     alignment and domain information
>gnl|CDD|222344 pfam13725, tRNA_bind_2, Possible tRNA binding domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 835
KOG20361011 consensus Predicted P-loop ATPase fused to an acet 100.0
COG1444758 Predicted P-loop ATPase fused to an acetyltransfer 100.0
PF13718196 GNAT_acetyltr_2: GNAT acetyltransferase 2; PDB: 2Z 100.0
PF05127177 Helicase_RecD: Helicase; InterPro: IPR007807 This 100.0
PF13725101 tRNA_bind_2: Possible tRNA binding domain; PDB: 2Z 99.72
PHA03333752 putative ATPase subunit of terminase; Provisional 99.45
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 98.74
TIGR01447586 recD exodeoxyribonuclease V, alpha subunit. This f 98.6
PRK10875615 recD exonuclease V subunit alpha; Provisional 98.59
TIGR01448720 recD_rel helicase, putative, RecD/TraA family. Thi 98.44
PF13673117 Acetyltransf_10: Acetyltransferase (GNAT) domain; 98.42
TIGR01575131 rimI ribosomal-protein-alanine acetyltransferase. 98.3
COG0456177 RimI Acetyltransferases [General function predicti 98.22
PF1350879 Acetyltransf_7: Acetyltransferase (GNAT) domain; P 98.19
smart00487201 DEXDc DEAD-like helicases superfamily. 98.16
PRK13889988 conjugal transfer relaxase TraA; Provisional 98.13
PTZ00330147 acetyltransferase; Provisional 98.02
TIGR02768744 TraA_Ti Ti-type conjugative transfer relaxase TraA 98.0
PRK138261102 Dtr system oriT relaxase; Provisional 98.0
PRK10146144 aminoalkylphosphonic acid N-acetyltransferase; Pro 97.91
PHA03368738 DNA packaging terminase subunit 1; Provisional 97.91
PRK09491146 rimI ribosomal-protein-alanine N-acetyltransferase 97.89
PF0058383 Acetyltransf_1: Acetyltransferase (GNAT) family; I 97.88
PRK10314153 putative acyltransferase; Provisional 97.85
TIGR02760 1960 TraI_TIGR conjugative transfer relaxase protein Tr 97.79
TIGR03827266 GNAT_ablB putative beta-lysine N-acetyltransferase 97.73
TIGR00376637 DNA helicase, putative. The gene product may repre 97.7
PRK13688156 hypothetical protein; Provisional 97.68
COG1643845 HrpA HrpA-like helicases [DNA replication, recombi 97.68
TIGR01970819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 97.66
TIGR03103547 trio_acet_GNAT GNAT-family acetyltransferase TIGR0 97.66
TIGR01890429 N-Ac-Glu-synth amino-acid N-acetyltransferase. Thi 97.66
PRK11664812 ATP-dependent RNA helicase HrpB; Provisional 97.58
TIGR02760 1960 TraI_TIGR conjugative transfer relaxase protein Tr 97.58
PRK10562145 putative acetyltransferase; Provisional 97.56
PRK147121623 conjugal transfer nickase/helicase TraI; Provision 97.51
PF05970364 PIF1: PIF1-like helicase; InterPro: IPR010285 This 97.5
PRK03624140 putative acetyltransferase; Provisional 97.5
PHA02533534 17 large terminase protein; Provisional 97.49
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 97.46
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 97.45
PRK137091747 conjugal transfer nickase/helicase TraI; Provision 97.44
PRK10514145 putative acetyltransferase; Provisional 97.4
PF13527127 Acetyltransf_9: Acetyltransferase (GNAT) domain; P 97.39
PRK08939306 primosomal protein DnaI; Reviewed 97.38
PRK05279441 N-acetylglutamate synthase; Validated 97.38
TIGR02382191 wecD_rffC TDP-D-fucosamine acetyltransferase. This 97.35
PF04851184 ResIII: Type III restriction enzyme, res subunit; 97.35
PHA00673154 acetyltransferase domain containing protein 97.34
PRK10140162 putative acetyltransferase YhhY; Provisional 97.33
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 97.33
PLN02706150 glucosamine 6-phosphate N-acetyltransferase 97.31
TIGR00643630 recG ATP-dependent DNA helicase RecG. 97.3
PRK10917681 ATP-dependent DNA helicase RecG; Provisional 97.3
cd02169297 Citrate_lyase_ligase Citrate lyase ligase. Citrate 97.23
PRK07757152 acetyltransferase; Provisional 97.23
TIGR02406157 ectoine_EctA L-2,4-diaminobutyric acid acetyltrans 97.22
PHA02653675 RNA helicase NPH-II; Provisional 97.2
TIGR01547396 phage_term_2 phage terminase, large subunit, PBSX 97.14
PRK10975194 TDP-fucosamine acetyltransferase; Provisional 97.14
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 97.13
TIGR01686320 FkbH FkbH-like domain. The C-terminal portion of t 97.1
PF0844586 FR47: FR47-like protein; InterPro: IPR013653 Prote 97.09
PRK09831147 putative acyltransferase; Provisional 97.08
PRK07922169 N-acetylglutamate synthase; Validated 97.04
PLN02825515 amino-acid N-acetyltransferase 97.04
PHA02558501 uvsW UvsW helicase; Provisional 97.03
KOG0922674 consensus DEAH-box RNA helicase [RNA processing an 96.94
PRK12308614 bifunctional argininosuccinate lyase/N-acetylgluta 96.92
KOG18051100 consensus DNA replication helicase [Replication, r 96.89
PRK08084235 DNA replication initiation factor; Provisional 96.88
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 96.83
PRK15130186 spermidine N1-acetyltransferase; Provisional 96.8
TIGR00580926 mfd transcription-repair coupling factor (mfd). Al 96.79
PRK07952244 DNA replication protein DnaC; Validated 96.79
PF09848352 DUF2075: Uncharacterized conserved protein (DUF207 96.78
PRK12377248 putative replication protein; Provisional 96.75
TIGR03448292 mycothiol_MshD mycothiol biosynthesis acetyltransf 96.74
TIGR03448292 mycothiol_MshD mycothiol biosynthesis acetyltransf 96.68
PF03354477 Terminase_1: Phage Terminase ; InterPro: IPR005021 96.64
PRK04296190 thymidine kinase; Provisional 96.63
PRK10590456 ATP-dependent RNA helicase RhlE; Provisional 96.6
PRK08903227 DnaA regulatory inactivator Hda; Validated 96.59
PRK10536262 hypothetical protein; Provisional 96.57
COG1484254 DnaC DNA replication protein [DNA replication, rec 96.55
PRK11192434 ATP-dependent RNA helicase SrmB; Provisional 96.55
cd0430165 NAT_SF N-Acyltransferase superfamily: Various enzy 96.51
PF03237384 Terminase_6: Terminase-like family; InterPro: IPR0 96.48
PRK01172674 ski2-like helicase; Provisional 96.48
PRK11634629 ATP-dependent RNA helicase DeaD; Provisional 96.45
PRK11776460 ATP-dependent RNA helicase DbpA; Provisional 96.43
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 96.38
PRK10809194 ribosomal-protein-S5-alanine N-acetyltransferase; 96.37
COG4098441 comFA Superfamily II DNA/RNA helicase required for 96.37
PRK10151179 ribosomal-protein-L7/L12-serine acetyltransferase; 96.36
PF13420155 Acetyltransf_4: Acetyltransferase (GNAT) domain; P 96.24
PF00580315 UvrD-helicase: UvrD/REP helicase N-terminal domain 96.19
PF1324576 AAA_19: Part of AAA domain 96.19
PTZ00424401 helicase 45; Provisional 96.16
PRK106891147 transcription-repair coupling factor; Provisional 96.15
COG1246153 ArgA N-acetylglutamate synthase and related acetyl 96.11
TIGR00124332 cit_ly_ligase [citrate (pro-3S)-lyase] ligase. ATP 96.1
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 96.09
PRK08181269 transposase; Validated 96.05
PRK05580679 primosome assembly protein PriA; Validated 96.04
PRK00254720 ski2-like helicase; Provisional 96.03
TIGR03585156 PseH pseudaminic acid biosynthesis N-acetyl transf 96.01
PRK08116268 hypothetical protein; Validated 95.97
PRK02362737 ski2-like helicase; Provisional 95.95
PRK04537572 ATP-dependent RNA helicase RhlB; Provisional 95.91
PRK01346411 hypothetical protein; Provisional 95.91
PRK06921266 hypothetical protein; Provisional 95.78
PRK114481123 hsdR type I restriction enzyme EcoKI subunit R; Pr 95.76
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 95.69
PRK08727233 hypothetical protein; Validated 95.68
PRK11057607 ATP-dependent DNA helicase RecQ; Provisional 95.68
PRK05642234 DNA replication initiation factor; Validated 95.62
PRK09401 1176 reverse gyrase; Reviewed 95.6
smart00382148 AAA ATPases associated with a variety of cellular 95.53
PRK01297475 ATP-dependent RNA helicase RhlB; Provisional 95.46
KOG1803649 consensus DNA helicase [Replication, recombination 95.43
KOG3138187 consensus Predicted N-acetyltransferase [General f 95.42
PF13523152 Acetyltransf_8: Acetyltransferase (GNAT) domain; P 95.38
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 95.37
PTZ00110545 helicase; Provisional 95.36
PLN00206518 DEAD-box ATP-dependent RNA helicase; Provisional 95.32
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 95.32
KOG3139165 consensus N-acetyltransferase [General function pr 95.22
PRK06526254 transposase; Provisional 95.21
TIGR01587358 cas3_core CRISPR-associated helicase Cas3. This mo 95.13
PF13173128 AAA_14: AAA domain 95.09
COG3393268 Predicted acetyltransferase [General function pred 95.06
PF0454550 Sigma70_r4: Sigma-70, region 4; InterPro: IPR00763 95.05
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 95.05
PRK06835329 DNA replication protein DnaC; Validated 95.0
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 94.99
COG2153155 ElaA Predicted acyltransferase [General function p 94.98
PRK14974336 cell division protein FtsY; Provisional 94.89
PHA03372668 DNA packaging terminase subunit 1; Provisional 94.88
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. 94.87
KOG0920924 consensus ATP-dependent RNA helicase A [RNA proces 94.82
PF10236309 DAP3: Mitochondrial ribosomal death-associated pro 94.81
COG1247169 Sortase and related acyltransferases [Cell envelop 94.8
PHA02544316 44 clamp loader, small subunit; Provisional 94.78
PRK09183259 transposase/IS protein; Provisional 94.77
KOG09241042 consensus mRNA splicing factor ATP-dependent RNA h 94.76
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 94.7
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 94.67
KOG3396150 consensus Glucosamine-phosphate N-acetyltransferas 94.62
TIGR02688449 conserved hypothetical protein TIGR02688. Members 94.59
PRK14964491 DNA polymerase III subunits gamma and tau; Provisi 94.54
PF13302142 Acetyltransf_3: Acetyltransferase (GNAT) domain; P 94.45
TIGR00614470 recQ_fam ATP-dependent DNA helicase, RecQ family. 94.43
PF0828154 Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013 94.39
PHA01807153 hypothetical protein 94.39
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 94.32
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 94.28
PRK14958509 DNA polymerase III subunits gamma and tau; Provisi 94.27
PRK13342413 recombination factor protein RarA; Reviewed 94.27
TIGR01389591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 94.23
TIGR03817742 DECH_helic helicase/secretion neighborhood putativ 94.22
PRK12323700 DNA polymerase III subunits gamma and tau; Provisi 94.22
PRK14956484 DNA polymerase III subunits gamma and tau; Provisi 94.2
PRK06893229 DNA replication initiation factor; Validated 94.05
PRK13767876 ATP-dependent helicase; Provisional 94.03
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 93.97
PRK08691709 DNA polymerase III subunits gamma and tau; Validat 93.97
KOG3234173 consensus Acetyltransferase, (GNAT) family [Genera 93.93
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 93.89
COG4626546 Phage terminase-like protein, large subunit [Gener 93.8
PRK07764824 DNA polymerase III subunits gamma and tau; Validat 93.78
COG0454156 WecD Histone acetyltransferase HPA2 and related ac 93.74
PRK00440319 rfc replication factor C small subunit; Reviewed 93.73
PRK12422445 chromosomal replication initiation protein; Provis 93.6
PRK10865857 protein disaggregation chaperone; Provisional 93.45
PRK00771437 signal recognition particle protein Srp54; Provisi 93.42
PRK14952584 DNA polymerase III subunits gamma and tau; Provisi 93.39
PRK14960702 DNA polymerase III subunits gamma and tau; Provisi 93.38
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 93.38
COG1061442 SSL2 DNA or RNA helicases of superfamily II [Trans 93.34
PRK14957546 DNA polymerase III subunits gamma and tau; Provisi 93.28
PF05673249 DUF815: Protein of unknown function (DUF815); Inte 93.22
PRK06645507 DNA polymerase III subunits gamma and tau; Validat 93.16
PRK12402337 replication factor C small subunit 2; Reviewed 93.13
TIGR01211522 ELP3 histone acetyltransferase, ELP3 family. The S 93.05
PRK07003830 DNA polymerase III subunits gamma and tau; Validat 93.0
PRK07994647 DNA polymerase III subunits gamma and tau; Validat 92.98
PRK14963504 DNA polymerase III subunits gamma and tau; Provisi 92.95
PRK14970367 DNA polymerase III subunits gamma and tau; Provisi 92.9
PRK14953486 DNA polymerase III subunits gamma and tau; Provisi 92.72
PRK14962472 DNA polymerase III subunits gamma and tau; Provisi 92.66
PF04466387 Terminase_3: Phage terminase large subunit; InterP 92.65
COG3153171 Predicted acetyltransferase [General function pred 92.63
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 92.58
cd0617155 Sigma70_r4 Sigma70, region (SR) 4 refers to the mo 92.51
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 92.48
cd01124187 KaiC KaiC is a circadian clock protein primarily f 92.47
PRK14701 1638 reverse gyrase; Provisional 92.45
PRK09111598 DNA polymerase III subunits gamma and tau; Validat 92.39
PRK14951618 DNA polymerase III subunits gamma and tau; Provisi 92.21
PRK09694878 helicase Cas3; Provisional 92.18
COG0513513 SrmB Superfamily II DNA and RNA helicases [DNA rep 92.12
PRK14087450 dnaA chromosomal replication initiation protein; P 92.1
COG2812515 DnaX DNA polymerase III, gamma/tau subunits [DNA r 92.05
TIGR02959170 SigZ RNA polymerase sigma factor, SigZ family. Thi 91.84
PRK05563559 DNA polymerase III subunits gamma and tau; Validat 91.67
CHL00181287 cbbX CbbX; Provisional 91.58
PF07652148 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR 91.58
PRK00411394 cdc6 cell division control protein 6; Reviewed 91.52
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 91.51
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 91.48
COG1200677 RecG RecG-like helicase [DNA replication, recombin 91.46
PF02399824 Herpes_ori_bp: Origin of replication binding prote 91.45
PF12775272 AAA_7: P-loop containing dynein motor region D3; P 91.4
PRK14971614 DNA polymerase III subunits gamma and tau; Provisi 91.36
PRK09047161 RNA polymerase factor sigma-70; Validated 91.31
PLN031371195 ATP-dependent DNA helicase; Q4-like; Provisional 91.3
KOG3216163 consensus Diamine acetyltransferase [Amino acid tr 91.26
PRK14712 1623 conjugal transfer nickase/helicase TraI; Provision 91.24
PRK14969527 DNA polymerase III subunits gamma and tau; Provisi 91.21
PRK04195482 replication factor C large subunit; Provisional 91.15
PRK12529178 RNA polymerase sigma factor; Provisional 91.08
PRK09652182 RNA polymerase sigma factor RpoE; Provisional 90.99
COG1670187 RimL Acetyltransferases, including N-acetylases of 90.97
PRK06647563 DNA polymerase III subunits gamma and tau; Validat 90.95
PRK00118104 putative DNA-binding protein; Validated 90.92
PRK05896605 DNA polymerase III subunits gamma and tau; Validat 90.88
PF01443234 Viral_helicase1: Viral (Superfamily 1) RNA helicas 90.86
PRK07940394 DNA polymerase III subunit delta'; Validated 90.84
TIGR02903615 spore_lon_C ATP-dependent protease, Lon family. Me 90.84
TIGR00708173 cobA cob(I)alamin adenosyltransferase. Alternate n 90.81
PRK07037163 extracytoplasmic-function sigma-70 factor; Validat 90.79
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 90.76
TIGR00595505 priA primosomal protein N'. All proteins in this f 90.63
TIGR00603732 rad25 DNA repair helicase rad25. All proteins in t 90.61
PRK12536181 RNA polymerase sigma factor; Provisional 90.53
PRK11924179 RNA polymerase sigma factor; Provisional 90.45
PRK11054684 helD DNA helicase IV; Provisional 90.45
PRK07133725 DNA polymerase III subunits gamma and tau; Validat 90.4
PRK09642160 RNA polymerase sigma factor SigW; Reviewed 90.38
cd00561159 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B 90.36
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 90.33
PRK12512184 RNA polymerase sigma factor; Provisional 90.27
COG0507696 RecD ATP-dependent exoDNAse (exonuclease V), alpha 90.26
KOG1802935 consensus RNA helicase nonsense mRNA reducing fact 90.2
TIGR02999183 Sig-70_X6 RNA polymerase sigma factor, TIGR02999 f 90.01
PRK12524196 RNA polymerase sigma factor; Provisional 90.01
COG2607287 Predicted ATPase (AAA+ superfamily) [General funct 89.96
PRK13766773 Hef nuclease; Provisional 89.95
PRK09643192 RNA polymerase sigma factor SigM; Reviewed 89.92
PF1388070 Acetyltransf_13: ESCO1/2 acetyl-transferase 89.88
PRK14965576 DNA polymerase III subunits gamma and tau; Provisi 89.8
PRK12519194 RNA polymerase sigma factor; Provisional 89.77
TIGR00362405 DnaA chromosomal replication initiator protein Dna 89.75
TIGR02948187 SigW_bacill RNA polymerase sigma-W factor. This si 89.73
PRK12898656 secA preprotein translocase subunit SecA; Reviewed 89.66
TIGR02621844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 89.62
PRK05602186 RNA polymerase sigma factor; Reviewed 89.61
PRK09112351 DNA polymerase III subunit delta'; Validated 89.6
PRK00149450 dnaA chromosomal replication initiation protein; R 89.55
TIGR02937158 sigma70-ECF RNA polymerase sigma factor, sigma-70 89.49
PF00176299 SNF2_N: SNF2 family N-terminal domain; InterPro: I 89.44
PRK09639166 RNA polymerase sigma factor SigX; Provisional 89.32
PRK12542185 RNA polymerase sigma factor; Provisional 89.22
PRK09641187 RNA polymerase sigma factor SigW; Provisional 89.14
TIGR02943188 Sig70_famx1 RNA polymerase sigma-70 factor, TIGR02 89.05
PRK09637181 RNA polymerase sigma factor SigZ; Provisional 89.03
PRK12523172 RNA polymerase sigma factor; Reviewed 88.96
KOG3235193 consensus Subunit of the major N alpha-acetyltrans 88.91
PRK12547164 RNA polymerase sigma factor; Provisional 88.89
PF05729166 NACHT: NACHT domain 88.85
PRK06851367 hypothetical protein; Provisional 88.82
TIGR02954169 Sig70_famx3 RNA polymerase sigma-70 factor, TIGR02 88.81
PRK09648189 RNA polymerase sigma factor SigD; Reviewed 88.74
PRK12531194 RNA polymerase sigma factor; Provisional 88.73
PRK12526206 RNA polymerase sigma factor; Provisional 88.73
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 88.7
KOG0923902 consensus mRNA splicing factor ATP-dependent RNA h 88.64
PRK12520191 RNA polymerase sigma factor; Provisional 88.64
COG1204766 Superfamily II helicase [General function predicti 88.62
cd01393226 recA_like RecA is a bacterial enzyme which has rol 88.59
KOG4144190 consensus Arylalkylamine N-acetyltransferase [Gene 88.52
PRK11923193 algU RNA polymerase sigma factor AlgU; Provisional 88.44
PRK12539184 RNA polymerase sigma factor; Provisional 88.39
COG1875436 NYN ribonuclease and ATPase of PhoH family domains 88.34
PRK10919672 ATP-dependent DNA helicase Rep; Provisional 88.32
PRK06759154 RNA polymerase factor sigma-70; Validated 88.31
COG1203733 CRISPR-associated helicase Cas3 [Defense mechanism 88.28
PRK09646194 RNA polymerase sigma factor SigK; Reviewed 88.21
PRK12527159 RNA polymerase sigma factor; Reviewed 88.17
COG4096875 HsdR Type I site-specific restriction-modification 88.16
PRK12514179 RNA polymerase sigma factor; Provisional 88.01
PRK12546188 RNA polymerase sigma factor; Provisional 88.0
PRK13919186 putative RNA polymerase sigma E protein; Provision 87.87
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 87.85
PRK11773721 uvrD DNA-dependent helicase II; Provisional 87.84
PRK12530189 RNA polymerase sigma factor; Provisional 87.81
PRK09415179 RNA polymerase factor sigma C; Reviewed 87.78
KOG0345567 consensus ATP-dependent RNA helicase [RNA processi 87.76
PRK12534187 RNA polymerase sigma factor; Provisional 87.72
PRK12516187 RNA polymerase sigma factor; Provisional 87.71
PRK12528161 RNA polymerase sigma factor; Provisional 87.71
PRK12522173 RNA polymerase sigma factor; Provisional 87.67
KOG0926 1172 consensus DEAH-box RNA helicase [RNA processing an 87.49
PHA00729226 NTP-binding motif containing protein 87.41
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 87.41
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 87.39
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 87.37
PRK12537182 RNA polymerase sigma factor; Provisional 87.33
TIGR01074664 rep ATP-dependent DNA helicase Rep. Designed to id 87.14
PRK09200790 preprotein translocase subunit SecA; Reviewed 87.09
PRK12545201 RNA polymerase sigma factor; Provisional 87.08
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 87.05
PRK13709 1747 conjugal transfer nickase/helicase TraI; Provision 87.01
PRK13341725 recombination factor protein RarA/unknown domain f 86.96
PRK08301234 sporulation sigma factor SigE; Reviewed 86.95
TIGR02939190 RpoE_Sigma70 RNA polymerase sigma factor RpoE. A s 86.9
PRK09644165 RNA polymerase sigma factor SigM; Provisional 86.86
PRK04217110 hypothetical protein; Provisional 86.85
PF12568128 DUF3749: Acetyltransferase (GNAT) domain; InterPro 86.85
PRK12540182 RNA polymerase sigma factor; Provisional 86.84
PRK12543179 RNA polymerase sigma factor; Provisional 86.84
TIGR02989159 Sig-70_gvs1 RNA polymerase sigma-70 factor, Rhodop 86.79
PRK09645173 RNA polymerase sigma factor SigL; Provisional 86.78
PRK12525168 RNA polymerase sigma factor; Provisional 86.73
TIGR02983162 SigE-fam_strep RNA polymerase sigma-70 factor, sig 86.72
PRK08451535 DNA polymerase III subunits gamma and tau; Validat 86.71
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r 86.44
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 86.43
TIGR02984189 Sig-70_plancto1 RNA polymerase sigma-70 factor, Pl 86.38
TIGR01075715 uvrD DNA helicase II. Designed to identify uvrD me 86.38
PRK06288268 RNA polymerase sigma factor WhiG; Reviewed 86.38
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 86.37
TIGR02985161 Sig70_bacteroi1 RNA polymerase sigma-70 factor, Ba 86.29
TIGR02928365 orc1/cdc6 family replication initiation protein. M 86.11
PRK14959624 DNA polymerase III subunits gamma and tau; Provisi 86.08
cd03282204 ABC_MSH4_euk MutS4 homolog in eukaryotes. The MutS 85.83
PRK09361225 radB DNA repair and recombination protein RadB; Pr 85.78
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 85.63
TIGR02947193 SigH_actino RNA polymerase sigma-70 factor, TIGR02 85.61
PRK12532195 RNA polymerase sigma factor; Provisional 85.59
PRK03992389 proteasome-activating nucleotidase; Provisional 85.54
PHA02535581 P terminase ATPase subunit; Provisional 85.43
PRK14954620 DNA polymerase III subunits gamma and tau; Provisi 85.4
PRK12533216 RNA polymerase sigma factor; Provisional 85.37
PRK12904830 preprotein translocase subunit SecA; Reviewed 85.35
PRK06930170 positive control sigma-like factor; Validated 85.31
PRK12511182 RNA polymerase sigma factor; Provisional 85.3
PRK12515189 RNA polymerase sigma factor; Provisional 85.28
TIGR02950154 SigM_subfam RNA polymerase sigma factor, SigM fami 85.26
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 85.25
PRK10416318 signal recognition particle-docking protein FtsY; 85.14
CHL00095821 clpC Clp protease ATP binding subunit 85.09
TIGR02980227 SigBFG RNA polymerase sigma-70 factor, sigma-B/F/G 85.07
smart0042158 HTH_LUXR helix_turn_helix, Lux Regulon. lux regulo 85.06
TIGR02952170 Sig70_famx2 RNA polymerase sigma-70 factor, TIGR02 84.88
PRK06986236 fliA flagellar biosynthesis sigma factor; Validate 84.86
PRK14086617 dnaA chromosomal replication initiation protein; P 84.81
PRK12544206 RNA polymerase sigma factor; Provisional 84.7
PRK09647203 RNA polymerase sigma factor SigE; Reviewed 84.68
cd01394218 radB RadB. The archaeal protein radB shares simila 84.58
TIGR00348667 hsdR type I site-specific deoxyribonuclease, HsdR 84.54
smart00488289 DEXDc2 DEAD-like helicases superfamily. 84.38
smart00489289 DEXDc3 DEAD-like helicases superfamily. 84.38
PRK14721420 flhF flagellar biosynthesis regulator FlhF; Provis 84.26
PRK09649185 RNA polymerase sigma factor SigC; Reviewed 84.15
PRK04914956 ATP-dependent helicase HepA; Validated 83.97
PRK12538233 RNA polymerase sigma factor; Provisional 83.89
PRK12535196 RNA polymerase sigma factor; Provisional 83.89
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 83.85
PF04665241 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 83.85
PRK10865857 protein disaggregation chaperone; Provisional 83.84
PRK14948620 DNA polymerase III subunits gamma and tau; Provisi 83.78
PRK09651172 RNA polymerase sigma factor FecI; Provisional 83.75
TIGR02012321 tigrfam_recA protein RecA. This model describes or 83.51
PRK14950585 DNA polymerase III subunits gamma and tau; Provisi 83.45
PRK12541161 RNA polymerase sigma factor; Provisional 83.45
PRK07471365 DNA polymerase III subunit delta'; Validated 83.4
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 83.27
PRK05803233 sporulation sigma factor SigK; Reviewed 83.26
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 83.17
PRK07670251 RNA polymerase sigma factor SigD; Validated 83.16
PRK09640188 RNA polymerase sigma factor SigX; Reviewed 83.12
cd0617057 LuxR_C_like C-terminal DNA-binding domain of LuxR- 83.01
PF1454278 Acetyltransf_CG: GCN5-related N-acetyl-transferase 82.9
PRK06851367 hypothetical protein; Provisional 82.81
KOG0925699 consensus mRNA splicing factor ATP-dependent RNA h 82.63
PRK12518175 RNA polymerase sigma factor; Provisional 82.56
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Valida 82.46
TIGR03117636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 82.33
cd00983325 recA RecA is a bacterial enzyme which has roles in 82.31
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 82.07
TIGR02479224 FliA_WhiG RNA polymerase sigma factor, FliA/WhiG f 82.06
PRK14723767 flhF flagellar biosynthesis regulator FlhF; Provis 81.96
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 81.89
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 81.89
PF0844489 Gly_acyl_tr_C: Aralkyl acyl-CoA:amino acid N-acylt 81.87
PRK08058329 DNA polymerase III subunit delta'; Validated 81.64
PHA03311828 helicase-primase subunit BBLF4; Provisional 81.64
CHL00176638 ftsH cell division protein; Validated 81.62
PRK12513194 RNA polymerase sigma factor; Provisional 81.57
COG1703323 ArgK Putative periplasmic protein kinase ArgK and 81.48
TIGR01073726 pcrA ATP-dependent DNA helicase PcrA. Designed to 81.31
PRK05564313 DNA polymerase III subunit delta'; Validated 81.19
TIGR00963745 secA preprotein translocase, SecA subunit. The pro 81.18
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 81.05
PRK12517188 RNA polymerase sigma factor; Provisional 80.92
PRK13531498 regulatory ATPase RavA; Provisional 80.84
PRK12899 970 secA preprotein translocase subunit SecA; Reviewed 80.77
PRK07408256 RNA polymerase sigma factor SigF; Reviewed 80.76
PF0019658 GerE: Bacterial regulatory proteins, luxR family; 80.68
CHL00095821 clpC Clp protease ATP binding subunit 80.68
PF07374100 DUF1492: Protein of unknown function (DUF1492); In 80.66
TIGR03001244 Sig-70_gmx1 RNA polymerase sigma-70 factor, Myxoco 80.62
KOG2488202 consensus Acetyltransferase (GNAT) domain-containi 80.6
PRK08583257 RNA polymerase sigma factor SigB; Validated 80.55
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 80.53
PRK05911257 RNA polymerase sigma factor sigma-28; Reviewed 80.34
PRK08295208 RNA polymerase factor sigma-70; Validated 80.32
TIGR00631655 uvrb excinuclease ABC, B subunit. This family is b 80.27
>KOG2036 consensus Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only] Back     alignment and domain information 
Probab=100.00  E-value=1.3e-257  Score=2122.74  Aligned_cols=809  Identities=57%  Similarity=0.945  Sum_probs=763.7

Q ss_pred             CCCccccccCCCCCccceecCCCCCccCCchhHHHHHHHHHhcccCCCCccccccCCcHHHHHHHHHHHHHHhccCCCcE
Q 003262            1 MDDELNVLPISSHIRSITAVPVKEDSEGLSEAERDLKDLKEQLCDDFPVGPLIKKCSTLDQGKAVITFLDAILDKTLRST   80 (835)
Q Consensus         1 ~dDelnvlpis~~~~~i~~~~~~~~~~~~~~~~~~l~~lk~~l~~~~p~g~Lv~~~~T~DQakAl~~~~~~i~ek~~r~~   80 (835)
                      |||||||||||+|+++|+|+|+ .++++.++.+.+|++|||++.|++|+|+|+++|+|.||++||++|+++|.+|++|++
T Consensus       199 ~DDeLnvLplssh~~nv~~~P~-~~~~~~~~~e~~lk~Lkesl~~~~P~G~Lv~~~kT~dQakav~~f~dai~eK~lr~~  277 (1011)
T KOG2036|consen  199 LDDELNVLPLSSHIKNVEAVPP-KDDENLSPSERELKELKESLSDDQPAGPLVGLCKTLDQAKAVLTFFDAIVEKTLRST  277 (1011)
T ss_pred             EcCccccccccccccccccCCC-cccccCChhhhhhHhhhhhhcCCCcchhhhhhhhhHHHHHHHHHHHHHHHHhhhcce
Confidence            6999999999999999999999 456779999999999999999999999999999999999999999999999999999


Q ss_pred             EEEEcCCCCCHHHHHHHHHHHHHHcCCCcEEEecCChHhHHHHHHHHHhhhccccccccccceeeecCCCCCCcceeEee
Q 003262           81 VALLAARGRGKSAALGLAIAGAIAAGYSNIFVTAPSPENLKTLFEFVCKGFNAIEYKEHIDYDIVRSSNPDLRKPIVRIN  160 (835)
Q Consensus        81 v~LTA~RGRGKSAaLGlaiA~ai~~g~~nI~VTAPs~enl~tlFef~~kgl~~lgy~e~~dy~i~~st~p~~~~aivrvn  160 (835)
                      |+|||+|||||||||||+||+|+++||+|||||||||||++|||||++||||+|+|+||+||+||||+||+|++||||||
T Consensus       278 vsLtA~RGRGKSAALGlsiA~AVa~GysnIyvtSPspeNlkTlFeFv~kGfDaL~Yqeh~Dy~iI~s~np~fkkaivRIn  357 (1011)
T KOG2036|consen  278 VSLTASRGRGKSAALGLSIAGAVAFGYSNIYVTSPSPENLKTLFEFVFKGFDALEYQEHVDYDIIQSTNPDFKKAIVRIN  357 (1011)
T ss_pred             EEEEecCCCCchhhhhHHHHHHHhcCcceEEEcCCChHHHHHHHHHHHcchhhhcchhhcchhhhhhcChhhhhhEEEEE
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eeeccceeEEeeCCccccccCCCcEEEEecccCCCHHHHHHhhcCCeEEEEeeccCCcccCCchhHHHHHHhhhcCCCCC
Q 003262          161 IYRQHRQTIQYMEPHEHEKLAQVELLVIDEAAAIPLPVVRSLLGPYLVFLSSTVNGYEGTGRSLSLKLLHQLEQQSHMPA  240 (835)
Q Consensus       161 i~~~hrq~Iqyi~P~d~~~l~~adLLvIDEAAAIPlpllk~Ll~~y~vflsSTi~GYEGTGR~fsLKl~~~L~~~~~~~~  240 (835)
                      |||+||||||||+|.|..+++||||||||||||||||+|++|+|||+|||||||||||||||+|||||+||||+|++.++
T Consensus       358 ifr~hrQtIQYi~P~D~~kl~q~eLlVIDEAAAIPLplvk~LigPylVfmaSTinGYEGTGRSlSlKLlqqLr~qs~~~~  437 (1011)
T KOG2036|consen  358 IFREHRQTIQYISPHDHQKLGQAELLVIDEAAAIPLPLVKKLIGPYLVFMASTINGYEGTGRSLSLKLLQQLRKQSRASN  437 (1011)
T ss_pred             EeccccceeEeeccchhhhccCCcEEEechhhcCCHHHHHHhhcceeEEEeecccccccccceehHHHHHHHHHhccccc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999997643


Q ss_pred             C--CcCCCccCCceeEEEeccccccCCCCchHHHHHHhcCCCCCCCCCCCCCCCCCCCcceEeeCcccccccCcCcHHHH
Q 003262          241 K--GVEGSAHGCLFKKIELSESIRYAPGDPIESWLNGLLCLDVMNSIPHINRLPPPSECDLYYVNRDTLFSYHKESELFL  318 (835)
Q Consensus       241 ~--~~~~~~~~r~~~ei~L~ePIRya~gDPvE~WLn~lLcLDa~~~~~~~~~~p~p~~c~l~~Vnrd~Lfs~h~~sE~fL  318 (835)
                      .  ...+...|+.++|++|+|||||++|||||+|||++|||||+...+...|||+|++|+|||||||+|||||++||.||
T Consensus       438 ~~~~k~~~~sg~~~kei~l~EsIRY~~gD~IE~WLn~lLcLDas~~~~~~~g~P~Ps~CeLyyVnRdtLFSyh~~sE~FL  517 (1011)
T KOG2036|consen  438 ARENKSSSKSGRTLKEISLEESIRYAPGDPIEKWLNRLLCLDASNCLPITSGCPSPSACELYYVNRDTLFSYHKASEAFL  517 (1011)
T ss_pred             cccCcccccccceeccccccccccCCCCCcHHHHHhhhhhhccccCCcccCCCCChhHceEEEEcchhhhcCCchHHHHH
Confidence            3  11134468999999999999999999999999999999999866677899999999999999999999999999999


Q ss_pred             HHHHHHHHhcccCCChhHHHHhhcCCCceEEEEecCCcccCCCCCCeEEEEEeeecCCCCHHHHHHHHhcCCCCCCCchh
Q 003262          319 QRMMALYVSSHYKNSPNDLQLMADAPAHHLFVLLGPVDESKNQLPDILCVIQVCLEGQISRRSVLKSFSEGHQPSGDQIP  398 (835)
Q Consensus       319 q~~~aLlV~AHYkNsPnDLqlL~DaPah~lfvL~~p~~~~~~~lp~il~viqValEG~is~~~~~~~l~~G~Rp~GdLIP  398 (835)
                      |+||+|||+|||||||||||||+|||+||||||++|++++++.+|+||||||||+||.||+++++++|++|+|+.|||||
T Consensus       518 qr~mal~VSSHYKNSPNDLQllsDAPaH~LFvLl~PVd~~~~~iPdvlcviQv~lEG~isr~si~~sL~~G~~a~GdlIp  597 (1011)
T KOG2036|consen  518 QRLMALYVSSHYKNSPNDLQLLSDAPAHHLFVLLGPVDPSQNAIPDVLCVIQVCLEGRISRQSIENSLRRGKRAAGDLIP  597 (1011)
T ss_pred             HHHHHHHHHHhccCCchhhhhhccCcccceEEEecCcCcccCCCCcceEEEEEeecceecHHHHHHHHhccccccCCccc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHhhccCCCCCCcccEEEEEeeCcccccCChHHHHHHHHHHHHhcccccccccccccccCCcchhhhhHHhhhhccc
Q 003262          399 WKFSEQFRDAVFPSLSGARIVRIATHPSAMRLGYGSTAVELLTRYYEGQLTTFSEIDVEDTVETPEVRVTEAAKKVSLLE  478 (835)
Q Consensus       399 w~ls~q~~d~~f~~lsgaRIVRIAvhPd~q~mGyGsraL~~L~~~~~g~~~~~~e~~~~~~~~~~~~~v~~~~~~~~l~~  478 (835)
                      |++|+||+|.+|+.++|+|||||||||+||+||||+|++++|.+||+|++++++|+.  .+.+..+++|+++ ++++|++
T Consensus       598 W~vseQf~D~~F~~l~GaRIVRIAvhP~y~~MGYGsrAvqLL~~y~eG~~~~i~e~~--~~~~~~~k~v~e~-~~vslle  674 (1011)
T KOG2036|consen  598 WTVSEQFQDEDFPKLSGARIVRIAVHPEYQKMGYGSRAVQLLTDYFEGKFTSISEDV--LAVDHSIKRVEEA-EKVSLLE  674 (1011)
T ss_pred             eehhhhhcccchhcccCceEEEEEeccchhccCccHHHHHHHHHHHhccCCCccccc--cccCccccccchh-hhhhhhh
Confidence            999999999999999999999999999999999999999999999999999998543  2334567788765 7899999


Q ss_pred             ccccCCCCCCcccccccccCCCCcceEEEecCCCHHHHHHHHHCCCeEEEeeecccCCCCCceEEEEccCCccccccccc
Q 003262          479 ENIKPKTNLPPLLVHLRERQPEKLNYIGVSFGLTLDLFRFWRKHKFAPFYVSQNANAVTGEHTCMVLKPLHSEDIEVNES  558 (835)
Q Consensus       479 e~i~~r~~~ppLl~~l~e~~~~~lDylGvSFGlT~~Ll~FWkk~GF~pVylrq~~ne~TGEhS~IMlr~L~~~~~~~~~~  558 (835)
                      |.|+||++|||||.+|+||+|+++||+|||||+|++|++||+|+||+||||||+.|++||||||||||+|+.++      
T Consensus       675 e~i~pR~~lppLL~~L~er~perldylGvSfGLT~~L~kFWk~~gF~PvylrQt~n~lTGEHtcimLk~L~~~e------  748 (1011)
T KOG2036|consen  675 EQIKPRKDLPPLLLKLSERPPERLDYLGVSFGLTPSLLKFWKKNGFVPVYLRQTSNDLTGEHTCIMLKTLEGDE------  748 (1011)
T ss_pred             hhcccccCCCceeeEcccCCCcccceeeecccCCHHHHHHHHhcCceeEEeeccccccccceeEEEEecCCCcc------
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999654      


Q ss_pred             CccchHHHHHHHHHHHHHhhhhhccCCCCCHHHHHHhcCCcccCCCCCCCCCCCcccccccCCCCCHHHHHHHHHHhcCC
Q 003262          559 DEWGFFGPFYRDFKQRFFWLLVQHKLQRMDYKLLMSVLDPKINFKELDPRQDNSDKFLKSLTGVFSANDILRLKDYTNGL  638 (835)
Q Consensus       559 ~~~~wl~~~~~dF~~Rf~~lL~~~~fr~l~~~lal~lL~~~~~~~~~~~~~~~~~l~~~~~~~~ls~~Dl~rL~~ya~~~  638 (835)
                        .+|+..|++||++||+.|| ++.|++|++.+|+++|++.+.+.+  ++.....++..+++.+|+|+|++||++|++|+
T Consensus       749 --~~wl~~f~qdFr~Rf~~lL-s~~F~~f~~~laLslL~~~~~~~~--~~~~~~~l~~~~l~~~fsp~Dl~Rl~~ys~n~  823 (1011)
T KOG2036|consen  749 --SGWLGAFYQDFRRRFLKLL-SYDFKKFTAKLALSLLQNKNNGKE--VSTLSSVLTREELDGYFSPYDLKRLRSYSRNL  823 (1011)
T ss_pred             --cchHHHHHHHHHHHHHHHh-hHHHhccCHHHHHHHhcccccCCC--CcccccccchHHhhcccChhhHHHHHHHhcCC
Confidence              7899999999999999999 999999999999999998877652  22334568888999999999999999999999


Q ss_pred             cchhhhhchHHHHHHHHhhccCC-CCccHHHHHHHHHHHhcCCCHHHHHHHhCCCHHHHHHHHHHHHHHHHHHHHhhchH
Q 003262          639 IEHYAILDLVPRLAHLYFQEKLP-VTLSYVQAAVLLYIGMLGQDISCIQEQMKLEADRIFVLFRKVMTKLTDYLYEISSE  717 (835)
Q Consensus       639 ~dy~~i~Dllp~La~lyf~~~l~-~~Ls~~q~~iLla~gLQ~Ks~~~v~~el~l~~~Q~lalf~k~i~kl~~~~~~~~~~  717 (835)
                      +|||+|.|++|.||++||.++++ +.||.+|++||||+|||+|+++.|++||+||++|++++|.|++|++++||+++.++
T Consensus       824 vD~~li~Dlip~ia~lYF~~klp~~~Ls~vq~siLL~lGlQ~k~vd~i~kel~Lp~~Q~~all~k~~kk~~~~~~~v~~~  903 (1011)
T KOG2036|consen  824 VDFHLIVDLIPDIAHLYFEGKLPSVKLSVVQSSILLALGLQHKSVDAIEKELNLPSNQLLALLTKAMKKLSKYFDEVEEK  903 (1011)
T ss_pred             chhhHHHHHHHHHHHHHHhccCCccchHHHHHHHHHHhccccCCHHHHHHHhcCChhhHHHHHHHHHHHHHHHHHHHHHH
Confidence            99999999999999999999999 99999999999999999999999999999999999999999999999999999999


Q ss_pred             HHhhCCCCCcCCCccccccchhHHHHhhHHHHHHHHHHHHhccCCccccccccccCChhHHHHHHhcCCCCCCCCceEEE
Q 003262          718 EIKTAPPRLKEGAFEPHNISLDEDLNDGAEQFEEGMKTKMEGLLNPELLQQYAIVDKNADLEKALQSGGGKIAAGGVISV  797 (835)
Q Consensus       718 ~i~~~~~~~~~~~~~p~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~l~~y~i~~~~~~~~~a~~~~~~~~~~~~~~~~  797 (835)
                      +||++|++.++..++|+..+++|||+|+|+|+.+++|++++++++ ++|++|+|.|++++|.+|+.+.+.+ +..++||+
T Consensus       904 ~ie~~l~~~~~~~~e~~~~sl~~dl~e~ake~~~~~r~~~~~L~~-~~L~~y~i~gd~e~~a~~~~~~~~~-~~~~v~S~  981 (1011)
T KOG2036|consen  904 AIEETLPREKDRVNEPTPVSLEDDLEEAAKEAEEQMREKQKELKA-EELDKYAIIGDEEEWAEALEKIGSS-GGIGVVSV  981 (1011)
T ss_pred             HHHhhchhhhhhcCCcCcccHHHHHHHHHHHHHHHHHHHHHHHHh-hhhhhhhhcCCHHHHHHHHhhhccc-ccceeEEe
Confidence            999999999988899999999999999999999999999999988 8999999999999999998763322 55789999


Q ss_pred             ecCccccCCccccccccccccccCCCCCCCCccccc
Q 003262          798 KSSKSKIDKPAKHKESHQSGKKRNKDVSGSKSNKKR  833 (835)
Q Consensus       798 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  833 (835)
                      |+++++       ++.+++.+|++.+.+.++|||.|
T Consensus       982 Ks~~kr-------~~~~~~~~k~~~~k~~~~~kk~~ 1010 (1011)
T KOG2036|consen  982 KSGKKR-------AAFDKSASKKKANKKPSKKKKFK 1010 (1011)
T ss_pred             cccccc-------ccCChhhhhcccccCccchhhcc
Confidence            999877       35666777777777766666654

>COG1444 Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only] Back     alignment and domain information
>PF13718 GNAT_acetyltr_2: GNAT acetyltransferase 2; PDB: 2ZPA_B Back     alignment and domain information
>PF05127 Helicase_RecD: Helicase; InterPro: IPR007807 This domain is about 350 amino acid residues long and appears to have a P-loop motif, suggesting this is an ATPase Back     alignment and domain information
>PF13725 tRNA_bind_2: Possible tRNA binding domain; PDB: 2ZPA_B Back     alignment and domain information
>PHA03333 putative ATPase subunit of terminase; Provisional Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>TIGR01447 recD exodeoxyribonuclease V, alpha subunit Back     alignment and domain information
>PRK10875 recD exonuclease V subunit alpha; Provisional Back     alignment and domain information
>TIGR01448 recD_rel helicase, putative, RecD/TraA family Back     alignment and domain information
>PF13673 Acetyltransf_10: Acetyltransferase (GNAT) domain; PDB: 2FIW_A 1BOB_A 3FNC_B 3EXN_A Back     alignment and domain information
>TIGR01575 rimI ribosomal-protein-alanine acetyltransferase Back     alignment and domain information
>COG0456 RimI Acetyltransferases [General function prediction only] Back     alignment and domain information
>PF13508 Acetyltransf_7: Acetyltransferase (GNAT) domain; PDB: 3EY5_A 3FRM_B 3D8P_B 3GY9_A 3GYA_A 3S6F_A 2Q7B_A 1CM0_B 1XEB_B 1Y7R_A Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PRK13889 conjugal transfer relaxase TraA; Provisional Back     alignment and domain information
>PTZ00330 acetyltransferase; Provisional Back     alignment and domain information
>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA Back     alignment and domain information
>PRK13826 Dtr system oriT relaxase; Provisional Back     alignment and domain information
>PRK10146 aminoalkylphosphonic acid N-acetyltransferase; Provisional Back     alignment and domain information
>PHA03368 DNA packaging terminase subunit 1; Provisional Back     alignment and domain information
>PRK09491 rimI ribosomal-protein-alanine N-acetyltransferase; Provisional Back     alignment and domain information
>PF00583 Acetyltransf_1: Acetyltransferase (GNAT) family; InterPro: IPR000182 The N-acetyltransferases (NAT) (EC 2 Back     alignment and domain information
>PRK10314 putative acyltransferase; Provisional Back     alignment and domain information
>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI Back     alignment and domain information
>TIGR03827 GNAT_ablB putative beta-lysine N-acetyltransferase Back     alignment and domain information
>TIGR00376 DNA helicase, putative Back     alignment and domain information
>PRK13688 hypothetical protein; Provisional Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>TIGR03103 trio_acet_GNAT GNAT-family acetyltransferase TIGR03103 Back     alignment and domain information
>TIGR01890 N-Ac-Glu-synth amino-acid N-acetyltransferase Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI Back     alignment and domain information
>PRK10562 putative acetyltransferase; Provisional Back     alignment and domain information
>PRK14712 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins Back     alignment and domain information
>PRK03624 putative acetyltransferase; Provisional Back     alignment and domain information
>PHA02533 17 large terminase protein; Provisional Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>PRK13709 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>PRK10514 putative acetyltransferase; Provisional Back     alignment and domain information
>PF13527 Acetyltransf_9: Acetyltransferase (GNAT) domain; PDB: 3SXN_C 2I00_D 1M4D_B 1M44_A 1M4G_B 1M4I_A 2OZG_A 2HV2_F 3N7Z_A 3RYO_B Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>PRK05279 N-acetylglutamate synthase; Validated Back     alignment and domain information
>TIGR02382 wecD_rffC TDP-D-fucosamine acetyltransferase Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>PHA00673 acetyltransferase domain containing protein Back     alignment and domain information
>PRK10140 putative acetyltransferase YhhY; Provisional Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>PLN02706 glucosamine 6-phosphate N-acetyltransferase Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>cd02169 Citrate_lyase_ligase Citrate lyase ligase Back     alignment and domain information
>PRK07757 acetyltransferase; Provisional Back     alignment and domain information
>TIGR02406 ectoine_EctA L-2,4-diaminobutyric acid acetyltransferase Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>TIGR01547 phage_term_2 phage terminase, large subunit, PBSX family Back     alignment and domain information
>PRK10975 TDP-fucosamine acetyltransferase; Provisional Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>TIGR01686 FkbH FkbH-like domain Back     alignment and domain information
>PF08445 FR47: FR47-like protein; InterPro: IPR013653 Proteins in this entry have a conserved region similar to the C-terminal region of the Drosophila melanogaster (Fruit fly) hypothetical protein FR47 (Q9VR51 from SWISSPROT) Back     alignment and domain information
>PRK09831 putative acyltransferase; Provisional Back     alignment and domain information
>PRK07922 N-acetylglutamate synthase; Validated Back     alignment and domain information
>PLN02825 amino-acid N-acetyltransferase Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>KOG0922 consensus DEAH-box RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK12308 bifunctional argininosuccinate lyase/N-acetylglutamate synthase; Provisional Back     alignment and domain information
>KOG1805 consensus DNA replication helicase [Replication, recombination and repair] Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>PRK15130 spermidine N1-acetyltransferase; Provisional Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>TIGR03448 mycothiol_MshD mycothiol biosynthesis acetyltransferase Back     alignment and domain information
>TIGR03448 mycothiol_MshD mycothiol biosynthesis acetyltransferase Back     alignment and domain information
>PF03354 Terminase_1: Phage Terminase ; InterPro: IPR005021 This entry is represented by Lactococcus phage bIL285, Orf41 (terminase) Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>cd04301 NAT_SF N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate Back     alignment and domain information
>PF03237 Terminase_6: Terminase-like family; InterPro: IPR004921 The terminase is a component of the molecular motor that translocates genomic DNA into empty capsids during DNA packaging [] Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK10809 ribosomal-protein-S5-alanine N-acetyltransferase; Provisional Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK10151 ribosomal-protein-L7/L12-serine acetyltransferase; Provisional Back     alignment and domain information
>PF13420 Acetyltransf_4: Acetyltransferase (GNAT) domain; PDB: 3DR8_A 3DR6_A 2AE6_B 2JLM_C 2J8R_A 1YVO_B 2J8M_A 2J8N_A 2BL1_A 3IWG_A Back     alignment and domain information
>PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>COG1246 ArgA N-acetylglutamate synthase and related acetyltransferases [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00124 cit_ly_ligase [citrate (pro-3S)-lyase] ligase Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>TIGR03585 PseH pseudaminic acid biosynthesis N-acetyl transferase Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK01346 hypothetical protein; Provisional Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG1803 consensus DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>KOG3138 consensus Predicted N-acetyltransferase [General function prediction only] Back     alignment and domain information
>PF13523 Acetyltransf_8: Acetyltransferase (GNAT) domain; PDB: 2VQY_A 2BUE_A 1V0C_A 1YK3_D 2PR8_A 2QIR_A 2PRB_A 2QML_A 2PC1_A Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>KOG3139 consensus N-acetyltransferase [General function prediction only] Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>COG3393 Predicted acetyltransferase [General function prediction only] Back     alignment and domain information
>PF04545 Sigma70_r4: Sigma-70, region 4; InterPro: IPR007630 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>COG2153 ElaA Predicted acyltransferase [General function prediction only] Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>PHA03372 DNA packaging terminase subunit 1; Provisional Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>KOG0920 consensus ATP-dependent RNA helicase A [RNA processing and modification] Back     alignment and domain information
>PF10236 DAP3: Mitochondrial ribosomal death-associated protein 3; InterPro: IPR019368 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>COG1247 Sortase and related acyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>KOG0924 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>KOG3396 consensus Glucosamine-phosphate N-acetyltransferase [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>TIGR02688 conserved hypothetical protein TIGR02688 Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF13302 Acetyltransf_3: Acetyltransferase (GNAT) domain; PDB: 3TTH_C 3JUW_A 2ZXV_A 2Z0Z_A 2VI7_B 3EG7_F 1YRE_C 3IGR_B 3FBU_A 2FCK_A Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>PF08281 Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013249 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>PHA01807 hypothetical protein Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG3234 consensus Acetyltransferase, (GNAT) family [General function prediction only] Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG4626 Phage terminase-like protein, large subunit [General function prediction only] Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG0454 WecD Histone acetyltransferase HPA2 and related acetyltransferases [Transcription / General function prediction only] Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>TIGR01211 ELP3 histone acetyltransferase, ELP3 family Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF04466 Terminase_3: Phage terminase large subunit; InterPro: IPR006701 Initiation of packaging of double-stranded viral DNA involves the specific interaction of the prohead with viral DNA in a process mediated by a phage-encoded terminase protein Back     alignment and domain information
>COG3153 Predicted acetyltransferase [General function prediction only] Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>cd06171 Sigma70_r4 Sigma70, region (SR) 4 refers to the most C-terminal of four conserved domains found in Escherichia coli (Ec) sigma70, the main housekeeping sigma, and related sigma-factors (SFs) Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02959 SigZ RNA polymerase sigma factor, SigZ family Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein Back     alignment and domain information
>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK09047 RNA polymerase factor sigma-70; Validated Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>KOG3216 consensus Diamine acetyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14712 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>PRK12529 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK09652 RNA polymerase sigma factor RpoE; Provisional Back     alignment and domain information
>COG1670 RimL Acetyltransferases, including N-acetylases of ribosomal proteins [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK00118 putative DNA-binding protein; Validated Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF01443 Viral_helicase1: Viral (Superfamily 1) RNA helicase; InterPro: IPR000606 This entry includes RNA and DNA helicases Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>TIGR00708 cobA cob(I)alamin adenosyltransferase Back     alignment and domain information
>PRK07037 extracytoplasmic-function sigma-70 factor; Validated Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>PRK12536 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK11924 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK11054 helD DNA helicase IV; Provisional Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK09642 RNA polymerase sigma factor SigW; Reviewed Back     alignment and domain information
>cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PRK12512 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>COG0507 RecD ATP-dependent exoDNAse (exonuclease V), alpha subunit - helicase superfamily I member [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1802 consensus RNA helicase nonsense mRNA reducing factor (pNORF1) [RNA processing and modification] Back     alignment and domain information
>TIGR02999 Sig-70_X6 RNA polymerase sigma factor, TIGR02999 family Back     alignment and domain information
>PRK12524 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>PRK09643 RNA polymerase sigma factor SigM; Reviewed Back     alignment and domain information
>PF13880 Acetyltransf_13: ESCO1/2 acetyl-transferase Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK12519 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>TIGR02948 SigW_bacill RNA polymerase sigma-W factor Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>PRK05602 RNA polymerase sigma factor; Reviewed Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>TIGR02937 sigma70-ECF RNA polymerase sigma factor, sigma-70 family Back     alignment and domain information
>PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e Back     alignment and domain information
>PRK09639 RNA polymerase sigma factor SigX; Provisional Back     alignment and domain information
>PRK12542 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK09641 RNA polymerase sigma factor SigW; Provisional Back     alignment and domain information
>TIGR02943 Sig70_famx1 RNA polymerase sigma-70 factor, TIGR02943 family Back     alignment and domain information
>PRK09637 RNA polymerase sigma factor SigZ; Provisional Back     alignment and domain information
>PRK12523 RNA polymerase sigma factor; Reviewed Back     alignment and domain information
>KOG3235 consensus Subunit of the major N alpha-acetyltransferase [General function prediction only] Back     alignment and domain information
>PRK12547 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>PRK06851 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02954 Sig70_famx3 RNA polymerase sigma-70 factor, TIGR02954 family Back     alignment and domain information
>PRK09648 RNA polymerase sigma factor SigD; Reviewed Back     alignment and domain information
>PRK12531 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12526 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>KOG0923 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK12520 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>KOG4144 consensus Arylalkylamine N-acetyltransferase [General function prediction only] Back     alignment and domain information
>PRK11923 algU RNA polymerase sigma factor AlgU; Provisional Back     alignment and domain information
>PRK12539 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only] Back     alignment and domain information
>PRK10919 ATP-dependent DNA helicase Rep; Provisional Back     alignment and domain information
>PRK06759 RNA polymerase factor sigma-70; Validated Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>PRK09646 RNA polymerase sigma factor SigK; Reviewed Back     alignment and domain information
>PRK12527 RNA polymerase sigma factor; Reviewed Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>PRK12514 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12546 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK13919 putative RNA polymerase sigma E protein; Provisional Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PRK11773 uvrD DNA-dependent helicase II; Provisional Back     alignment and domain information
>PRK12530 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK09415 RNA polymerase factor sigma C; Reviewed Back     alignment and domain information
>KOG0345 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK12534 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12516 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12528 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12522 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>KOG0926 consensus DEAH-box RNA helicase [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK12537 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>TIGR01074 rep ATP-dependent DNA helicase Rep Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK12545 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PRK13709 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PRK08301 sporulation sigma factor SigE; Reviewed Back     alignment and domain information
>TIGR02939 RpoE_Sigma70 RNA polymerase sigma factor RpoE Back     alignment and domain information
>PRK09644 RNA polymerase sigma factor SigM; Provisional Back     alignment and domain information
>PRK04217 hypothetical protein; Provisional Back     alignment and domain information
>PF12568 DUF3749: Acetyltransferase (GNAT) domain; InterPro: IPR024612 This domain is found in uncharacterised proteins from Gammaproteobacteria, and is approximately 40 amino acids in length Back     alignment and domain information
>PRK12540 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12543 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>TIGR02989 Sig-70_gvs1 RNA polymerase sigma-70 factor, Rhodopirellula/Verrucomicrobium family Back     alignment and domain information
>PRK09645 RNA polymerase sigma factor SigL; Provisional Back     alignment and domain information
>PRK12525 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>TIGR02983 SigE-fam_strep RNA polymerase sigma-70 factor, sigma-E family Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>TIGR02984 Sig-70_plancto1 RNA polymerase sigma-70 factor, Planctomycetaceae-specific subfamily 1 Back     alignment and domain information
>TIGR01075 uvrD DNA helicase II Back     alignment and domain information
>PRK06288 RNA polymerase sigma factor WhiG; Reviewed Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>TIGR02985 Sig70_bacteroi1 RNA polymerase sigma-70 factor, Bacteroides expansion family 1 Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd03282 ABC_MSH4_euk MutS4 homolog in eukaryotes Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>TIGR02947 SigH_actino RNA polymerase sigma-70 factor, TIGR02947 family Back     alignment and domain information
>PRK12532 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>PHA02535 P terminase ATPase subunit; Provisional Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK12533 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12904 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK06930 positive control sigma-like factor; Validated Back     alignment and domain information
>PRK12511 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12515 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>TIGR02950 SigM_subfam RNA polymerase sigma factor, SigM family Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>TIGR02980 SigBFG RNA polymerase sigma-70 factor, sigma-B/F/G subfamily Back     alignment and domain information
>smart00421 HTH_LUXR helix_turn_helix, Lux Regulon Back     alignment and domain information
>TIGR02952 Sig70_famx2 RNA polymerase sigma-70 factor, TIGR02952 family Back     alignment and domain information
>PRK06986 fliA flagellar biosynthesis sigma factor; Validated Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK12544 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK09647 RNA polymerase sigma factor SigE; Reviewed Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family Back     alignment and domain information
>smart00488 DEXDc2 DEAD-like helicases superfamily Back     alignment and domain information
>smart00489 DEXDc3 DEAD-like helicases superfamily Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK09649 RNA polymerase sigma factor SigC; Reviewed Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>PRK12538 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12535 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK09651 RNA polymerase sigma factor FecI; Provisional Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK12541 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PRK05803 sporulation sigma factor SigK; Reviewed Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>PRK07670 RNA polymerase sigma factor SigD; Validated Back     alignment and domain information
>PRK09640 RNA polymerase sigma factor SigX; Reviewed Back     alignment and domain information
>cd06170 LuxR_C_like C-terminal DNA-binding domain of LuxR-like proteins Back     alignment and domain information
>PF14542 Acetyltransf_CG: GCN5-related N-acetyl-transferase; PDB: 2H5M_A 2Q44_A 1XMT_A 2Q4Y_A 2IL4_A 2EVN_A 1R57_A Back     alignment and domain information
>PRK06851 hypothetical protein; Provisional Back     alignment and domain information
>KOG0925 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK12518 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>TIGR02479 FliA_WhiG RNA polymerase sigma factor, FliA/WhiG family Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>PF08444 Gly_acyl_tr_C: Aralkyl acyl-CoA:amino acid N-acyltransferase, C-terminal region; InterPro: IPR013652 This entry represents mammalian-specific glycine N-acyltransferase (also called aralkyl acyl-CoA:amino acid N-acyltransferase; 2 Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PHA03311 helicase-primase subunit BBLF4; Provisional Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>PRK12513 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01073 pcrA ATP-dependent DNA helicase PcrA Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>PRK12517 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK07408 RNA polymerase sigma factor SigF; Reviewed Back     alignment and domain information
>PF00196 GerE: Bacterial regulatory proteins, luxR family; InterPro: IPR000792 This domain is a DNA-binding, helix-turn-helix (HTH) domain of about 65 amino acids, present in transcription regulators of the LuxR/FixJ family of response regulators Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>PF07374 DUF1492: Protein of unknown function (DUF1492); InterPro: IPR010861 This entry is represented by Streptococcus phage 7201, Orf19 Back     alignment and domain information
>TIGR03001 Sig-70_gmx1 RNA polymerase sigma-70 factor, Myxococcales family 1 Back     alignment and domain information
>KOG2488 consensus Acetyltransferase (GNAT) domain-containing protein [General function prediction only] Back     alignment and domain information
>PRK08583 RNA polymerase sigma factor SigB; Validated Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>PRK05911 RNA polymerase sigma factor sigma-28; Reviewed Back     alignment and domain information
>PRK08295 RNA polymerase factor sigma-70; Validated Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query835
2zpa_A671 Crystal Structure Of Trna(Met) Cytidine Acetyltrans 4e-19
>pdb|2ZPA|A Chain A, Crystal Structure Of Trna(Met) Cytidine Acetyltransferase Length = 671 Back     alignment and structure 
Iteration: 1

 Score = 93.6 bits (231), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 90/368 (24%), Positives = 141/368 (38%), Gaps = 76/368 (20%)
Query: 79  STVALLAARGRGKSXXXXXXXXXXXXXXYSNIFVTAPSPENLKTLFEFVCKGFNAIEYKE 138
              A+ AARGRGKS                   VTAP+  +   L +F  + F  I    
Sbjct: 193 GVAAVTAARGRGKSALAGQLISRIA----GRAIVTAPAKASTDVLAQFAGEKFRFIAPDA 248
Query: 139 HIDYDIVRSSNPDLRKPIVRINIYRQHRQTIQYMEPHEHEKLAQVELLVIDEAAAIPLPV 198
            +  D                                      Q + LV+DEAAAIP P+
Sbjct: 249 LLASD-------------------------------------EQADWLVVDEAAAIPAPL 271
Query: 199 VRSLLGPY-LVFLSSTVNGYEGTGRSLSLKLLHQLEQQSHMPAKGVEGSAHGCLFKKIEL 257
           +  L+  +    L++TV GYEGTGR   LK   +                      + EL
Sbjct: 272 LHQLVSRFPRTLLTTTVQGYEGTGRGFLLKFCARFPH-----------------LHRFEL 314
Query: 258 SESIRYAPGDPIESWLNGLLCLDVMNSIPHINRLPPPSECDLYYVNRDTLFSYHKESELF 317
            + IR+A G P+E  ++  L  D  N   H      P    +      TL+    E+ L 
Sbjct: 315 QQPIRWAQGCPLEKXVSEALVFDDEN-FTHT-----PQGNIVISAFEQTLWQSDPETPL- 367
Query: 318 LQRMMALYVSSHYKNSPNDLQLMADAPAHHLFVLLGPVDESKNQLPDILCVIQVCLEGQI 377
             ++  L   +HY+ SP DL+   DAP  H     G     +N++   L ++    EG +
Sbjct: 368 --KVYQLLSGAHYRTSPLDLRRXXDAPGQHFLQAAG-----ENEIAGALWLVD---EGGL 417
Query: 378 SRRSVLKSFSEGHQPSGDQIPWKFSEQFRDAVFPSLSGARIVRIATHPSAMRLGYGSTAV 437
           S++     ++   +P G+ +    +    + +  +L G R+ RIA HP+  R G G   +
Sbjct: 418 SQQLSQAVWAGFRRPRGNLVAQSLAAHGNNPLAATLRGRRVSRIAVHPARQREGTGRQLI 477
Query: 438 ELLTRYYE 445
               +Y +
Sbjct: 478 AGALQYTQ 485

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query835
2zpa_A671 Uncharacterized protein YPFI; RNA modification enz 1e-114
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-17
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-07
>2zpa_A Uncharacterized protein YPFI; RNA modification enzyme, RNA helicase, acetyltransferase, GCN5 acetyltransferase; HET: ACO ADP; 2.35A {Escherichia coli K12} Length = 671 Back     alignment and structure
 Score =  360 bits (925), Expect = e-114
 Identities = 120/637 (18%), Positives = 200/637 (31%), Gaps = 181/637 (28%)

Query: 56  CSTLDQGKAVITFLDAILDKTLRSTVALLAARGRGKSAALGLAIAGAIAAGYSNIFVTAP 115
               +Q + +   +            A+ AARGRGKSA  G  I+           VTAP
Sbjct: 175 APQPEQQQLLKQLM-----TMPPGVAAVTAARGRGKSALAGQLISR----IAGRAIVTAP 225

Query: 116 SPENLKTLFEFVCKGFNAIEYKEHIDYDIVRSSNPDLRKPIVRINIYRQHRQTIQYMEPH 175
           +  +   L +F  + F  I     +  D                                
Sbjct: 226 AKASTDVLAQFAGEKFRFIAPDALLASDE------------------------------- 254

Query: 176 EHEKLAQVELLVIDEAAAIPLPVVRSLLGPY-LVFLSSTVNGYEGTGRSLSLKLLHQLEQ 234
                 Q + LV+DEAAAIP P++  L+  +    L++TV GYEGTGR   LK   +   
Sbjct: 255 ------QADWLVVDEAAAIPAPLLHQLVSRFPRTLLTTTVQGYEGTGRGFLLKFCARFPH 308

Query: 235 QSHMPAKGVEGSAHGCLFKKIELSESIRYAPGDPIESWLNGLLCLDVMNSIPHINRLPPP 294
                              + EL + IR+A G P+E  ++  L  D  N          P
Sbjct: 309 -----------------LHRFELQQPIRWAQGCPLEKMVSEALVFDDENF------THTP 345

Query: 295 SECDLYYVNRDTLFSYHKESELFLQRMMALYVSSHYKNSPNDLQLMADAPAHHLFVLLGP 354
               +      TL+    E+     ++  L   +HY+ SP DL+ M DAP  H     G 
Sbjct: 346 QGNIVISAFEQTLWQSDPET---PLKVYQLLSGAHYRTSPLDLRRMMDAPGQHFLQAAGE 402

Query: 355 VDESKNQLPDILCVIQVCLEGQISRRSVLKSFSEGHQPSGDQIPWKFSEQFRDAVFPSLS 414
                    +I   + +  EG +S++     ++   +P G+ +    +    + +  +L 
Sbjct: 403 --------NEIAGALWLVDEGGLSQQLSQAVWAGFRRPRGNLVAQSLAAHGNNPLAATLR 454

Query: 415 GARIVRIATHPSAMRLGYGSTAVELLTRYYEGQLTTFSEIDVEDTVETPEVRVTEAAKKV 474
           G R+ RIA H                                      P  +        
Sbjct: 455 GRRVSRIAVH--------------------------------------PARQ-------- 468

Query: 475 SLLEENIKPKTNLPPLLVHLRERQPEKLNYIGVSFGLTLDLFRFWRKHKFAPFYVSQNAN 534
                    +      L+    +  + L+Y+ VSFG T +L+RFW++  F    +  +  
Sbjct: 469 ---------REGTGRQLIAGALQYTQDLDYLSVSFGYTGELWRFWQRCGFVLVRMGNHRE 519

Query: 535 AVTGEHTCMVLKPLHSEDIEVNESDEWGFFGPFYRDFKQRFFWLLVQHKLQRMDYKLLMS 594
           A +G +T M L P+     +             +   ++    L  Q   + +    L  
Sbjct: 520 ASSGCYTAMALLPMSDAGKQ--------LAEREHYRLRRDAQALA-QWNGETLPVDPLND 570

Query: 595 VLDPKINFKELDPRQDNSDKFLKSLTGVFSANDILRLKDYTNGLIEHYAILDLVPRLAHL 654
            +                           S +D L L  +          L  + RL   
Sbjct: 571 AV--------------------------LSDDDWLELAGFAFAHRPLLTSLGCLLRLLQT 604

Query: 655 YFQEKLPVTLSYVQAAVLLYIGMLGQDISCIQEQMKL 691
                       +    L          + +   +KL
Sbjct: 605 SE----------LALPALRGRLQKNASDAQLCTTLKL 631
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query835
2zpa_A671 Uncharacterized protein YPFI; RNA modification enz 100.0
1ghe_A177 Acetyltransferase; acyl coenzyme A complex; HET: A 98.79
3dr6_A174 YNCA; acetyltransferase, csgid target, essential g 98.72
4e0a_A164 BH1408 protein; structural genomics, PSI-biology, 98.7
3efa_A147 Putative acetyltransferase; structural genom 2, pr 98.7
1q2y_A140 Protein YJCF, similar to hypothetical proteins; GC 98.7
1z4r_A168 General control of amino acid synthesis protein 5- 98.68
1y9w_A140 Acetyltransferase; structural genomics, Pro struct 98.66
3upu_A459 ATP-dependent DNA helicase DDA; RECA-like domain, 98.66
2r7h_A177 Putative D-alanine N-acetyltransferase of GNAT FA; 98.66
1tiq_A180 Protease synthase and sporulation negative regulat 98.65
3lod_A162 Putative acyl-COA N-acyltransferase; structural ge 98.64
1cjw_A166 Protein (serotonin N-acetyltransferase); HET: COT; 98.63
1w36_D608 RECD, exodeoxyribonuclease V alpha chain; recombin 98.63
3kkw_A182 Putative uncharacterized protein; acetyltransferas 98.62
3ld2_A197 SMU.2055, putative acetyltransferase; HET: COA; 2. 98.62
2x7b_A168 N-acetyltransferase SSO0209; HET: COA; 1.95A {Sulf 98.6
1mk4_A157 Hypothetical protein YQJY; alpha-beta-alpha sandwi 98.57
1n71_A180 AAC(6')-II; aminoglycoside 6'-N-acetyltransferase, 98.57
2q7b_A181 Acetyltransferase, GNAT family; NP_689019.1, struc 98.57
2fiw_A172 GCN5-related N-acetyltransferase:aminotransferase 98.57
3ey5_A181 Acetyltransferase-like, GNAT family; structural ge 98.56
2i6c_A160 Putative acetyltransferase; GNAT family, structura 98.56
3e1s_A574 Exodeoxyribonuclease V, subunit RECD; alpha and be 98.55
1kux_A207 Aralkylamine, serotonin N-acetyltransferase; enzym 98.54
1s3z_A165 Aminoglycoside 6'-N-acetyltransferase; GNAT, amino 98.52
3pp9_A187 Putative streptothricin acetyltransferase; toxin p 98.52
3fix_A183 N-acetyltransferase; termoplasma acidophilum, stru 98.5
2ob0_A170 Human MAK3 homolog; acetyltransferase, structural 98.49
1xeb_A150 Hypothetical protein PA0115; midwest center for st 98.48
2cy2_A174 TTHA1209, probable acetyltransferase; structural g 98.48
3t9y_A150 Acetyltransferase, GNAT family; PSI-biology, struc 98.48
2cnt_A160 Modification of 30S ribosomal subunit protein S18; 98.48
3bln_A143 Acetyltransferase GNAT family; NP_981174.1, struct 98.47
2g3a_A152 Acetyltransferase; structural genomics, PSI, prote 98.45
2atr_A138 Acetyltransferase, GNAT family; MCSG, structural g 98.45
4evy_A166 Aminoglycoside N(6')-acetyltransferase type 1; cen 98.45
2pdo_A144 Acetyltransferase YPEA; alpha-beta-alpha sandwich, 98.44
4h89_A173 GCN5-related N-acetyltransferase; N-acyltransferas 98.43
3d8p_A163 Acetyltransferase of GNAT family; NP_373092.1, str 98.43
1qst_A160 TGCN5 histone acetyl transferase; GCN5-related N-a 98.42
2jdc_A146 Glyphosate N-acetyltransferase; GNAT; HET: CAO; 1. 98.41
2fia_A162 Acetyltransferase; structural genomics, PSI, prote 98.39
2dxq_A150 AGR_C_4057P, acetyltransferase; structural genomic 98.39
2ree_A224 CURA; GNAT, S-acetyltransferase, decarboxylase, po 98.38
2qec_A204 Histone acetyltransferase HPA2 and related acetylt 98.37
1ygh_A164 ADA4, protein (transcriptional activator GCN5); tr 98.37
3f8k_A160 Protein acetyltransferase; GCN5-related N-acetyltr 98.35
2fe7_A166 Probable N-acetyltransferase; structural genomics, 98.32
2ae6_A166 Acetyltransferase, GNAT family; GCN5-related N-ace 98.32
3mgd_A157 Predicted acetyltransferase; structural genomics, 98.32
3i3g_A161 N-acetyltransferase; malaria, structural genomics, 98.31
1vkc_A158 Putative acetyl transferase; structural genomics, 98.3
2i79_A172 Acetyltransferase, GNAT family; acetyl coenzyme *A 98.3
4ag7_A165 Glucosamine-6-phosphate N-acetyltransferase; HET: 98.28
3gy9_A150 GCN5-related N-acetyltransferase; YP_001815201.1, 98.28
4fd4_A217 Arylalkylamine N-acetyltransferase like 5B; GNAT; 98.28
1y7r_A133 Hypothetical protein SA2161; structural genomics, 98.28
3s6f_A145 Hypothetical acetyltransferase; acyl-COA N-acyltra 98.27
2gan_A190 182AA long hypothetical protein; alpha-beta protei 98.27
1z4e_A153 Transcriptional regulator; nysgxrc target T2017, G 98.27
3owc_A188 Probable acetyltransferase; structural genomics, P 98.23
2kcw_A147 Uncharacterized acetyltransferase YJAB; GNAT fold, 98.23
1wwz_A159 Hypothetical protein PH1933; structural genomics, 98.22
3f5b_A182 Aminoglycoside N(6')acetyltransferase; APC60744, l 98.2
3g8w_A169 Lactococcal prophage PS3 protein 05; APC61042, ace 98.2
1qsm_A152 HPA2 histone acetyltransferase; protein-acetyl coe 98.19
1yx0_A159 Hypothetical protein YSNE; NESG, GFT structral gen 98.19
3dsb_A157 Putative acetyltransferase; APC60368.2, ST genomic 98.18
1vhs_A175 Similar to phosphinothricin acetyltransferase; str 98.18
2ozh_A142 Hypothetical protein XCC2953; structural genomics, 98.17
2oh1_A179 Acetyltransferase, GNAT family; YP_013287.1, struc 98.16
4fd5_A222 Arylalkylamine N-acetyltransferase 2; GNAT; 1.64A 98.16
1u6m_A199 Acetyltransferase, GNAT family; structural genomic 98.15
2eui_A153 Probable acetyltransferase; dimer, structural geno 98.14
3exn_A160 Probable acetyltransferase; GCN5-related N-acetylt 98.13
2aj6_A159 Hypothetical protein MW0638; structural genomics, 98.12
1bo4_A168 Protein (serratia marcescens aminoglycoside-3-N- a 98.12
2ge3_A170 Probable acetyltransferase; structural GEN PSI, pr 98.12
3jvn_A166 Acetyltransferase; alpha-beta protein, structural 98.11
1y9k_A157 IAA acetyltransferase; structural genomics, midwes 98.11
3ddd_A288 Putative acetyltransferase; NP_142035.1, structura 98.09
2j8m_A172 Acetyltransferase PA4866 from P. aeruginosa; GCN5 98.09
2g0b_A198 FEEM; N-acyl transferase, environmental DNA, prote 98.09
3fnc_A163 Protein LIN0611, putative acetyltransferase; GNAT, 98.08
2b5g_A171 Diamine acetyltransferase 1; structural genomics, 98.08
3fyn_A176 Integron gene cassette protein HFX_CASS3; integron 98.07
2r1i_A172 GCN5-related N-acetyltransferase; YP_831484.1, put 98.07
3eg7_A176 Spermidine N1-acetyltransferase; structural genomi 98.07
2jlm_A182 Putative phosphinothricin N-acetyltransferase; met 98.06
2fl4_A149 Spermine/spermidine acetyltransferase; structural 98.04
3e0k_A150 Amino-acid acetyltransferase; N-acetylglutamate sy 98.04
2pr1_A163 Uncharacterized N-acetyltransferase YLBP; YIBP pro 98.04
3qb8_A197 A654L protein; GNAT N-acetyltransferase, acetyltra 98.03
3i9s_A183 Integron cassette protein; oyster POND, woods HOLE 98.02
2pc1_A201 Acetyltransferase, GNAT family; NP_688560.1, struc 98.02
2q0y_A153 GCN5-related N-acetyltransferase; YP_295895.1, ace 98.02
3t90_A149 Glucose-6-phosphate acetyltransferase 1; GNAT fold 98.0
2k5t_A128 Uncharacterized protein YHHK; N-acetyl transferase 97.99
1yr0_A175 AGR_C_1654P, phosphinothricin acetyltransferase; s 97.98
2bei_A170 Diamine acetyltransferase 2; SSAT2, BC011751, AAH1 97.97
1ufh_A180 YYCN protein; alpha and beta, fold, acetyltransfer 97.96
3frm_A254 Uncharacterized conserved protein; APC61048, staph 97.95
3d3s_A189 L-2,4-diaminobutyric acid acetyltransferase; alpha 97.95
1m4i_A181 Aminoglycoside 2'-N-acetyltransferase; COA binding 97.92
2bue_A202 AAC(6')-IB; GNAT, transferase, aminoglycoside, flu 97.91
2vi7_A177 Acetyltransferase PA1377; GNAT, GCN5 family, N-ace 97.9
1i12_A160 Glucosamine-phosphate N-acetyltransferase; GNAT, a 97.87
3d2m_A456 Putative acetylglutamate synthase; protein-COA-Glu 97.87
2o0j_A385 Terminase, DNA packaging protein GP17; nucleotide- 97.86
3te4_A215 GH12636P, dopamine N acetyltransferase, isoform A; 97.84
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 97.82
1yvk_A163 Hypothetical protein BSU33890; ALPHS-beta protein, 97.81
3c26_A266 Putative acetyltransferase TA0821; NP_394282.1, A 97.8
2gk6_A624 Regulator of nonsense transcripts 1; UPF1, helicas 97.8
4b3f_X646 DNA-binding protein smubp-2; hydrolase, helicase; 97.78
2wjy_A800 Regulator of nonsense transcripts 1; nonsense medi 97.77
1on0_A158 YYCN protein; structural genomics, alpha-beta prot 97.73
1rif_A282 DAR protein, DNA helicase UVSW; bacteriophage, REC 97.72
3igr_A184 Ribosomal-protein-S5-alanine N-acetyltransferase; 97.71
3tth_A170 Spermidine N1-acetyltransferase; central intermedi 97.68
2q04_A211 Acetoin utilization protein; ZP_00540088.1, struct 97.67
2o28_A184 Glucosamine 6-phosphate N-acetyltransferase; struc 97.63
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 97.62
3cpe_A592 Terminase, DNA packaging protein GP17; large termi 97.59
3ec4_A228 Putative acetyltransferase from the GNAT family; Y 97.59
1s7k_A182 Acetyl transferase; GNAT; 1.80A {Salmonella typhim 97.59
1nsl_A184 Probable acetyltransferase; structural genomics, h 97.58
2fck_A181 Ribosomal-protein-serine acetyltransferase, putat; 97.58
3tt2_A330 GCN5-related N-acetyltransferase; structural genom 97.57
3juw_A175 Probable GNAT-family acetyltransferase; structural 97.57
2wpx_A339 ORF14; transferase, acetyl transferase, antibiotic 97.54
2vez_A190 Putative glucosamine 6-phosphate acetyltransferase 97.53
3fbu_A168 Acetyltransferase, GNAT family; structur genomics, 97.51
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 97.48
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 97.47
3h4q_A188 Putative acetyltransferase; NP_371943.1, structura 97.45
4fd7_A238 Putative arylalkylamine N-acetyltransferase 7; GNA 97.44
3eo4_A164 Uncharacterized protein MJ1062; APC60792.2,MJ_1062 97.42
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 97.4
2xzl_A802 ATP-dependent helicase NAM7; hydrolase-RNA complex 97.4
1r57_A102 Conserved hypothetical protein; GCN5, N-acetyltran 97.36
1yre_A197 Hypothetical protein PA3270; APC5563, midwest cent 97.36
2xau_A773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 97.35
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 97.35
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 97.35
3r9f_A188 MCCE protein; microcin C7, acetyltransferase, SELF 97.33
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 97.32
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 97.3
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 97.27
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 97.27
3iwg_A276 Acetyltransferase, GNAT family; structural genomic 97.27
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 97.26
2zw5_A301 Bleomycin acetyltransferase; dimer, two domains; H 97.25
2va8_A715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 97.25
2qml_A198 BH2621 protein; structural genomics, joint center 97.24
3tt2_A330 GCN5-related N-acetyltransferase; structural genom 97.23
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 97.22
1p0h_A318 Hypothetical protein RV0819; GNAT fold, acetyltran 97.21
3bor_A237 Human initiation factor 4A-II; translation initiat 97.2
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 97.18
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 97.17
2wpx_A339 ORF14; transferase, acetyl transferase, antibiotic 97.16
2vzy_A218 RV0802C; transferase, GCN5-related N-acetyltransfe 97.15
3g3s_A249 GCN5-related N-acetyltransferase; ZP_00874857.1, a 97.14
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 97.13
2ozg_A396 GCN5-related N-acetyltransferase; YP_325469.1, ace 97.13
2fsr_A195 Acetyltransferase; alpha-beta-sandwich, structural 97.1
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 97.1
1p0h_A318 Hypothetical protein RV0819; GNAT fold, acetyltran 97.08
3sqw_A579 ATP-dependent RNA helicase MSS116, mitochondrial; 97.08
1sqh_A312 Hypothetical protein CG14615-PA; structural genomi 97.06
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 97.06
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 97.04
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 97.02
3n7z_A388 Acetyltransferase, GNAT family; PSI2, MCSG, struct 96.99
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 96.98
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 96.96
3pzj_A209 Probable acetyltransferases; MCSG, PSI-2, structur 96.94
2i00_A406 Acetyltransferase, GNAT family; structural genomic 96.94
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 96.93
2z10_A194 Ribosomal-protein-alanine acetyltransferase; alpha 96.93
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 96.91
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 96.91
1gm5_A780 RECG; helicase, replication restart; HET: DNA ADP; 96.89
3tcv_A246 GCN5-related N-acetyltransferase; GRAM negative co 96.88
2hv2_A400 Hypothetical protein; PSI, protein structure initi 96.88
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 96.88
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 96.85
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 96.84
3h1t_A590 Type I site-specific restriction-modification syst 96.82
2zj8_A720 DNA helicase, putative SKI2-type helicase; RECA fo 96.82
3b6e_A216 Interferon-induced helicase C domain-containing P; 96.81
4ava_A333 Lysine acetyltransferase; allosteric regulation, d 96.8
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 96.8
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 96.8
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 96.77
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 96.74
1yk3_A210 Hypothetical protein RV1347C/MT1389; acyltransfera 96.73
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 96.72
2qgz_A308 Helicase loader, putative primosome component; str 96.72
3r1k_A428 Enhanced intracellular surviVal protein; GNAT, ace 96.72
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 96.61
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 96.59
2p6r_A702 Afuhel308 helicase; protein-DNA complex, SF2 helic 96.57
2eyq_A1151 TRCF, transcription-repair coupling factor; MFD, S 96.56
3sxn_A422 Enhanced intracellular surviVal protein; GNAT fold 96.54
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 96.49
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 96.48
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 96.47
2z83_A459 Helicase/nucleoside triphosphatase; hydrolase, mem 96.46
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 96.46
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 96.43
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 96.37
2chg_A226 Replication factor C small subunit; DNA-binding pr 96.31
2ykg_A696 Probable ATP-dependent RNA helicase DDX58; hydrola 96.3
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 96.28
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 96.24
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 96.2
3bos_A242 Putative DNA replication factor; P-loop containing 96.14
2v6i_A431 RNA helicase; membrane, hydrolase, transmembrane, 96.14
1yks_A440 Genome polyprotein [contains: flavivirin protease 96.06
1ro5_A201 Autoinducer synthesis protein LASI; alpha-beta-alp 96.05
2whx_A618 Serine protease/ntpase/helicase NS3; transcription 95.98
2jlq_A451 Serine protease subunit NS3; ribonucleoprotein, nu 95.92
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 95.9
2ft0_A235 TDP-fucosamine acetyltransferase; GNAT fold acetyl 95.87
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 95.86
1xmt_A103 Putative acetyltransferase; structural genomics, p 95.86
3vkw_A446 Replicase large subunit; alpha/beta domain, helica 95.86
3o8b_A666 HCV NS3 protease/helicase; ntpase, RNA, translocat 95.81
2wv9_A673 Flavivirin protease NS2B regulatory subunit, FLAV 95.77
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 95.73
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 95.71
4a2w_A936 RIG-I, retinoic acid inducible protein I; hydrolas 95.63
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 95.61
3p2h_A201 AHL synthase; acyl-ACP binding, SAM binding, signa 95.4
2kjq_A149 DNAA-related protein; solution structure, NESG, st 95.39
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 95.38
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 95.25
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 95.19
4gl2_A699 Interferon-induced helicase C domain-containing P; 95.19
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 94.94
1kzf_A230 Acyl-homoserinelactone synthase ESAI; alpha-beta, 94.81
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 94.72
3pvs_A447 Replication-associated recombination protein A; ma 94.45
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 94.34
2o8x_A70 Probable RNA polymerase sigma-C factor; promoter r 94.31
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 94.25
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 94.23
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 94.22
2v1x_A591 ATP-dependent DNA helicase Q1; DNA strand annealin 94.2
3hug_A92 RNA polymerase sigma factor; ECF sigma factor, zin 94.15
1sxj_A516 Activator 1 95 kDa subunit; clamp loader, processi 94.09
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 94.08
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 93.82
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 93.78
1oyw_A523 RECQ helicase, ATP-dependent DNA helicase; winged 93.71
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 93.63
3dmq_A968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 93.59
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 93.57
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 93.56
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 93.53
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 93.34
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 93.33
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 93.33
3rc3_A677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 93.33
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 93.29
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 93.2
1ku3_A73 Sigma factor SIGA; helix-turn-helix, transcription 92.83
4f92_B1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 92.76
3mzy_A164 RNA polymerase sigma-H factor; PSI, MCSG, structur 92.73
2chq_A319 Replication factor C small subunit; DNA-binding pr 92.66
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 92.56
3e2i_A219 Thymidine kinase; Zn-binding, ATP-binding, DNA syn 92.54
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 92.52
1g5t_A196 COB(I)alamin adenosyltransferase; P-loop protein, 92.42
1z63_A500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 92.39
3lfu_A647 DNA helicase II; SF1 helicase, ATP-binding, DNA da 92.37
2p7v_B68 Sigma-70, RNA polymerase sigma factor RPOD; RSD, r 92.16
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 92.11
2r8r_A228 Sensor protein; KDPD, PFAM02702, MCSG, structural 92.06
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 91.95
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 91.77
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 91.77
3co5_A143 Putative two-component system transcriptional RES 91.76
2ce7_A476 Cell division protein FTSH; metalloprotease; HET: 91.63
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 91.21
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 91.17
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 91.15
1tty_A87 Sigma-A, RNA polymerase sigma factor RPOD; helix-t 91.15
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 91.08
1bob_A320 HAT1, histone acetyltransferase; histone modificat 90.97
2j9r_A214 Thymidine kinase; TK1, DNK, lasso, transferase, AT 90.9
1qvr_A854 CLPB protein; coiled coil, AAA ATPase, chaperone; 90.74
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 90.7
1or7_A194 Sigma-24, RNA polymerase sigma-E factor; regulatio 90.69
2v1u_A387 Cell division control protein 6 homolog; DNA repli 90.56
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 90.48
1xsv_A113 Hypothetical UPF0122 protein SAV1236; helix-turn-h 90.04
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 89.97
2cvh_A220 DNA repair and recombination protein RADB; filamen 89.96
3c57_A95 Two component transcriptional regulatory protein; 89.89
3t72_q99 RNA polymerase sigma factor RPOD, DNA-directed RN 89.84
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 89.69
2r62_A268 Cell division protease FTSH homolog; ATPase domain 89.68
1s7o_A113 Hypothetical UPF0122 protein SPY1201/SPYM3_0842/SP 89.62
1rp3_A239 RNA polymerase sigma factor sigma-28 (FLIA); trans 89.61
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 89.4
1uaa_A673 REP helicase, protein (ATP-dependent DNA helicase 89.33
1fse_A74 GERE; helix-turn-helix DNA-binding protein transcr 89.14
3u4q_A 1232 ATP-dependent helicase/nuclease subunit A; helicas 88.72
2w00_A1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 88.51
1ojl_A304 Transcriptional regulatory protein ZRAR; response 88.35
1je8_A82 Nitrate/nitrite response regulator protein NARL; p 88.14
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 88.06
1x3u_A79 Transcriptional regulatory protein FIXJ; helix-tur 87.83
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 87.7
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 87.66
1pjr_A724 PCRA; DNA repair, DNA replication, SOS response, h 87.6
2r44_A331 Uncharacterized protein; putative ATPase, structur 87.44
3ulq_B90 Transcriptional regulatory protein COMA; tetratric 87.4
4a15_A620 XPD helicase, ATP-dependent DNA helicase TA0057; h 87.05
1z3i_X644 Similar to RAD54-like; recombination ATPase helica 86.44
2gno_A305 DNA polymerase III, gamma subunit-related protein; 86.09
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 85.5
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 85.41
1c4o_A664 DNA nucleotide excision repair enzyme UVRB; uvrabc 85.25
1tf5_A844 Preprotein translocase SECA subunit; ATPase, helic 85.01
1xp8_A366 RECA protein, recombinase A; recombination, radior 84.75
1p4w_A99 RCSB; solution structure, DNA binding domain, DNA 84.72
1u94_A356 RECA protein, recombinase A; homologous recombinat 84.11
2rnj_A91 Response regulator protein VRAR; HTH LUXR-type dom 83.95
2d4p_A141 Hypothetical protein TTHA1254; structural genomics 83.9
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 83.87
2orv_A234 Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 83.58
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 83.18
3pxg_A468 Negative regulator of genetic competence CLPC/MEC; 82.89
3crv_A551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 82.68
2fsf_A853 Preprotein translocase SECA subunit; ATPase, DNA-R 82.66
3cmu_A2050 Protein RECA, recombinase A; homologous recombinat 82.41
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 82.36
1um8_A376 ATP-dependent CLP protease ATP-binding subunit CL; 82.16
2z43_A324 DNA repair and recombination protein RADA; archaea 82.11
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 81.99
1w4r_A195 Thymidine kinase; type II, human, cytosolic, phosp 81.6
2p0w_A324 Histone acetyltransferase type B catalytic subuni; 81.57
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 81.43
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 81.37
1nkt_A922 Preprotein translocase SECA 1 subunit; preprotein 80.83
1odf_A290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 80.22
2jpc_A61 SSRB; DNA binding protein, structural genomics, PS 80.17
2q1z_A184 RPOE, ECF SIGE; ECF sigma factor, cupin fold, zinc 80.04
>2zpa_A Uncharacterized protein YPFI; RNA modification enzyme, RNA helicase, acetyltransferase, GCN5 acetyltransferase; HET: ACO ADP; 2.35A {Escherichia coli K12} Back     alignment and structure
Probab=100.00  E-value=5.9e-107  Score=944.53  Aligned_cols=478  Identities=26%  Similarity=0.360  Sum_probs=420.5

Q ss_pred             cccCCcHHHHHHHHHHHHHHhccCCCcEEEEEcCCCCCHHHHHHHHHHHHHHcCCCcEEEecCChHhHHHHHHHHHhhhc
Q 003262           53 IKKCSTLDQGKAVITFLDAILDKTLRSTVALLAARGRGKSAALGLAIAGAIAAGYSNIFVTAPSPENLKTLFEFVCKGFN  132 (835)
Q Consensus        53 v~~~~T~DQakAl~~~~~~i~ek~~r~~v~LTA~RGRGKSAaLGlaiA~ai~~g~~nI~VTAPs~enl~tlFef~~kgl~  132 (835)
                      ...|.|.||++||.+|++.+     ..+++|||+|||||||++|+++|.++    .+++||||+++|+++||+|+.+   
T Consensus       172 ~~~~~T~dQ~~al~~~~~~~-----~~~~vlta~RGRGKSa~lG~~~a~~~----~~~~vtAP~~~a~~~l~~~~~~---  239 (671)
T 2zpa_A          172 ATGAPQPEQQQLLKQLMTMP-----PGVAAVTAARGRGKSALAGQLISRIA----GRAIVTAPAKASTDVLAQFAGE---  239 (671)
T ss_dssp             CCSSCCHHHHHHHHHHTTCC-----SEEEEEEECTTSSHHHHHHHHHHHSS----SCEEEECSSCCSCHHHHHHHGG---
T ss_pred             CCCCCCHHHHHHHHHHHHhh-----hCeEEEecCCCCCHHHHHHHHHHHHH----hCcEEECCCHHHHHHHHHHhhC---
Confidence            34699999999999888754     24689999999999999999999885    4689999999999999999742   


Q ss_pred             cccccccccceeeecCCCCCCcceeEeeeeeccceeEEeeCCccc-cccCCCcEEEEecccCCCHHHHHHhhcCC-eEEE
Q 003262          133 AIEYKEHIDYDIVRSSNPDLRKPIVRINIYRQHRQTIQYMEPHEH-EKLAQVELLVIDEAAAIPLPVVRSLLGPY-LVFL  210 (835)
Q Consensus       133 ~lgy~e~~dy~i~~st~p~~~~aivrvni~~~hrq~Iqyi~P~d~-~~l~~adLLvIDEAAAIPlpllk~Ll~~y-~vfl  210 (835)
                                                         +|+|++|+++ ....++||||||||||||+|+|++|+++| +|||
T Consensus       240 -----------------------------------~i~~~~Pd~~~~~~~~~dlliVDEAAaIp~pll~~ll~~~~~v~~  284 (671)
T 2zpa_A          240 -----------------------------------KFRFIAPDALLASDEQADWLVVDEAAAIPAPLLHQLVSRFPRTLL  284 (671)
T ss_dssp             -----------------------------------GCCBCCHHHHHHSCCCCSEEEEETGGGSCHHHHHHHHTTSSEEEE
T ss_pred             -----------------------------------CeEEeCchhhhhCcccCCEEEEEchhcCCHHHHHHHHhhCCeEEE
Confidence                                               2789999986 45678999999999999999999999999 7999


Q ss_pred             EeeccCCcccCCchhHHHHHHhhhcCCCCCCCcCCCccCCceeEEEeccccccCCCCchHHHHHHhcCCCCCCCCCCCCC
Q 003262          211 SSTVNGYEGTGRSLSLKLLHQLEQQSHMPAKGVEGSAHGCLFKKIELSESIRYAPGDPIESWLNGLLCLDVMNSIPHINR  290 (835)
Q Consensus       211 sSTi~GYEGTGR~fsLKl~~~L~~~~~~~~~~~~~~~~~r~~~ei~L~ePIRya~gDPvE~WLn~lLcLDa~~~~~~~~~  290 (835)
                      ||||||||||||||+|||+++|+                 .|++++|+|||||++|||||+|||++||||+++++    +
T Consensus       285 ~tTv~GYEGtGrgf~lk~~~~L~-----------------~~~~~~L~~piR~a~~DplE~wl~~~llld~~~~~----~  343 (671)
T 2zpa_A          285 TTTVQGYEGTGRGFLLKFCARFP-----------------HLHRFELQQPIRWAQGCPLEKMVSEALVFDDENFT----H  343 (671)
T ss_dssp             EEEBSSTTBBCHHHHHHHHHTST-----------------TCEEEECCSCSSSCTTCHHHHHHHHHHTCCCGGGG----S
T ss_pred             EecCCcCCCcCcccccccHhhcC-----------------CCcEEEccCceecCCCCCHHHHHHHhhCcCCCCCC----C
Confidence            99999999999999999999992                 38899999999999999999999999999998642    4


Q ss_pred             CCCCCCcceEeeCcccccccCcCcHHHHHHHHHHHHhcccCCChhHHHHhhcCCCceEEEEecCCcccCCCCCCeEEEEE
Q 003262          291 LPPPSECDLYYVNRDTLFSYHKESELFLQRMMALYVSSHYKNSPNDLQLMADAPAHHLFVLLGPVDESKNQLPDILCVIQ  370 (835)
Q Consensus       291 ~p~p~~c~l~~Vnrd~Lfs~h~~sE~fLq~~~aLlV~AHYkNsPnDLqlL~DaPah~lfvL~~p~~~~~~~lp~il~viq  370 (835)
                      +| |+.|++++||||+||+    +|.+|+++|+|||+|||||+||||++|+|+|+|++||+..     +   ++|+|+++
T Consensus       344 ~~-~~~~~~~~~~~~~l~~----~e~~L~~~~~Ll~~aHYr~sp~dL~~llD~p~~~l~va~~-----~---g~IVG~i~  410 (671)
T 2zpa_A          344 TP-QGNIVISAFEQTLWQS----DPETPLKVYQLLSGAHYRTSPLDLRRMMDAPGQHFLQAAG-----E---NEIAGALW  410 (671)
T ss_dssp             CC-CSCCEEEEEETTHHHH----CTHHHHHHHHHHHHHSSSBCHHHHHHHHHCTTEEEEEEEC-----S---SSEEEEEE
T ss_pred             CC-CCcceEEEEcHHHhhc----CHHHHHHHHHHHHhcccCCCHHHHHHHhcCCCceEEEEEE-----C---CeEEEEEE
Confidence            55 6999999999999997    6899999999999999999999999999999999999872     1   58999999


Q ss_pred             eeecCCCCHHHHHHHHhcCCCCCCCchhHHHHHhhccCCCCCCcccEEEEEeeCcccccCChHHHHHHHHHHHHhccccc
Q 003262          371 VCLEGQISRRSVLKSFSEGHQPSGDQIPWKFSEQFRDAVFPSLSGARIVRIATHPSAMRLGYGSTAVELLTRYYEGQLTT  450 (835)
Q Consensus       371 ValEG~is~~~~~~~l~~G~Rp~GdLIPw~ls~q~~d~~f~~lsgaRIVRIAvhPd~q~mGyGsraL~~L~~~~~g~~~~  450 (835)
                      ++.||+++++.+.+++++++||+||||||++++|+++++|++++++||+||||||+|||+|||+++|+.++++       
T Consensus       411 v~~eG~l~~~~~~~~~~g~rRp~G~lip~~l~~~~~~~e~~~~~~~~I~~IAV~P~~rg~GiG~~LL~~~e~~-------  483 (671)
T 2zpa_A          411 LVDEGGLSQQLSQAVWAGFRRPRGNLVAQSLAAHGNNPLAATLRGRRVSRIAVHPARQREGTGRQLIAGALQY-------  483 (671)
T ss_dssp             EEEEECCCHHHHHHHHHTSCCCSSCHHHHHHHHHSSCTTGGGSEEEEEEEEEECTTSCSSSHHHHHHHHHHHT-------
T ss_pred             EEEcCCcCHHHHHHHHhcccCCCCcchhHHHHHhhcchhhcccCceEEEEEEECHHHcCCCHHHHHHHHHHHH-------
Confidence            9999999999999999999999999999999999999999999999999999999999999999999876542       


Q ss_pred             ccccccccccCCcchhhhhHHhhhhcccccccCCCCCCcccccccccCCCCcceEEEecCCCHHHHHHHHHCCCeEEEee
Q 003262          451 FSEIDVEDTVETPEVRVTEAAKKVSLLEENIKPKTNLPPLLVHLRERQPEKLNYIGVSFGLTLDLFRFWRKHKFAPFYVS  530 (835)
Q Consensus       451 ~~e~~~~~~~~~~~~~v~~~~~~~~l~~e~i~~r~~~ppLl~~l~e~~~~~lDylGvSFGlT~~Ll~FWkk~GF~pVylr  530 (835)
                                                                      ..+++|++|+||.|..+++||+|+||.+++++
T Consensus       484 ------------------------------------------------a~~~~~l~v~~~~n~~ai~FYek~GF~~v~ig  515 (671)
T 2zpa_A          484 ------------------------------------------------TQDLDYLSVSFGYTGELWRFWQRCGFVLVRMG  515 (671)
T ss_dssp             ------------------------------------------------CCSCSEEEEEEECCHHHHHHHHHTTCEEEEEC
T ss_pred             ------------------------------------------------HhcCCEEEEEecCCHHHHHHHHHCCCEEEeee
Confidence                                                            24568999999999999999999999999999


Q ss_pred             ecccCCCCCceEEEEccCCcccccccccCccchHHHHHHHHHHHHHhhhhhccCCCCCHHHHHHhcCCcccCCCCCCCCC
Q 003262          531 QNANAVTGEHTCMVLKPLHSEDIEVNESDEWGFFGPFYRDFKQRFFWLLVQHKLQRMDYKLLMSVLDPKINFKELDPRQD  610 (835)
Q Consensus       531 q~~ne~TGEhS~IMlr~L~~~~~~~~~~~~~~wl~~~~~dF~~Rf~~lL~~~~fr~l~~~lal~lL~~~~~~~~~~~~~~  610 (835)
                      +.+|..+|||+++|+|||+..+        ..+...+.+.|++++..+. .           +.-+...           
T Consensus       516 ~~~~~~~Ge~a~iM~k~L~~~g--------~~l~d~~~~~f~r~~~~l~-~-----------~~~~~~~-----------  564 (671)
T 2zpa_A          516 NHREASSGCYTAMALLPMSDAG--------KQLAEREHYRLRRDAQALA-Q-----------WNGETLP-----------  564 (671)
T ss_dssp             SSCCTTTCCCEEEEEEECSHHH--------HHHHHHHHHHHHHHHHHHH-H-----------HHTSCCS-----------
T ss_pred             eccccCCCceeeeeeeehhhhH--------HHHHHHHHHHHHHhhhhhh-h-----------ccccccc-----------
Confidence            9999999999999999999766        6688889999998874332 1           1111100           


Q ss_pred             CCcccccccCCCCCHHHHHHHHHHhcCCcchhhhhchHHHHHHHHhhccCCCCccHHHHHHHHHHHhcCCCHHHHHHHhC
Q 003262          611 NSDKFLKSLTGVFSANDILRLKDYTNGLIEHYAILDLVPRLAHLYFQEKLPVTLSYVQAAVLLYIGMLGQDISCIQEQMK  690 (835)
Q Consensus       611 ~~~l~~~~~~~~ls~~Dl~rL~~ya~~~~dy~~i~Dllp~La~lyf~~~l~~~Ls~~q~~iLla~gLQ~Ks~~~v~~el~  690 (835)
                         +.. ..+..+++.|+++|..|+.+...|+.+.   |.|.+++....+       +..+|+++++|+++|++++++++
T Consensus       565 ---~~~-~~~~~l~~~d~~~L~~fa~g~r~~e~~~---~al~rl~~~~~~-------~~~~L~~~~~Q~~~~~~~~~~l~  630 (671)
T 2zpa_A          565 ---VDP-LNDAVLSDDDWLELAGFAFAHRPLLTSL---GCLLRLLQTSEL-------ALPALRGRLQKNASDAQLCTTLK  630 (671)
T ss_dssp             ---SCC-CCCCCCCHHHHHHHHHHHHSCCCTTTTH---HHHHHHHHHCCS-------CCHHHHHHHHSCCCHHHHHHHTT
T ss_pred             ---ccc-cCccCCCHHHHHHHHHHHcCCcCHHHHH---HHHHHHHHhccc-------hHHHHHHHHHcCCCHHHHHHHhC
Confidence               000 0023588999999999999999999888   666666654432       34789999999999999999999


Q ss_pred             CCH-HHHHHHHHHHHHHHHHHH
Q 003262          691 LEA-DRIFVLFRKVMTKLTDYL  711 (835)
Q Consensus       691 l~~-~Q~lalf~k~i~kl~~~~  711 (835)
                      ++| ++++..+|++++.++..+
T Consensus       631 ~~g~k~~~~~lR~~~~~~l~~~  652 (671)
T 2zpa_A          631 LSGRKMLLVRQREEAAQALFAL  652 (671)
T ss_dssp             CSSHHHHHHHHHHHHHHHHHTT
T ss_pred             CCcHHHHHHHHHHHHHHHHHhh
Confidence            998 799999999998888665
>1ghe_A Acetyltransferase; acyl coenzyme A complex; HET: ACO; 1.55A {Pseudomonas syringae PV} SCOP: d.108.1.1 PDB: 1j4j_A* Back     alignment and structure
>3dr6_A YNCA; acetyltransferase, csgid target, essential gene, IDP00086, structural genomics, center for STRU genomics of infectious diseases; HET: MSE; 1.75A {Salmonella typhimurium} SCOP: d.108.1.1 PDB: 3dr8_A* Back     alignment and structure
>4e0a_A BH1408 protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG, transferase; 1.80A {Bacillus halodurans} PDB: 4f6a_A* Back     alignment and structure
>3efa_A Putative acetyltransferase; structural genom 2, protein structure initiative, midwest center for structu genomics, MCSG; 2.42A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>1q2y_A Protein YJCF, similar to hypothetical proteins; GCN5-related N-acetyltransferase superfamily fold, NYSGXRC, PSI, protein structure initiative; 2.00A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>1z4r_A General control of amino acid synthesis protein 5-like 2; GCN5, acetyltransferase, SGC, structural genomics, structural genomics consortium; HET: ACO; 1.74A {Homo sapiens} SCOP: d.108.1.1 PDB: 1cm0_B* Back     alignment and structure
>1y9w_A Acetyltransferase; structural genomics, Pro structure initiative, PSI, midwest center for structural GE MCSG; 1.90A {Bacillus cereus} SCOP: d.108.1.1 Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>2r7h_A Putative D-alanine N-acetyltransferase of GNAT FA; putative acetyltransferase of the GNAT family; 1.85A {Desulfovibrio desulfuricans subsp} Back     alignment and structure
>1tiq_A Protease synthase and sporulation negative regulatory protein PAI 1; alpha-beta protein, structural genomics, PSI; HET: COA; 1.90A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>3lod_A Putative acyl-COA N-acyltransferase; structural genomics, PSI2, MCSG, structure initiative; 2.50A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1cjw_A Protein (serotonin N-acetyltransferase); HET: COT; 1.80A {Ovis aries} SCOP: d.108.1.1 PDB: 1b6b_A Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>3kkw_A Putative uncharacterized protein; acetyltransferase, GNAT family, structural genomics, PSI, protein structure initiative; 1.41A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>3ld2_A SMU.2055, putative acetyltransferase; HET: COA; 2.50A {Streptococcus mutans} Back     alignment and structure
>2x7b_A N-acetyltransferase SSO0209; HET: COA; 1.95A {Sulfolobus solfataricus} Back     alignment and structure
>1mk4_A Hypothetical protein YQJY; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>1n71_A AAC(6')-II; aminoglycoside 6'-N-acetyltransferase, antibiotic resistance, coenzyme A; HET: COA; 1.80A {Enterococcus faecium} SCOP: d.108.1.1 PDB: 2a4n_A* 1b87_A* Back     alignment and structure
>2q7b_A Acetyltransferase, GNAT family; NP_689019.1, structural GEN joint center for structural genomics, JCSG; HET: MSE FLC; 2.00A {Streptococcus agalactiae 2603V} Back     alignment and structure
>2fiw_A GCN5-related N-acetyltransferase:aminotransferase II; alpha-beta-alpha sandwich, GCN4-related acetyltransferase, S genomics, PSI; HET: ACO; 2.35A {Rhodopseudomonas palustris} SCOP: d.108.1.1 Back     alignment and structure
>3ey5_A Acetyltransferase-like, GNAT family; structural genomics, APC60148, GNAT famil protein structure initiative; 2.15A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2i6c_A Putative acetyltransferase; GNAT family, structural genomic, structur genomics, PSI-2, protein structure initiative; HET: MSE EPE; 1.30A {Pseudomonas aeruginosa} SCOP: d.108.1.1 PDB: 3pgp_A* Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>1kux_A Aralkylamine, serotonin N-acetyltransferase; enzyme-inhibitor complex, bisubstrate analog, alternate conformations; HET: CA3; 1.80A {Ovis aries} SCOP: d.108.1.1 PDB: 1kuv_A* 1kuy_A* 1l0c_A* 1ib1_E* Back     alignment and structure
>1s3z_A Aminoglycoside 6'-N-acetyltransferase; GNAT, aminoglycoside ribostamycin; HET: COA RIO; 2.00A {Salmonella enteritidis} SCOP: d.108.1.1 PDB: 1s5k_A* 1s60_A* 2vbq_A* Back     alignment and structure
>3pp9_A Putative streptothricin acetyltransferase; toxin production resistance, infectious diseases, structural genomics; HET: MSE ACO; 1.60A {Bacillus anthracis} Back     alignment and structure
>3fix_A N-acetyltransferase; termoplasma acidophilum, structural GEN PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 2.30A {Thermoplasma acidophilum} PDB: 3f0a_A* 3k9u_A* 3ne7_A* Back     alignment and structure
>2ob0_A Human MAK3 homolog; acetyltransferase, structural genomics consortium, SGC; HET: ACO; 1.80A {Homo sapiens} PDB: 2psw_A* 3tfy_A* Back     alignment and structure
>1xeb_A Hypothetical protein PA0115; midwest center for structural genomics, MCSG, structural GEN protein structure initiative, PSI, APC22065; 2.35A {Pseudomonas aeruginosa} SCOP: d.108.1.1 Back     alignment and structure
>2cy2_A TTHA1209, probable acetyltransferase; structural genomics, unknown function, NPPSFA; HET: ACO; 2.00A {Thermus thermophilus} SCOP: d.108.1.1 PDB: 1wk4_A* Back     alignment and structure
>3t9y_A Acetyltransferase, GNAT family; PSI-biology, structural genomics, midwest center for structu genomics, MCSG; HET: PGE; 2.00A {Staphylococcus aureus} Back     alignment and structure
>2cnt_A Modification of 30S ribosomal subunit protein S18; N-alpha acetylation, GCN5-N-acetyltransferase, ribosomal Pro acetyltransferase, GNAT; HET: COA; 2.4A {Salmonella typhimurium} PDB: 2cnm_A* 2cns_A* Back     alignment and structure
>3bln_A Acetyltransferase GNAT family; NP_981174.1, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE MRD GOL; 1.31A {Bacillus cereus} Back     alignment and structure
>2g3a_A Acetyltransferase; structural genomics, PSI, protein structu initiative, midwest center for structural genomics, MCSG; 1.90A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 Back     alignment and structure
>2atr_A Acetyltransferase, GNAT family; MCSG, structural genomics, PSI, protein structure INIT midwest center for structural genomics; 2.01A {Streptococcus pneumoniae} SCOP: d.108.1.1 Back     alignment and structure
>4evy_A Aminoglycoside N(6')-acetyltransferase type 1; center for structural genomics of infectious diseases (csgid national institute of allergy and infectious diseases; HET: TOY; 1.77A {Acinetobacter haemolyticus} PDB: 4f0y_A 4e8o_A Back     alignment and structure
>2pdo_A Acetyltransferase YPEA; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: MSE; 2.00A {Shigella flexneri 2A} Back     alignment and structure
>4h89_A GCN5-related N-acetyltransferase; N-acyltransferase superfamily, structural genomics, PSI-BIOL midwest center for structural genomics, MCSG; 1.37A {Kribbella flavida} Back     alignment and structure
>3d8p_A Acetyltransferase of GNAT family; NP_373092.1, structural GE joint center for structural genomics, JCSG, protein structu initiative; 2.20A {Staphylococcus aureus subsp} Back     alignment and structure
>1qst_A TGCN5 histone acetyl transferase; GCN5-related N-acetyltransferase, COA binding protein; HET: EPE; 1.70A {Tetrahymena thermophila} SCOP: d.108.1.1 PDB: 1m1d_A* 1pu9_A* 1pua_A* 5gcn_A* 1qsr_A* 1q2d_A* 1q2c_A* 1qsn_A* Back     alignment and structure
>2jdc_A Glyphosate N-acetyltransferase; GNAT; HET: CAO; 1.6A {Bacillus licheniformis} SCOP: d.108.1.1 PDB: 2bsw_A* 2jdd_A* Back     alignment and structure
>2fia_A Acetyltransferase; structural genomics, PSI, protein structu initiative, midwest center for structural genomics, MCSG; 2.60A {Enterococcus faecalis} SCOP: d.108.1.1 Back     alignment and structure
>2dxq_A AGR_C_4057P, acetyltransferase; structural genomics, PSI-2, protein struc initiative, midwest center for structural genomics, MCSG; 1.80A {Agrobacterium tumefaciens str} Back     alignment and structure
>2ree_A CURA; GNAT, S-acetyltransferase, decarboxylase, polyketid synthase, loading, phosphopantetheine, transferase, lyase; HET: SO4; 1.95A {Lyngbya majuscula} PDB: 2ref_A* Back     alignment and structure
>2qec_A Histone acetyltransferase HPA2 and related acetyltransferases; NP_600742.1, acetyltransferase (GNAT) family; 1.90A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1ygh_A ADA4, protein (transcriptional activator GCN5); transcriptional regulation, histone acetylation; 1.90A {Saccharomyces cerevisiae} SCOP: d.108.1.1 Back     alignment and structure
>3f8k_A Protein acetyltransferase; GCN5-related N-acetyltransferase; HET: COA; 1.84A {Sulfolobus solfataricus P2} Back     alignment and structure
>2fe7_A Probable N-acetyltransferase; structural genomics, pseudomonas aerugi PSI, protein structure initiative; 2.00A {Pseudomonas aeruginosa ucbpp-pa14} SCOP: d.108.1.1 Back     alignment and structure
>2ae6_A Acetyltransferase, GNAT family; GCN5-related N-acetyltransferase (GNAT), alpha-beta, structu genomics, PSI, protein structure initiative; HET: GOL; 2.19A {Enterococcus faecalis} SCOP: d.108.1.1 Back     alignment and structure
>3mgd_A Predicted acetyltransferase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; HET: ACO; 1.90A {Clostridium acetobutylicum} Back     alignment and structure
>3i3g_A N-acetyltransferase; malaria, structural genomics, structural genomics consortium, SGC,; 1.86A {Trypanosoma brucei} PDB: 3fb3_A Back     alignment and structure
>1vkc_A Putative acetyl transferase; structural genomics, pyrococcus furiosus southeast collaboratory for structural genomics, secsg; 1.89A {Pyrococcus furiosus} SCOP: d.108.1.1 Back     alignment and structure
>2i79_A Acetyltransferase, GNAT family; acetyl coenzyme *A, structur genomics, PSI-2, protein structure initiative; HET: ACO; 2.10A {Streptococcus pneumoniae} Back     alignment and structure
>4ag7_A Glucosamine-6-phosphate N-acetyltransferase; HET: COA; 1.55A {Caenorhabditis elegans} PDB: 4ag9_A* Back     alignment and structure
>3gy9_A GCN5-related N-acetyltransferase; YP_001815201.1, putative acetyltransferase; HET: MSE COA SO4; 1.52A {Exiguobacterium sibiricum 255-15} PDB: 3gya_A* Back     alignment and structure
>4fd4_A Arylalkylamine N-acetyltransferase like 5B; GNAT; 1.95A {Aedes aegypti} Back     alignment and structure
>1y7r_A Hypothetical protein SA2161; structural genomics, protein structure initiative, PSI, midwest center for structural genomics; 1.70A {Staphylococcus aureus} SCOP: d.108.1.1 Back     alignment and structure
>3s6f_A Hypothetical acetyltransferase; acyl-COA N-acyltransferases, structural genomics, joint CENT structural genomics, JCSG; HET: MSE COA; 1.19A {Deinococcus radiodurans} Back     alignment and structure
>2gan_A 182AA long hypothetical protein; alpha-beta protein., structural genomics, PSI, protein struc initiative; 2.10A {Pyrococcus horikoshii} SCOP: d.108.1.1 Back     alignment and structure
>1z4e_A Transcriptional regulator; nysgxrc target T2017, GNAT fold, structural genomics, PSI, P structure initiative; 2.00A {Bacillus halodurans} SCOP: d.108.1.1 Back     alignment and structure
>3owc_A Probable acetyltransferase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; HET: COA; 1.90A {Pseudomonas aeruginosa} Back     alignment and structure
>2kcw_A Uncharacterized acetyltransferase YJAB; GNAT fold, acyltransferase; NMR {Escherichia coli} Back     alignment and structure
>1wwz_A Hypothetical protein PH1933; structural genomics, pyrococcus horikoshii OT3, riken struct genomics/proteomics initiative, RSGI; HET: ACO; 1.75A {Pyrococcus horikoshii} SCOP: d.108.1.1 Back     alignment and structure
>3f5b_A Aminoglycoside N(6')acetyltransferase; APC60744, legionella pneumophila subsp. pneumophila, structural genomics, PSI-2; HET: MSE; 2.00A {Legionella pneumophila subsp} Back     alignment and structure
>3g8w_A Lactococcal prophage PS3 protein 05; APC61042, acetyltransferase, staphylococcus epidermidis ATCC structural genomics; HET: NHE FLC; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>1qsm_A HPA2 histone acetyltransferase; protein-acetyl coenzyme A complex; HET: ACO; 2.40A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 1qso_A Back     alignment and structure
>1yx0_A Hypothetical protein YSNE; NESG, GFT structral genomics, SR220, structural genomics, PSI, protein structure initiative; NMR {Bacillus subtilis subsp} SCOP: d.108.1.1 Back     alignment and structure
>3dsb_A Putative acetyltransferase; APC60368.2, ST genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; HET: MSE; 1.48A {Clostridium difficile} Back     alignment and structure
>1vhs_A Similar to phosphinothricin acetyltransferase; structural genomics, unknown function; 1.80A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>2ozh_A Hypothetical protein XCC2953; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.40A {Xanthomonas campestris PV} Back     alignment and structure
>2oh1_A Acetyltransferase, GNAT family; YP_013287.1, structural genom joint center for structural genomics, JCSG, protein structu initiative; HET: MSE UNL; 1.46A {Listeria monocytogenes str} Back     alignment and structure
>4fd5_A Arylalkylamine N-acetyltransferase 2; GNAT; 1.64A {Aedes aegypti} PDB: 4fd6_A Back     alignment and structure
>1u6m_A Acetyltransferase, GNAT family; structural genomics, PSI, protein structure initiative; 2.40A {Enterococcus faecalis} SCOP: d.108.1.1 Back     alignment and structure
>2eui_A Probable acetyltransferase; dimer, structural genomics, PSI, protein structure initiative; 2.80A {Pseudomonas aeruginosa PAO1} SCOP: d.108.1.1 Back     alignment and structure
>3exn_A Probable acetyltransferase; GCN5-related N-acetyltransferase, MCSG, P structural genomics, protein structure initiative; HET: ACO; 1.80A {Thermus thermophilus} Back     alignment and structure
>2aj6_A Hypothetical protein MW0638; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL; 1.63A {Staphylococcus aureus subsp} SCOP: d.108.1.1 Back     alignment and structure
>1bo4_A Protein (serratia marcescens aminoglycoside-3-N- acetyltransferase); eubacterial aminoglyco resistance, GCN5-related N-acetyltransferase; HET: SPD COA; 2.30A {Serratia marcescens} SCOP: d.108.1.1 Back     alignment and structure
>2ge3_A Probable acetyltransferase; structural GEN PSI, protein structure initiative, midwest center for struc genomics, MCSG; HET: ACO; 2.25A {Agrobacterium tumefaciens} SCOP: d.108.1.1 Back     alignment and structure
>3jvn_A Acetyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 2.61A {Vibrio fischeri} Back     alignment and structure
>1y9k_A IAA acetyltransferase; structural genomics, midwest center for structural genomics bacillus cereus ATCC 14579, PSI; 2.39A {Bacillus cereus atcc 14579} SCOP: d.108.1.1 Back     alignment and structure
>3ddd_A Putative acetyltransferase; NP_142035.1, structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: COA; 2.25A {Pyrococcus horikoshii} Back     alignment and structure
>2j8m_A Acetyltransferase PA4866 from P. aeruginosa; GCN5 family, phosphinothricin, methionine sulfone, methionine sulfoximine; 1.44A {Pseudomonas aeruginosa} PDB: 2bl1_A 2j8n_A 2j8r_A* 1yvo_A Back     alignment and structure
>2g0b_A FEEM; N-acyl transferase, environmental DNA, protein-product compl antibiotic synthase, transferase; HET: NLT; 3.00A {Uncultured bacterium} Back     alignment and structure
>3fnc_A Protein LIN0611, putative acetyltransferase; GNAT, RIMI, structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.75A {Listeria innocua} SCOP: d.108.1.0 Back     alignment and structure
>2b5g_A Diamine acetyltransferase 1; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: ALY; 1.70A {Homo sapiens} SCOP: d.108.1.1 PDB: 2b4d_A* 2jev_A* 2g3t_A 2f5i_A 2b3u_A 2b3v_A* 2b4b_A* 2b58_A* 2fxf_A* 3bj7_A* 3bj8_A* Back     alignment and structure
>3fyn_A Integron gene cassette protein HFX_CASS3; integron cassette protein, mobIle metagenome, structural genomics, PSI-2; 1.45A {Uncultured bacterium} Back     alignment and structure
>2r1i_A GCN5-related N-acetyltransferase; YP_831484.1, putative acetyltransferase, arthrobacter SP. FB acetyltransferase (GNAT) family; HET: MSE; 1.65A {Arthrobacter SP} Back     alignment and structure
>3eg7_A Spermidine N1-acetyltransferase; structural genomics, IDP016 transferase, center for structural genomics of infectious D csgid; HET: MSE; 2.38A {Vibrio cholerae} SCOP: d.108.1.0 Back     alignment and structure
>2jlm_A Putative phosphinothricin N-acetyltransferase; methionine sulfoximine; 2.35A {Acinetobacter baylyi} Back     alignment and structure
>2fl4_A Spermine/spermidine acetyltransferase; structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 1.60A {Enterococcus faecalis} SCOP: d.108.1.1 Back     alignment and structure
>3e0k_A Amino-acid acetyltransferase; N-acetylglutamate synthase, structu genomics, PSI-2, protein structure initiative; HET: MSE; 2.52A {Vibrio parahaemolyticus} Back     alignment and structure
>2pr1_A Uncharacterized N-acetyltransferase YLBP; YIBP protein, coenzyme A, structural GE PSI-2, protein structure initiative; HET: SUC COA; 3.20A {Bacillus subtilis} Back     alignment and structure
>3qb8_A A654L protein; GNAT N-acetyltransferase, acetyltransferase, COA, spermine, spermidine, transferase; HET: COA; 1.50A {Paramecium bursaria chlorella virus 1} Back     alignment and structure
>3i9s_A Integron cassette protein; oyster POND, woods HOLE, acetyltransferase, structural genomics, PSI-2, protein structure initiative; 2.20A {Vibrio cholerae} Back     alignment and structure
>2pc1_A Acetyltransferase, GNAT family; NP_688560.1, structural genom joint center for structural genomics, JCSG; HET: MSE; 1.28A {Streptococcus agalactiae 2603V} Back     alignment and structure
>2q0y_A GCN5-related N-acetyltransferase; YP_295895.1, acetyltransferase (GNAT) family, structural genomics, joint center for ST genomics; HET: MSE; 1.80A {Ralstonia eutropha JMP134} Back     alignment and structure
>3t90_A Glucose-6-phosphate acetyltransferase 1; GNAT fold, glcnac biosynthesis, alpha/beta protein; HET: EPE; 1.50A {Arabidopsis thaliana} Back     alignment and structure
>2k5t_A Uncharacterized protein YHHK; N-acetyl transferase, COA, bound ligand, coenzyme A, structural genomics, PSI-2, protein structure initiative; HET: COA; NMR {Escherichia coli K12} Back     alignment and structure
>1yr0_A AGR_C_1654P, phosphinothricin acetyltransferase; structural genomics, protein structure initiative, NYSGXRC, PSI; 2.00A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 Back     alignment and structure
>2bei_A Diamine acetyltransferase 2; SSAT2, BC011751, AAH11751, thialysine N-acetyltransferase, structural genomics, protein structure initiative, PSI; HET: ACO; 1.84A {Homo sapiens} SCOP: d.108.1.1 PDB: 2q4v_A* Back     alignment and structure
>1ufh_A YYCN protein; alpha and beta, fold, acetyltransferase, structural genomics, PSI, protein structure initiative; 2.20A {Bacillus subtilis subsp} SCOP: d.108.1.1 Back     alignment and structure
>3frm_A Uncharacterized conserved protein; APC61048, staphylococcus epidermidis ATCC structural genomics, PSI-2, protein structure initiative; HET: MES; 2.32A {Staphylococcus epidermidis} Back     alignment and structure
>3d3s_A L-2,4-diaminobutyric acid acetyltransferase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: MSE; 1.87A {Bordetella parapertussis 12822} Back     alignment and structure
>1m4i_A Aminoglycoside 2'-N-acetyltransferase; COA binding motif; HET: COA KAN PAP; 1.50A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1m4d_A* 1m4g_A* 1m44_A* Back     alignment and structure
>2bue_A AAC(6')-IB; GNAT, transferase, aminoglycoside, fluoroquinolone, acetyltransferase, antibiotic resistance; HET: COA RIO; 1.7A {Escherichia coli} PDB: 1v0c_A* 2vqy_A* 2prb_A* 2qir_A* 2pr8_A* Back     alignment and structure
>2vi7_A Acetyltransferase PA1377; GNAT, GCN5 family, N-acetyltransferase, hypothetical protein; 2.25A {Pseudomonas aeruginosa} Back     alignment and structure
>1i12_A Glucosamine-phosphate N-acetyltransferase; GNAT, alpha/beta; HET: ACO; 1.30A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 1i1d_A* 1i21_A Back     alignment and structure
>3d2m_A Putative acetylglutamate synthase; protein-COA-Glu ternary complex, transferase; HET: COA GLU; 2.21A {Neisseria gonorrhoeae} PDB: 2r8v_A* 3b8g_A* 2r98_A* 3d2p_A* Back     alignment and structure
>2o0j_A Terminase, DNA packaging protein GP17; nucleotide-binding fold, hydrolase; HET: DNA ADP; 1.80A {Enterobacteria phage T4} PDB: 2o0h_A* 2o0k_A* Back     alignment and structure
>3te4_A GH12636P, dopamine N acetyltransferase, isoform A; dopamine/acetyl COA, N-acetyltransferase domain; HET: ACO; 1.46A {Drosophila melanogaster} PDB: 3v8i_A* Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>1yvk_A Hypothetical protein BSU33890; ALPHS-beta protein, structural genomics, PSI, protein structure initiative; HET: COA; 3.01A {Bacillus subtilis subsp} SCOP: d.108.1.1 Back     alignment and structure
>3c26_A Putative acetyltransferase TA0821; NP_394282.1, A putative acetyltransferase, acetyltransferase family, structural genomics; 2.00A {Thermoplasma acidophilum dsm 1728} Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Back     alignment and structure
>1on0_A YYCN protein; structural genomics, alpha-beta protein with anti-parallel B strands, PSI, protein structure initiative; 2.20A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 Back     alignment and structure
>3igr_A Ribosomal-protein-S5-alanine N-acetyltransferase; fisch MCSG, structural genomics, midwest center for structural GE protein structure initiative; HET: MSE; 2.00A {Vibrio fischeri} SCOP: d.108.1.0 Back     alignment and structure
>3tth_A Spermidine N1-acetyltransferase; central intermediary metabolism; 3.30A {Coxiella burnetii} Back     alignment and structure
>2q04_A Acetoin utilization protein; ZP_00540088.1, structural genom joint center for structural genomics, JCSG, protein structu initiative; HET: MSE; 2.33A {Exiguobacterium sibiricum} Back     alignment and structure
>2o28_A Glucosamine 6-phosphate N-acetyltransferase; structural genomics, structural genomics consortium, SGC; HET: 16G COA; 1.80A {Homo sapiens} PDB: 2huz_A* 3cxq_A* 3cxs_A 3cxp_A Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>3cpe_A Terminase, DNA packaging protein GP17; large terminase, alternative initiation, ATP-binding, DNA- binding, hydrolase, nuclease; HET: DNA; 2.80A {Bacteriophage T4} PDB: 3ezk_A* Back     alignment and structure
>3ec4_A Putative acetyltransferase from the GNAT family; YP_497011.1, joint center for structural genomics; 1.80A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID} Back     alignment and structure
>1s7k_A Acetyl transferase; GNAT; 1.80A {Salmonella typhimurium} SCOP: d.108.1.1 PDB: 1s7l_A* 1s7n_A* 1s7f_A 1z9u_A Back     alignment and structure
>1nsl_A Probable acetyltransferase; structural genomics, hexamer, alpha-beta, PSI, protein struc initiative, midwest center for structural genomics; 2.70A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>2fck_A Ribosomal-protein-serine acetyltransferase, putat; ribosomal-protein structural genomics, PSI, protein structure initiative; HET: MSE; 1.70A {Vibrio cholerae o1 biovar eltor} SCOP: d.108.1.1 Back     alignment and structure
>3tt2_A GCN5-related N-acetyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta sandwich; HET: MES; 2.73A {Sphaerobacter thermophilus} Back     alignment and structure
>3juw_A Probable GNAT-family acetyltransferase; structural genomics, APC60242, acetyltransferas protein structure initiative; HET: MSE; 2.11A {Bordetella pertussis} Back     alignment and structure
>2wpx_A ORF14; transferase, acetyl transferase, antibiotic biosynthesis; HET: ACO; 2.31A {Streptomyces clavuligerus} PDB: 2wpw_A* Back     alignment and structure
>2vez_A Putative glucosamine 6-phosphate acetyltransferase; acyltransferase; HET: ACO G6P; 1.45A {Aspergillus fumigatus} PDB: 2vxk_A* Back     alignment and structure
>3fbu_A Acetyltransferase, GNAT family; structur genomics, PSI2, MCSG, protein structure initiative, midwest for structural genomics; HET: COA; 1.80A {Bacillus anthracis str} Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>3h4q_A Putative acetyltransferase; NP_371943.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE P33; 2.50A {Staphylococcus aureus subsp} Back     alignment and structure
>4fd7_A Putative arylalkylamine N-acetyltransferase 7; GNAT, COA binding; 1.80A {Aedes aegypti} Back     alignment and structure
>3eo4_A Uncharacterized protein MJ1062; APC60792.2,MJ_1062,methanocaldococcus jannaschii DSM 2661, S genomics, PSI-2; HET: MES PG6; 2.19A {Methanocaldococcus jannaschii} Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1r57_A Conserved hypothetical protein; GCN5, N-acetyltransferase, structural genomics, PSI, protein structure initiative; NMR {Staphylococcus aureus} SCOP: d.108.1.1 PDB: 2h5m_A* Back     alignment and structure
>1yre_A Hypothetical protein PA3270; APC5563, midwest center for structural genomics, MSC protein structure initiative, PSI, MCSG; HET: COA; 2.15A {Pseudomonas aeruginosa} SCOP: d.108.1.1 Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>3r9f_A MCCE protein; microcin C7, acetyltransferase, SELF immunity, resistance, A coenzyme A, transferase; HET: COA GSU; 1.20A {Escherichia coli} PDB: 3r95_A* 3r96_A* 3r9e_A* 3r9g_A* Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3iwg_A Acetyltransferase, GNAT family; structural genomics, APC, PSI-2, protein structure initiativ midwest center for structural genomics; HET: MSE; 2.30A {Colwellia psychrerythraea} Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>2zw5_A Bleomycin acetyltransferase; dimer, two domains; HET: COA; 2.40A {Streptomyces verticillus} PDB: 2zw4_A* 2zw6_A 2zw7_A* Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>2qml_A BH2621 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, unknown function; HET: MSE; 1.55A {Bacillus halodurans} Back     alignment and structure
>3tt2_A GCN5-related N-acetyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta sandwich; HET: MES; 2.73A {Sphaerobacter thermophilus} Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1p0h_A Hypothetical protein RV0819; GNAT fold, acetyltransferase, coenzyme A complex, MSHD, TRAN; HET: COA ACO; 1.60A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1ozp_A* 2c27_A* Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>2wpx_A ORF14; transferase, acetyl transferase, antibiotic biosynthesis; HET: ACO; 2.31A {Streptomyces clavuligerus} PDB: 2wpw_A* Back     alignment and structure
>2vzy_A RV0802C; transferase, GCN5-related N-acetyltransferase, succinyltransferase; HET: FLC; 2.00A {Mycobacterium tuberculosis} PDB: 2vzz_A* Back     alignment and structure
>3g3s_A GCN5-related N-acetyltransferase; ZP_00874857.1, acetyltransferase (GNAT) family, structural joint center for structural genomics, JCSG; HET: MSE; 1.80A {Streptococcus suis} Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>2ozg_A GCN5-related N-acetyltransferase; YP_325469.1, acetyltransfe (GNAT) family, structural genomics, joint center for struct genomics, JCSG; HET: COA; 2.00A {Anabaena variabilis} SCOP: d.106.1.4 d.108.1.10 Back     alignment and structure
>2fsr_A Acetyltransferase; alpha-beta-sandwich, structural genomics, PSI, protein struc initiative, midwest center for structural genomics; HET: PEG; 1.52A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>1p0h_A Hypothetical protein RV0819; GNAT fold, acetyltransferase, coenzyme A complex, MSHD, TRAN; HET: COA ACO; 1.60A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1ozp_A* 2c27_A* Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1sqh_A Hypothetical protein CG14615-PA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Drosophila melanogaster} SCOP: d.108.1.5 Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>3n7z_A Acetyltransferase, GNAT family; PSI2, MCSG, structural genomics, protein structure initiativ midwest center for structural genomics; 2.75A {Bacillus anthracis} Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>3pzj_A Probable acetyltransferases; MCSG, PSI-2, structural genomics, protein structure initiati midwest center for structural genomics; HET: MSE; 1.85A {Chromobacterium violaceum} Back     alignment and structure
>2i00_A Acetyltransferase, GNAT family; structural genomics, PSI-2, structure initiative, midwest center for structural genomic transferase; 2.30A {Enterococcus faecalis} SCOP: d.106.1.4 d.108.1.10 Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>2z10_A Ribosomal-protein-alanine acetyltransferase; alpha/beta protein, acyltransferase, structural genomics, NPPSFA; HET: IYR; 1.77A {Thermus thermophilus} PDB: 2z0z_A* 2z11_A* 2zxv_A* Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>3tcv_A GCN5-related N-acetyltransferase; GRAM negative coccobacillus, brucellosis, acyl CO-A, arylami transferase; 1.75A {Brucella melitensis biovar abortus 230ORGANISM_TAXID} Back     alignment and structure
>2hv2_A Hypothetical protein; PSI, protein structure initiative, midwest center for struct genomics, MCSG, structural genomics, unknown function; HET: EPE PG4; 2.40A {Enterococcus faecalis} SCOP: d.106.1.4 d.108.1.10 Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>4ava_A Lysine acetyltransferase; allosteric regulation, domain coupling; HET: ACO; 1.70A {Mycobacterium tuberculosis} PDB: 4avb_A* 4avc_A* Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>1yk3_A Hypothetical protein RV1347C/MT1389; acyltransferase, GCN5-related fold, structural genomics, PSI, protein structure initiative; HET: BOG; 2.20A {Mycobacterium tuberculosis} SCOP: d.108.1.1 Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>3r1k_A Enhanced intracellular surviVal protein; GNAT, acetyltransferase, transferase; HET: COA; 1.95A {Mycobacterium tuberculosis} PDB: 3sxo_A 3ryo_A 3uy5_A Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>3sxn_A Enhanced intracellular surviVal protein; GNAT fold, acetyltransferase, acetyl COA binding, transferas; HET: COA; 2.03A {Mycobacterium smegmatis} Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>1ro5_A Autoinducer synthesis protein LASI; alpha-beta-alpha sandwich, phosphopantetheine fold, signalin; 2.30A {Pseudomonas aeruginosa} SCOP: d.108.1.3 Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>2ft0_A TDP-fucosamine acetyltransferase; GNAT fold acetyltransferase, structural genomics, montreal-K bacterial structural genomics initiative, BSGI; HET: ACO; 1.66A {Escherichia coli} PDB: 2fs5_A* Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1xmt_A Putative acetyltransferase; structural genomics, protein structure initiative, CESG, AT1G77540, center for eukaryotic structural genomics; 1.15A {Arabidopsis thaliana} SCOP: d.108.1.1 PDB: 2q44_A 2evn_A 2il4_A* 2q4y_A* Back     alignment and structure
>3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>3p2h_A AHL synthase; acyl-ACP binding, SAM binding, signaling protein-I MTA complex, signaling protein-inhibitor complex; HET: MTA NOO; 2.00A {Burkholderia glumae} PDB: 3p2f_A* Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>1kzf_A Acyl-homoserinelactone synthase ESAI; alpha-beta, autoinducer synthase, quorum sensing, bacterial pathogenesis, ligase; 1.80A {Pantoea stewartii subsp} SCOP: d.108.1.3 PDB: 1k4j_A Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>2o8x_A Probable RNA polymerase sigma-C factor; promoter recognition, transcription regulation, helix-turn-H motif, transcription; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>3hug_A RNA polymerase sigma factor; ECF sigma factor, zinc binding anti-sigma factor, oxidative transcription regulation; 2.35A {Mycobacterium tuberculosis} Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>1ku3_A Sigma factor SIGA; helix-turn-helix, transcription; 1.80A {Thermus aquaticus} SCOP: a.4.13.2 PDB: 1ku7_A 1rio_H 3n97_A* Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>3mzy_A RNA polymerase sigma-H factor; PSI, MCSG, structural genomics, midwest center for structura genomics, protein structure initiative; 2.50A {Fusobacterium nucleatum subsp} Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A* Back     alignment and structure
>2p7v_B Sigma-70, RNA polymerase sigma factor RPOD; RSD, regulator of sigma 70, sigma 70 domain 4, transcription, regulation, helix-turn-helix; 2.60A {Escherichia coli} SCOP: a.4.13.2 Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>1tty_A Sigma-A, RNA polymerase sigma factor RPOD; helix-turn-helix, transcription; NMR {Thermotoga maritima} SCOP: a.4.13.2 Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>1bob_A HAT1, histone acetyltransferase; histone modification, acetyl coenzyme A binding-protein; HET: ACO; 2.30A {Saccharomyces cerevisiae} SCOP: d.108.1.1 Back     alignment and structure
>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>1or7_A Sigma-24, RNA polymerase sigma-E factor; regulation, DNA-binding, transmembrane, transcription; 2.00A {Escherichia coli} SCOP: a.4.13.2 a.177.1.1 PDB: 2h27_A Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>1xsv_A Hypothetical UPF0122 protein SAV1236; helix-turn-helix, putative DNA-binding protein, signal recognition particle, unknown function; 1.70A {Staphylococcus aureus subsp} SCOP: a.4.13.3 Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>3c57_A Two component transcriptional regulatory protein; response regulator, two-component regulatory system, DNA-BIN protein; 1.70A {Mycobacterium tuberculosis} PDB: 1zlk_A 1zlj_A Back     alignment and structure
>3t72_q RNA polymerase sigma factor RPOD, DNA-directed RN polymerase subunit beta; winged-helix motif, transcription activation, DNA-binding; 4.33A {Escherichia coli} PDB: 1tlh_B Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>1s7o_A Hypothetical UPF0122 protein SPY1201/SPYM3_0842/SPS1042/SPYM18_1152; putative DNA binding protein, structural genomics; 2.31A {Streptococcus pyogenes serotype M3} SCOP: a.4.13.3 Back     alignment and structure
>1rp3_A RNA polymerase sigma factor sigma-28 (FLIA); transcription; 2.30A {Aquifex aeolicus} SCOP: a.4.13.1 a.4.13.2 a.177.1.1 PDB: 1sc5_A Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>1uaa_A REP helicase, protein (ATP-dependent DNA helicase REP.); complex (helicase/DNA), DNA unwinding, hydrolase/DNA complex; HET: DNA; 3.00A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1fse_A GERE; helix-turn-helix DNA-binding protein transcriptional regulat transcription; 2.05A {Bacillus subtilis} SCOP: a.4.6.2 Back     alignment and structure
>3u4q_A ATP-dependent helicase/nuclease subunit A; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_A* Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>1je8_A Nitrate/nitrite response regulator protein NARL; protein-DNA complex, two-component response regulator, helix-turn-helix, DNA bending; 2.12A {Escherichia coli} SCOP: a.4.6.2 PDB: 1zg1_A 1zg5_A Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1x3u_A Transcriptional regulatory protein FIXJ; helix-turn-helix; NMR {Sinorhizobium meliloti} Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>1pjr_A PCRA; DNA repair, DNA replication, SOS response, helicase, ATP- binding, DNA-binding; 2.50A {Geobacillus stearothermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1qhg_A* 3pjr_A* 2pjr_A* 1qhh_B* 1qhh_D* 1qhh_A* 1qhh_C* 2pjr_B* Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>3ulq_B Transcriptional regulatory protein COMA; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} PDB: 2krf_A Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>1p4w_A RCSB; solution structure, DNA binding domain, DNA binding protein; NMR {Erwinia amylovora} SCOP: a.4.6.2 Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>2rnj_A Response regulator protein VRAR; HTH LUXR-type domain, DNA binding domain, activator, antibiotic resistance, cytoplasm, DNA-binding; NMR {Staphylococcus aureus} Back     alignment and structure
>2d4p_A Hypothetical protein TTHA1254; structural genomics, NPPSFA, national project on protein STR and functional analyses; 1.70A {Thermus thermophilus} SCOP: d.108.1.1 PDB: 2d4o_A Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* Back     alignment and structure
>2p0w_A Histone acetyltransferase type B catalytic subuni; HAT1, structural genomics, structural genomics consortium, S transferase; HET: ACO; 1.90A {Homo sapiens} Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>2jpc_A SSRB; DNA binding protein, structural genomics, PSI-2, protein structure initiative; NMR {Salmonella typhimurium} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query835
d1tiqa_173 Protease synthase and sporulation negative regulat 98.93
d1n71a_180 Aminoglycoside 6'-N-acetyltransferase {Enterococcu 98.9
d2atra1137 Probable acetyltransferase SP0256 {Streptococcus p 98.74
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 98.74
d2jdca1145 Probable acetyltransferase YitI {Bacillus lichenif 98.67
d2g3aa1137 Probable acetyltransferase Atu2258 {Agrobacterium 98.61
d1y9wa1140 Probable acetyltransferase BC2806 {Bacillus cereus 98.61
d1yx0a1151 Hypothetical protein YsnE {Bacillus subtilis [TaxI 98.6
d1ghea_170 Tabtoxin resistance protein {Pseudomonas syringae 98.57
d1wwza1157 Hypothetical protein PH1933 {Pyrococcus horikoshii 98.56
d1y9ka1152 IAA acetyltransferase {Bacillus cereus [TaxId: 139 98.5
d1z4ea1150 Transcriptional regulator BH1968 {Bacillus halodur 98.49
d2gana1182 Hypothetical protein PH0736 {Pyrococcus horikoshii 98.49
d2i6ca1160 Putative acetyltransferase PA4794 {Pseudomonas aer 98.47
d1y7ra1133 Hypothetical protein SA2161 {Staphylococcus aureus 98.46
d1qsra_162 Catalytic domain of GCN5 histone acetyltransferase 98.46
d1s3za_147 Aminoglycoside N-acetyltransferase AAC(6')-IY {Sal 98.41
d2fl4a1146 Probable spermine/spermidine acetyltransferase EF1 98.37
d1z4ra1162 Catalytic domain of GCN5 histone acetyltransferase 98.34
d1vkca_149 Putative acetyltransferase PF0028 {Pyrococcus furi 98.31
d1yr0a1163 Phosphinothricin acetyltransferase {Agrobacterium 98.31
d1yvoa1169 Hypothetical protein PA4866 {Pseudomonas aeruginos 98.3
d1q2ya_140 Probable acetyltransferase YjcF {Bacillus subtilis 98.29
d1vhsa_165 Putative phosphinothricin acetyltransferase YwnH { 98.27
d2fiwa1156 Probable N-acetyltransferase RPA1999 {Rhodopseudom 98.27
d1ufha_155 Putative acetyltransferase YycN {Bacillus subtilis 98.26
d2fe7a1156 Probable N-acetyltransferase PA0478 {Pseudomonas a 98.25
d1u6ma_189 Putative acetyltransferase EF0945 {Enterococcus fa 98.24
d2fiaa1157 Probable acetyltransferase EF1919 {Enterococcus fa 98.22
d2cy2a1174 Probable acetyltransferase TTHA1209 {Thermus therm 98.17
d1mk4a_157 Hypothetical protein YqiY {Bacillus subtilis [TaxI 98.16
d1ygha_164 Catalytic domain of GCN5 histone acetyltransferase 98.15
d2ae6a1161 Putative acetyltransferase EF0244 {Enterococcus fa 98.06
d1cjwa_166 Serotonin N-acetyltranferase {Sheep (Ovis aries) [ 98.06
d1i12a_157 Glucosamine-phosphate N-acetyltransferase GNA1 {Ba 97.96
d1yvka1152 Hypothetical protein YvbK (BSu33890) {Bacillus sub 97.94
d1xeba_149 Hypothetical protein PA0115 {Pseudomonas aeruginos 97.92
d2beia1167 Diamine acetyltransferase 2 {Human (Homo sapiens) 97.86
d1m4ia_181 Aminoglycoside 2'-N-acetyltransferase {Mycobacteri 97.84
d2ge3a1164 Probable acetyltransferase Atu2290 {Agrobacterium 97.76
d2b5ga1167 Diamine acetyltransferase 1 {Human (Homo sapiens) 97.68
d1qsma_150 Histone acetyltransferase HPA2 {Baker's yeast (Sac 97.42
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 97.4
d2aj6a1118 Hypothetical protein MW0638 {Staphylococcus aureus 97.29
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 97.15
d2euia1153 Probable acetyltransferase PA4026 {Pseudomonas aer 97.11
d1p0ha_308 Mycothiol synthase MshD {Mycobacterium tuberculosi 97.08
d2ozga2283 Putative acetyltransferase Ava4977 {Anabaena varia 97.06
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 97.06
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 97.0
d1bo4a_137 Aminoglycoside 3-N-acetyltransferase {Serratia mar 96.99
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 96.99
d2hv2a2285 Hypothetical protein EF1021 {Enterococcus faecalis 96.96
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 96.88
d1sqha_297 Hypothetical protein cg14615-pa {Fruit fly (Drosop 96.87
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 96.85
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 96.84
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 96.66
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 96.59
d2i00a2291 Putative acetyltransferase EF2353 {Enterococcus fa 96.54
d1nsla_180 Probable acetyltransferase YdaF {Bacillus subtilis 96.49
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 96.29
d1s7ka1174 L7/L12-Ribosomal-protein-serine acetyltransferase 96.29
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 96.27
d2fcka1178 Putative ribosomal-protein-serine acetyltransferas 95.98
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 95.97
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 95.97
d1ro5a_197 Autoinducer synthesis protein LasI {Pseudomonas ae 95.67
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 95.55
d1p0ha_308 Mycothiol synthase MshD {Mycobacterium tuberculosi 95.36
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 95.36
d1rp3a271 Sigma factor sigma-28 (FliA) {Aquifex aeolicus [Ta 95.19
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 95.16
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 94.95
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 94.9
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 94.73
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 94.69
d1yrea1183 Hypothetical protein PA3270 {Pseudomonas aeruginos 94.66
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 94.28
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 94.26
d1yk3a1198 Hypothetical protein Rv1347c/MT1389 {Mycobacterium 94.21
d1r57a_102 Hypothetical protein SA2309 {Staphylococcus aureus 94.17
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 94.14
d1or7a168 SigmaE factor (RpoE) {Escherichia coli [TaxId: 562 93.85
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 93.04
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 92.76
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 92.6
g1qhh.1623 DEXX box DNA helicase {Bacillus stearothermophilus 92.22
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 91.4
d1s7oa_106 Hypothetical protein SPy1201 {Streptococcus pyogen 90.97
d1xsva_106 Hypothetical protein SAV1236 {Staphylococcus aureu 90.6
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 90.5
d2fsra1164 Probable acetyltranferase Atu2435 {Agrobacterium t 90.18
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 90.1
d1kzfa_210 Acyl-homoserinelactone synthase EsaI {Pantoea stew 89.35
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 89.13
d1l3la165 Quorum-sensing transcription factor TraR, C-termin 88.8
d1z63a1230 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 88.77
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 88.67
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 88.25
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 87.3
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 87.11
d1fsea_67 Germination protein GerE {Bacillus subtilis [TaxId 86.15
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 85.78
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 85.71
d1t5la1413 Nucleotide excision repair enzyme UvrB {Bacillus c 85.36
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 84.85
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 84.78
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 84.75
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 84.35
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 84.18
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 84.09
d1ku3a_61 Sigma70 (SigA, RpoD) {Thermus aquaticus [TaxId: 27 83.34
d1a04a167 Nitrate/nitrite response regulator (NarL) {Escheri 82.73
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 81.92
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 81.73
d1c4oa1408 Nucleotide excision repair enzyme UvrB {Thermus th 81.23
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 81.19
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 80.91
d1yioa170 Response regulatory protein StyR, C-terminal domai 80.16
>d1tiqa_ d.108.1.1 (A:) Protease synthase and sporulation negative regulatory protein PaiA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Acyl-CoA N-acyltransferases (Nat)
superfamily: Acyl-CoA N-acyltransferases (Nat)
family: N-acetyl transferase, NAT
domain: Protease synthase and sporulation negative regulatory protein PaiA
species: Bacillus subtilis [TaxId: 1423]

Probab=98.93  E-value=5.9e-09  Score=98.53  Aligned_cols=119  Identities=14%  Similarity=0.103  Sum_probs=83.3

Q ss_pred             hcCCCceEEEEecCCcccCCCCCCeEEEEEeeecCCCCHHHHHHHHhcCCCCCCCchhHHHHHhhccCCCCCCcccEEEE
Q 003262          341 ADAPAHHLFVLLGPVDESKNQLPDILCVIQVCLEGQISRRSVLKSFSEGHQPSGDQIPWKFSEQFRDAVFPSLSGARIVR  420 (835)
Q Consensus       341 ~DaPah~lfvL~~p~~~~~~~lp~il~viqValEG~is~~~~~~~l~~G~Rp~GdLIPw~ls~q~~d~~f~~lsgaRIVR  420 (835)
                      .+.|.+++|++..     +   .+++|.+.+......                              ..+..-..+.|.+
T Consensus        53 l~~~~~~~~v~~~-----~---~~ivG~~~~~~~~~~------------------------------~~~~~~~~~~i~~   94 (173)
T d1tiqa_          53 LSNMSSQFFFIYF-----D---HEIAGYVKVNIDDAQ------------------------------SEEMGAESLEIER   94 (173)
T ss_dssp             HHCTTEEEEEEEE-----T---TEEEEEEEEEEGGGS------------------------------SSCCCTTEEEEEE
T ss_pred             HhCCCcEEEEEEE-----C---CEecceEEEEecCcc------------------------------ccccCCCeEEEEE
Confidence            3457888887752     2   368888766643211                              1223346789999


Q ss_pred             EeeCcccccCChHHHHHHHHHHHHhcccccccccccccccCCcchhhhhHHhhhhcccccccCCCCCCcccccccccCCC
Q 003262          421 IATHPSAMRLGYGSTAVELLTRYYEGQLTTFSEIDVEDTVETPEVRVTEAAKKVSLLEENIKPKTNLPPLLVHLRERQPE  500 (835)
Q Consensus       421 IAvhPd~q~mGyGsraL~~L~~~~~g~~~~~~e~~~~~~~~~~~~~v~~~~~~~~l~~e~i~~r~~~ppLl~~l~e~~~~  500 (835)
                      |+|+|+|||+|+|+++|+.+.+++.....                                                   
T Consensus        95 i~v~~~~rgkGig~~ll~~~~~~~~~~g~---------------------------------------------------  123 (173)
T d1tiqa_          95 IYIKNSFQKHGLGKHLLNKAIEIALERNK---------------------------------------------------  123 (173)
T ss_dssp             EEECGGGCSSSHHHHHHHHHHHHHHHTTC---------------------------------------------------
T ss_pred             EEECHHHcCCCCCcchhHhhhhhhhhhhc---------------------------------------------------
Confidence            99999999999999999999998753211                                                   


Q ss_pred             CcceEEEecCCCHHHHHHHHHCCCeEEEeeecccCCCCCceEEEEccCC
Q 003262          501 KLNYIGVSFGLTLDLFRFWRKHKFAPFYVSQNANAVTGEHTCMVLKPLH  549 (835)
Q Consensus       501 ~lDylGvSFGlT~~Ll~FWkk~GF~pVylrq~~ne~TGEhS~IMlr~L~  549 (835)
                      .-=|+.|.- -+...++||+|+||.++.....+..-.+.+..||.|+|.
T Consensus       124 ~~i~l~v~~-~N~~a~~fY~k~GF~~~g~~~~~~~~~~~~~~im~k~L~  171 (173)
T d1tiqa_         124 KNIWLGVWE-KNENAIAFYKKMGFVQTGAHSFYMGDEEQTDLIMAKTLI  171 (173)
T ss_dssp             SEEEEEEET-TCHHHHHHHHHTTCEEEEEEEEEETTEEEEEEEEEEECC
T ss_pred             chhhccccc-cCHHHHHHHHHCCCEEeeEEEeecCCCCcEEEEEEeECC
Confidence            001455543 389999999999999998766544333445778999985
>d1n71a_ d.108.1.1 (A:) Aminoglycoside 6'-N-acetyltransferase {Enterococcus faecium [TaxId: 1352]} Back     information, alignment and structure
>d2atra1 d.108.1.1 (A:1-137) Probable acetyltransferase SP0256 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2jdca1 d.108.1.1 (A:2-146) Probable acetyltransferase YitI {Bacillus licheniformis [TaxId: 1402]} Back     information, alignment and structure
>d2g3aa1 d.108.1.1 (A:1-137) Probable acetyltransferase Atu2258 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1y9wa1 d.108.1.1 (A:1-140) Probable acetyltransferase BC2806 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1yx0a1 d.108.1.1 (A:1-151) Hypothetical protein YsnE {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ghea_ d.108.1.1 (A:) Tabtoxin resistance protein {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d1wwza1 d.108.1.1 (A:1-157) Hypothetical protein PH1933 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1y9ka1 d.108.1.1 (A:1-152) IAA acetyltransferase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1z4ea1 d.108.1.1 (A:4-153) Transcriptional regulator BH1968 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d2gana1 d.108.1.1 (A:1-182) Hypothetical protein PH0736 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2i6ca1 d.108.1.1 (A:1001-1160) Putative acetyltransferase PA4794 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1y7ra1 d.108.1.1 (A:1-133) Hypothetical protein SA2161 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1qsra_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Tetrahymena thermophila [TaxId: 5911]} Back     information, alignment and structure
>d1s3za_ d.108.1.1 (A:) Aminoglycoside N-acetyltransferase AAC(6')-IY {Salmonella enteritidis [TaxId: 149539]} Back     information, alignment and structure
>d2fl4a1 d.108.1.1 (A:1-146) Probable spermine/spermidine acetyltransferase EF1086 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1z4ra1 d.108.1.1 (A:497-658) Catalytic domain of GCN5 histone acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vkca_ d.108.1.1 (A:) Putative acetyltransferase PF0028 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1yr0a1 d.108.1.1 (A:4-166) Phosphinothricin acetyltransferase {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1yvoa1 d.108.1.1 (A:4-172) Hypothetical protein PA4866 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1q2ya_ d.108.1.1 (A:) Probable acetyltransferase YjcF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1vhsa_ d.108.1.1 (A:) Putative phosphinothricin acetyltransferase YwnH {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2fiwa1 d.108.1.1 (A:2-157) Probable N-acetyltransferase RPA1999 {Rhodopseudomonas palustris [TaxId: 1076]} Back     information, alignment and structure
>d1ufha_ d.108.1.1 (A:) Putative acetyltransferase YycN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2fe7a1 d.108.1.1 (A:3-158) Probable N-acetyltransferase PA0478 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1u6ma_ d.108.1.1 (A:) Putative acetyltransferase EF0945 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2fiaa1 d.108.1.1 (A:1-157) Probable acetyltransferase EF1919 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2cy2a1 d.108.1.1 (A:1-174) Probable acetyltransferase TTHA1209 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1mk4a_ d.108.1.1 (A:) Hypothetical protein YqiY {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ygha_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ae6a1 d.108.1.1 (A:1-161) Putative acetyltransferase EF0244 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1cjwa_ d.108.1.1 (A:) Serotonin N-acetyltranferase {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1i12a_ d.108.1.1 (A:) Glucosamine-phosphate N-acetyltransferase GNA1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yvka1 d.108.1.1 (A:5-156) Hypothetical protein YvbK (BSu33890) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1xeba_ d.108.1.1 (A:) Hypothetical protein PA0115 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2beia1 d.108.1.1 (A:3-169) Diamine acetyltransferase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m4ia_ d.108.1.1 (A:) Aminoglycoside 2'-N-acetyltransferase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ge3a1 d.108.1.1 (A:6-169) Probable acetyltransferase Atu2290 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2b5ga1 d.108.1.1 (A:3-169) Diamine acetyltransferase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qsma_ d.108.1.1 (A:) Histone acetyltransferase HPA2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d2aj6a1 d.108.1.1 (A:1-118) Hypothetical protein MW0638 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2euia1 d.108.1.1 (A:1-153) Probable acetyltransferase PA4026 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1p0ha_ d.108.1.1 (A:) Mycothiol synthase MshD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ozga2 d.108.1.10 (A:8-290) Putative acetyltransferase Ava4977 {Anabaena variabilis [TaxId: 1172]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1bo4a_ d.108.1.1 (A:) Aminoglycoside 3-N-acetyltransferase {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2hv2a2 d.108.1.10 (A:2-286) Hypothetical protein EF1021 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1sqha_ d.108.1.5 (A:) Hypothetical protein cg14615-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2i00a2 d.108.1.10 (A:10-300) Putative acetyltransferase EF2353 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1nsla_ d.108.1.1 (A:) Probable acetyltransferase YdaF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1s7ka1 d.108.1.1 (A:3-176) L7/L12-Ribosomal-protein-serine acetyltransferase RimL {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcka1 d.108.1.1 (A:1-178) Putative ribosomal-protein-serine acetyltransferase VC1889 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ro5a_ d.108.1.3 (A:) Autoinducer synthesis protein LasI {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1p0ha_ d.108.1.1 (A:) Mycothiol synthase MshD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rp3a2 a.4.13.2 (A:164-234) Sigma factor sigma-28 (FliA) {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1yrea1 d.108.1.1 (A:11-193) Hypothetical protein PA3270 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1yk3a1 d.108.1.1 (A:10-207) Hypothetical protein Rv1347c/MT1389 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1r57a_ d.108.1.1 (A:) Hypothetical protein SA2309 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1or7a1 a.4.13.2 (A:120-187) SigmaE factor (RpoE) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s7oa_ a.4.13.3 (A:) Hypothetical protein SPy1201 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1xsva_ a.4.13.3 (A:) Hypothetical protein SAV1236 {Staphylococcus aureus, strain Mu50 / ATCC 700699 [TaxId: 1280]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fsra1 d.108.1.1 (A:4-167) Probable acetyltranferase Atu2435 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kzfa_ d.108.1.3 (A:) Acyl-homoserinelactone synthase EsaI {Pantoea stewartii subsp. stewartii [TaxId: 66271]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1l3la1 a.4.6.2 (A:170-234) Quorum-sensing transcription factor TraR, C-terminal domain {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fsea_ a.4.6.2 (A:) Germination protein GerE {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ku3a_ a.4.13.2 (A:) Sigma70 (SigA, RpoD) {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1a04a1 a.4.6.2 (A:150-216) Nitrate/nitrite response regulator (NarL) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1c4oa1 c.37.1.19 (A:2-409) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yioa1 a.4.6.2 (A:131-200) Response regulatory protein StyR, C-terminal domain {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure