Citrus Sinensis ID: 003270


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-----
MLVRGLQFRVLVRYFAIILRGIVVVMGTPLMLLVEMTVEMIMVLQKQKIWKSGWILQMTYCIWQWRAASAHEDFWRCLNFENRKISVEQFEDVCQRYPNATEVNIYGAPAIHLLVMKAVSLLRNLEALTLGRGQLGDAFFHALADCSMLKSLNVNDATLGNGVQEIPINHDQLRRLEITKCRVMRVSIRCPQLEHLSLKRSNMAQAVLNCPLLHLLDIASCHKLSDAAIRLAATSCPQLESLDMSNCSCVSDESLREIALSCANLRILNSSYCPNISLESVRLPMLTVLQLHSCEGITSASMAAISHSYMLEVLELDNCNLLTSVSLELPRLQNIRLVHCRKFADLNLRAMMLSSIMVSNCAALHRINITSNSLQKLSLQKQENLTSLALQCQCLQEVDLTDCESLTNSVCEVFSDGGGCPMLKSLVLDNCEGLTVVRFCSTSLVSLSLVGCRAITALELKCPILEKVCLDGCDHIESASFVPVALQSLNLGICPKLSTLGIEALHMVVLELKGCGVLSDAYINCPLLTSLDASFCSQLKDDCLSATTTSCPLIESLILMSCQSIGPDGLYSLRSLQNLTMLDLSYTFLTNLEPVFESCLQLKVLKLQACKYLTNTSLESLYKKGSLPALQELDLSYGTLCQSAIEELLAYCTHLTHVSLNGCGNMHDLNWGASGCQPFESPSVYNSCGIFPHENIHESIDQPNRLLQNLNCVGCPNIRKVFIPPQARCFHLSSLNLSLSANLKEVDVACFNLCFLNLSNCCSLETLKLDCPKLTSLFLQSCNIDEEGVESAITQCGMLETLDVRFCPKICSTSMGRLRAACPSLKRIFSSLTTS
cccccccHHHHHHHHHEEEccEEEEEcccHHHHcccHHHHHHHccccccccEEEEEEEcccHHHHHHHHHccccccEEEcccccccHHHHHHHHcccccccEEEccccccccHHHHHHHHccccccEEEcccccccHHHHHHccccccccEEEcccccccccHHHHccccccccEEEEccccccccccccccccEEEcccccHHHHHcccccccEEEEcccccccHHHHHHHHHccccccEEEEEccccccHHHHHHHHHccccccEEEccccccccccccccccccEEccccccccccHHHHHccccccccEEEccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHccccccEEEccccccccHHHHHHHHcccccccccEEEEEccccccccccccccccEEEccccccccHHHHccccccEEEccccccccccccccccccEEEccccccccccccccccccEEEEcccccccccccccccccEEEccccccccHHHHHHHHcccccccEEEccccccccHHHHHHccccccccEEEcccccccccHHHHHccccccEEEEcccccccHHHHHHHHcccccccccEEEEEcccccHHHHHHHHHccccccEEEEEcccccccccccccccccccccccccccccccccHHHHHHHcccccccEEEccccccccccccccccccccccEEcccccccccccccccccccEEEccccccHHHHccccccccEEEEccccccHHHHHHHHHccccccEEEEcccccccHHHHHHHHHccccccEEEEccccc
cccHHHHHHHHHHHHHHHHHHEEEEcccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHccHHHccccccccccHHHHHHHHHHcccccEEEccccccccHHHHHHHHHcccccEEEcccccccHHHHHHHHHcccccEEEcccccccccHHHHHHHcccccEEccccccccccHcccccccEEccccHHHHHHHHHcccccEEEccccccccHHHHHHHHHHcccccEEEccccccccHHHHHHHHHHcccccEEEcccccccccHHcccHcccEEEccccccccHHHHHHHHccccccEEEccccccccHHHcccccccEEEccccccccHHHHHHHHHcccccccccccccccccEEEccccccccHHHHHHHHHHcccccEEEccccccccHHHHHHHHHccccccccEEEcccccccccHHHHHHcHcEEcccccccHHHHHHHcccccEEEccccccccHHHHHHHHHHHccccccccccHHHHHccccEEEEccccccccccccccccccEEEccccccccHHHHHHHHHHcccccEEEccccccccHHHHHHHHcccccEEEccccccHHHHHHHHHHcccccEEEccccccccHHHHHHHHHcccccccEEEEcccccccHHHHHHHHHHcccccEEEccccccccHHHHHHHHHccccHHEEEccccccccHHHHHHHHHccccccEEEccccccccHHHHHHHHHcccccEEEccccccccHHHHHHHHHHHccccccccHHHHHcccccccEEEcccccccHHHHHHHHHHcccccEEEccccccccHHHHHHHHHHcHcHHEEEEEcccc
MLVRGLQFRVLVRYFAIILRGIVVVMGTPLMLLVEMTVEMIMVLQKQKIWKSGWILQMTYCIWQWRAASAHEDFWRCLNFENRKISVEQFEDVCqrypnatevniygaPAIHLLVMKAVSLLRNLEALTLGRGQLGDAFFHALADCSmlkslnvndatlgngvqeipinhdQLRRLEITKCRVMrvsircpqlehlsLKRSNMAQAVLNCPLLHLLDIASCHKLSDAAIRLAAtscpqlesldmsncscvsdESLREIALSCANLrilnssycpnislesvrlpmlTVLQLHscegitsaSMAAISHSYMLEVLEldncnlltsvslelprlqnirlvHCRKFADLNLRAMMLSSIMVSNCAALHRINITSNSLQKLSLQKQENLTSLALQCQclqevdltdcesltnsvcevfsdgggcpmlkslvldncegltVVRFCSTSLVSLSLVGCRAITALElkcpilekvcldgcdhiesasfVPVALQslnlgicpklstLGIEALHMVVLELKgcgvlsdayincplltsldasfcsqlkddclsatttscpLIESLILMscqsigpdglysLRSLQNLTMLDLSYTFLTNLEPVFESCLQLKVLKLQACKYLtntsleslykkgslpalqeLDLSYGTLCQSAIEELLAYCTHLthvslngcgnmhdlnwgasgcqpfespsvynscgifphenihesidqpnrllqnlncvgcpnirkvfippqarcfhLSSLNLSLSANLKEVDVACFNLCFlnlsnccsletlkldcpkltslFLQSCNIDEEGVESAITqcgmletldvrfcpkicstsmgrlraaCPSLKRIFSSLTTS
MLVRGLQFRVLVRYFAIILRGIVVVMGTPLMLLVEMTVEMIMVLQKQKIWKSGWILQMTYCIWQWRAASAHEDFWRCLNFENRKISVEQFEDVCQRYPNATEVNIYGAPAIHLLVMKAVSLLRNLEALTLGRGQLGDAFFHALADCSMLKSLNVNDATLGNgvqeipinhdqlrRLEITKCRVMRVSIRCPQLEHLSLKRSNMAQAVLNCPLLHLLDIASCHKLSDAAIRLAATSCPQLESLDMSNCSCVSDESLREIALSCANLRILNSSYCPNISLESVRLPMLTVLQLHSCEGITSASMAAISHSYMLEVLELDNCNLLTSVSLELPRLQNIRLVHCRKFADLNLRAMMLSSIMVSNCAALHRINITSNSLQKLSLQKQENLTSLALQCQCLQEVDLTDCESLTNSVCEVFSDGGGCPMLKSLVLDNCEGLTVVRFCSTSLVSLSLVGCRAITALELKCPILEKVCLDGCDHIESASFVPVALQSLNLGICPKLSTLGIEALHMVVLELKGCGVLSDAYINCPLLTSLDASFCSQLKDDCLSATTTSCPLIESLILMSCQSIGPDGLYSLRSLQNLTMLDLSYTFLTNLEPVFESCLQLKVLKLQACKYLTNTSLESLYKKGSLPALQELDLSYGTLCQSAIEELLAYCTHLTHVSLNGCGNMHDLNWGASGCQPFESPSVYNSCGIFPHENIHESIDQPNRLLQNLNCVGCPNIRKVFIPPQARCFHLSSLNLSLSANLKEVDVACFNLCFLNLSNCCSLETLKLDCPKLTSLFLQSCNIDEEGVESAITQCGMLETLDVRFCPKICStsmgrlraacpslkrifssltts
MLVRGLQFRVLVRYFAIILRGIVVVMGTPLMLLVEMTVEMIMVLQKQKIWKSGWILQMTYCIWQWRAASAHEDFWRCLNFENRKISVEQFEDVCQRYPNATEVNIYGAPAIHLLVMKAVSLLRNLEALTLGRGQLGDAFFHALADCSMLKSLNVNDATLGNGVQEIPINHDQLRRLEITKCRVMRVSIRCPQLEHLSLKRSNMAQAVLNCPLLHLLDIASCHKLSDAAIRLAATSCPQLESLDMSNCSCVSDESLREIALSCANLRILNSSYCPNISLESVRLPMLTVLQLHSCEGITSASMAAISHSYMLEVLELDNCNLLTSVSLELPRLQNIRLVHCRKFADLNLRAMMLSSIMVSNCAALHRINITSNSLQKLSLQKQENLTSLALQCQCLQEVDLTDCESLTNSVCEVFSDGGGCPMLKSLVLDNCEGLTVVRFCSTSLVSLSLVGCRAITALELKCPILEKVCLDGCDHIESASFVPVALQSLNLGICPKLSTLGIEALHMVVLELKGCGVLSDAYINCPLLTSLDASFCSQLKDDCLSATTTSCPLIESLILMSCQSIGPDGLYSLRSLQNLTMLDLSYTFLTNLEPVFESCLQLKVLKLQACKYLTNTSLESLYKKGSLPALQELDLSYGTLCQSAIEELLAYCTHLTHVSLNGCGNMHDLNWGASGCQPFESPSVYNSCGIFPHENIHESIDQPNRLLQNLNCVGCPNIRKVFIPPQARCFHlsslnlslsanlKEVDVAcfnlcflnlsnccslETLKLDCPKLTSLFLQSCNIDEEGVESAITQCGMLETLDVRFCPKICSTSMGRLRAACPSLKRIFSSLTTS
**VRGLQFRVLVRYFAIILRGIVVVMGTPLMLLVEMTVEMIMVLQKQKIWKSGWILQMTYCIWQWRAASAHEDFWRCLNFENRKISVEQFEDVCQRYPNATEVNIYGAPAIHLLVMKAVSLLRNLEALTLGRGQLGDAFFHALADCSMLKSLNVNDATLGNGVQEIPINHDQLRRLEITKCRVMRVSIRCPQLEHLSLKRSNMAQAVLNCPLLHLLDIASCHKLSDAAIRLAATSCPQLESLDMSNCSCVSDESLREIALSCANLRILNSSYCPNISLESVRLPMLTVLQLHSCEGITSASMAAISHSYMLEVLELDNCNLLTSVSLELPRLQNIRLVHCRKFADLNLRAMMLSSIMVSNCAALHRINITSNSLQKLSLQKQENLTSLALQCQCLQEVDLTDCESLTNSVCEVFSDGGGCPMLKSLVLDNCEGLTVVRFCSTSLVSLSLVGCRAITALELKCPILEKVCLDGCDHIESASFVPVALQSLNLGICPKLSTLGIEALHMVVLELKGCGVLSDAYINCPLLTSLDASFCSQLKDDCLSATTTSCPLIESLILMSCQSIGPDGLYSLRSLQNLTMLDLSYTFLTNLEPVFESCLQLKVLKLQACKYLTNTSLESLYKKGSLPALQELDLSYGTLCQSAIEELLAYCTHLTHVSLNGCGNMHDLNWGASGCQPFESPSVYNSCGIFPHENIHESIDQPNRLLQNLNCVGCPNIRKVFIPPQARCFHLSSLNLSLSANLKEVDVACFNLCFLNLSNCCSLETLKLDCPKLTSLFLQSCNIDEEGVESAITQCGMLETLDVRFCPKICSTSMGRLRAACPSLKRIF******
**VRGLQFRVLVRYFAIILRGIVVVMGTPLMLLVEMTVEMIMVLQKQKIWKSGWILQMTYCIWQWRAASAHEDFWRCLNFENRKISVEQFEDVCQRYPNATEVNIYGAPAIHLLVMKAVSLLRNLEALTLGRGQLGDAFFHALADCSMLKSLNVNDATLGNGVQEIPINHDQLRRLEITKCRVMRVSIRCPQLEHLSLKRSNMAQAVLNCPLLHLLDIASCHKLSDAAIRLAATSCPQLESLDMSNCSCVSDESLREIALSCANLRILNSSYCPNISLESVRLPMLTVLQLHSCEGITSASMAAISHSYMLEVLELDNCNLLTSVSLELPRLQNIRLVHCRKFADLNLRAMMLSSIMVSNCAALHRINITSNSLQKLSLQKQENLTSLALQCQCLQEVDLTDCESLTNSVCEVFSDGGGCPMLKSLVLDNCEGLTVVRFCSTSLVSLSLVGCRAITALELKCPILEKVCLDGCDHIESASFVPVALQSLNLGICPKLSTLGIEALHMVVLELKGCGVLSDAYINCPLLTSLDASFCSQLKDDCLSATTTSCPLIESLILMSCQSIGPDGLYSLRSLQNLTMLDLSYTFLTNLEPVFESCLQLKVLKLQACKYLTNTSLESLYKKGSLPALQELDLSYGTLCQSAIEELLAYCTHLTHVSLNGCGNMHDLNWGASGCQPFESPSVYNSCGIFPHENIHESIDQPNRLLQNLNCVGCPNIRKVFIPPQARCFHLSSLNLSLSANLKEVDVACFNLCFLNLSNCCSLETLKLDCPKLTSLFLQSCNIDEEGVESAITQCGMLETLDVRFCPKICSTSMGRLRAACPSLKRIFSSLT**
MLVRGLQFRVLVRYFAIILRGIVVVMGTPLMLLVEMTVEMIMVLQKQKIWKSGWILQMTYCIWQWRAASAHEDFWRCLNFENRKISVEQFEDVCQRYPNATEVNIYGAPAIHLLVMKAVSLLRNLEALTLGRGQLGDAFFHALADCSMLKSLNVNDATLGNGVQEIPINHDQLRRLEITKCRVMRVSIRCPQLEHLSLKRSNMAQAVLNCPLLHLLDIASCHKLSDAAIRLAATSCPQLESLDMSNCSCVSDESLREIALSCANLRILNSSYCPNISLESVRLPMLTVLQLHSCEGITSASMAAISHSYMLEVLELDNCNLLTSVSLELPRLQNIRLVHCRKFADLNLRAMMLSSIMVSNCAALHRINITSNSLQKLSLQKQENLTSLALQCQCLQEVDLTDCESLTNSVCEVFSDGGGCPMLKSLVLDNCEGLTVVRFCSTSLVSLSLVGCRAITALELKCPILEKVCLDGCDHIESASFVPVALQSLNLGICPKLSTLGIEALHMVVLELKGCGVLSDAYINCPLLTSLDASFCSQLKDDCLSATTTSCPLIESLILMSCQSIGPDGLYSLRSLQNLTMLDLSYTFLTNLEPVFESCLQLKVLKLQACKYLTNTSLESLYKKGSLPALQELDLSYGTLCQSAIEELLAYCTHLTHVSLNGCGNMHDLNWGASGCQPFESPSVYNSCGIFPHENIHESIDQPNRLLQNLNCVGCPNIRKVFIPPQARCFHLSSLNLSLSANLKEVDVACFNLCFLNLSNCCSLETLKLDCPKLTSLFLQSCNIDEEGVESAITQCGMLETLDVRFCPKICSTSMGRLRAACPSLKRIFSSLTTS
*LVRGLQFRVLVRYFAIILRGIVVVMGTPLMLLVEMTVEMIMVLQKQKIWKSGWILQMTYCIWQWRAASAHEDFWRCLNFENRKISVEQFEDVCQRYPNATEVNIYGAPAIHLLVMKAVSLLRNLEALTLGRGQLGDAFFHALADCSMLKSLNVNDATLGNGVQEIPINHDQLRRLEITKCRVMRVSIRCPQLEHLSLKRSNMAQAVLNCPLLHLLDIASCHKLSDAAIRLAATSCPQLESLDMSNCSCVSDESLREIALSCANLRILNSSYCPNISLESVRLPMLTVLQLHSCEGITSASMAAISHSYMLEVLELDNCNLLTSVSLELPRLQNIRLVHCRKFADLNLRAMMLSSIMVSNCAALHRINITSNSLQKLSLQKQENLTSLALQCQCLQEVDLTDCESLTNSVCEVFSDGGGCPMLKSLVLDNCEGLTVVRFCSTSLVSLSLVGCRAITALELKCPILEKVCLDGCDHIESASFVPVALQSLNLGICPKLSTLGIEALHMVVLELKGCGVLSDAYINCPLLTSLDASFCSQLKDDCLSATTTSCPLIESLILMSCQSIGPDGLYSLRSLQNLTMLDLSYTFLTNLEPVFESCLQLKVLKLQACKYLTNTSLESLYKKGSLPALQELDLSYGTLCQSAIEELLAYCTHLTHVSLNGCGNMHDLNWGASGCQPFESPSVYNSCGIFPHENIHESIDQPNRLLQNLNCVGCPNIRKVFIPPQARCFHLSSLNLSLSANLKEVDVACFNLCFLNLSNCCSLETLKLDCPKLTSLFLQSCNIDEEGVESAITQCGMLETLDVRFCPKICSTSMGRLRAACPSLKRIFSSLTT*
iiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLVRGLQFRVLVRYFAIILRGIVVVMGTPLMLLVEMTVEMIMVLQKQKIWKSGWILQMTYCIWQWRAASAHEDFWRCLNFENRKISVEQFEDVCQRYPNATEVNIYGAPAIHLLVMKAVSLLRNLEALTLGRGQLGDAFFHALADCSMLKSLNVNDATLGNGVQEIPINHDQLRRLEITKCRVMRVSIRCPQLEHLSLKRSNMAQAVLNCPLLHLLDIASCHKLSDAAIRLAATSCPQLESLDMSNCSCVSDESLREIALSCANLRILNSSYCPNISLESVRLPMLTVLQLHSCEGITSASMAAISHSYMLEVLELDNCNLLTSVSLELPRLQNIRLVHCRKFADLNLRAMMLSSIMVSNCAALHRINITSNSLQKLSLQKQENLTSLALQCQCLQEVDLTDCESLTNSVCEVFSDGGGCPMLKSLVLDNCEGLTVVRFCSTSLVSLSLVGCRAITALELKCPILEKVCLDGCDHIESASFVPVALQSLNLGICPKLSTLGIEALHMVVLELKGCGVLSDAYINCPLLTSLDASFCSQLKDDCLSATTTSCPLIESLILMSCQSIGPDGLYSLRSLQNLTMLDLSYTFLTNLEPVFESCLQLKVLKLQACKYLTNTSLESLYKKGSLPALQELDLSYGTLCQSAIEELLAYCTHLTHVSLNGCGNMHDLNWGASGCQPFESPSVYNSCGIFPHENIHESIDQPNRLLQNLNCVGCPNIRKVFIPPQARCFHLSSLNLSLSANLKEVDVACFNLCFLNLSNCCSLETLKLDCPKLTSLFLQSCNIDEEGVESAITQCGMLETLDVRFCPKICSTSMGRLRAACPSLKRIFSSLTTS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query835 2.2.26 [Sep-21-2011]
Q9SMY8990 F-box/LRR-repeat protein yes no 0.913 0.770 0.744 0.0
Q9C5D2610 F-box/LRR-repeat protein no no 0.462 0.632 0.251 9e-19
A6H779423 F-box/LRR-repeat protein yes no 0.308 0.609 0.270 3e-13
Q96IG2436 F-box/LRR-repeat protein yes no 0.308 0.591 0.249 4e-13
Q58DG6436 F-box/LRR-repeat protein no no 0.308 0.591 0.249 4e-13
P34284466 Uncharacterized F-box/LRR yes no 0.322 0.577 0.251 6e-13
Q8NEE6735 F-box/LRR-repeat protein no no 0.440 0.500 0.237 8e-13
Q8BH16423 F-box/LRR-repeat protein no no 0.299 0.591 0.280 1e-12
Q9CZV8436 F-box/LRR-repeat protein no no 0.301 0.577 0.257 1e-12
Q9SKK0628 EIN3-binding F-box protei no no 0.468 0.622 0.246 2e-12
>sp|Q9SMY8|FBL15_ARATH F-box/LRR-repeat protein 15 OS=Arabidopsis thaliana GN=FBL15 PE=1 SV=2 Back     alignment and function desciption
 Score = 1162 bits (3005), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 572/768 (74%), Positives = 662/768 (86%), Gaps = 5/768 (0%)

Query: 64  QWRAASAHEDFWRCLNFENRKISVEQFEDVCQRYPNATEVNIYGAPAIHLLVMKAVSLLR 123
           QWR ASAHEDFWR LNFEN +IS+EQFE++C RYPNATEVN+YGAPA++ L MKA + LR
Sbjct: 222 QWRVASAHEDFWRVLNFENIRISMEQFENMCSRYPNATEVNVYGAPAVNALAMKAATTLR 281

Query: 124 NLEALTLGRGQLGDAFFHALADCSMLKSLNVNDATLGNGVQEIPINHDQLRRLEITKCRV 183
           NLE LT+G+G + ++FF AL +C+ML+S+ V+DA LGNG QEI ++HD+LR L+ITKCRV
Sbjct: 282 NLEVLTIGKGHISESFFQALGECNMLRSVTVSDAILGNGAQEIHLSHDRLRELKITKCRV 341

Query: 184 MRVSIRCPQLEHLSLKRSNMAQAVLNCPLLHLLDIASCHKLSDAAIRLAATSCPQLESLD 243
           MR+SIRCPQL  LSLKRSNM+QA+LNCPLL LLDIASCHKL DAAIR AA SCPQLESLD
Sbjct: 342 MRLSIRCPQLRSLSLKRSNMSQAMLNCPLLQLLDIASCHKLLDAAIRSAAISCPQLESLD 401

Query: 244 MSNCSCVSDESLREIALSCANLRILNSSYCPNISLESVRLPMLTVLQLHSCEGITSASMA 303
           +SNCSCVSDE+LREIA +CANL ILN+SYCPNISLESV LPMLTVL+LHSCEGITSASM 
Sbjct: 402 VSNCSCVSDETLREIAQACANLHILNASYCPNISLESVHLPMLTVLKLHSCEGITSASMT 461

Query: 304 AISHSYMLEVLELDNCNLLTSVSLELPRLQNIRLVHCRKFADLNLRAMMLSSIMVSNCAA 363
            I++S  LEVLELDNCNLLT+VSL L RLQ+I LVHCRKF DLNL+++MLSSI VSNC A
Sbjct: 462 WIANSPALEVLELDNCNLLTTVSLHLSRLQSISLVHCRKFTDLNLQSIMLSSITVSNCPA 521

Query: 364 LHRINITSNSLQKLSLQKQENLTSLALQCQCLQEVDLTDCESLTNSVCEVFSDGGGCPML 423
           L RI ITSN+L++L+LQKQENLT+L LQC  LQEVDL+DCESL+NSVC++FSD GGCPML
Sbjct: 522 LRRITITSNALRRLALQKQENLTTLVLQCHSLQEVDLSDCESLSNSVCKIFSDDGGCPML 581

Query: 424 KSLVLDNCEGLTVVRFCSTSLVSLSLVGCRAITALELKCPILEKVCLDGCDHIESASFVP 483
           KSL+LDNCE LT VRFC++SL SLSLVGCRA+T+LELKCP +E++CLDGCDH+E+A F P
Sbjct: 582 KSLILDNCESLTAVRFCNSSLASLSLVGCRAVTSLELKCPRIEQICLDGCDHLETAFFQP 641

Query: 484 VALQSLNLGICPKLSTLGIEALHMVVLELKGCGVLSDAYINCPLLTSLDASFCSQLKDDC 543
           VAL+SLNLGICPKLS L IEA +MV LELKGCGVLS+A I CPLLTSLDASFCSQL+DDC
Sbjct: 642 VALRSLNLGICPKLSVLNIEAPYMVSLELKGCGVLSEASIMCPLLTSLDASFCSQLRDDC 701

Query: 544 LSATTTSCPLIESLILMSCQSIGPDGLYSLRSLQNLTMLDLSYTFLTNLEPVFESCLQLK 603
           LSATT SCPLIESL+LMSC SIG DGL SL  L NLT+LDLSYTFL NLEPVF+SC+QLK
Sbjct: 702 LSATTASCPLIESLVLMSCPSIGSDGLSSLNGLPNLTVLDLSYTFLMNLEPVFKSCIQLK 761

Query: 604 VLKLQACKYLTNTSLESLYKKGSLPALQELDLSYGTLCQSAIEELLAYCTHLTHVSLNGC 663
           VLKLQACKYLT++SLE LYK+G+LPAL+ELDLSYGTLCQ+AI++LLA CTHLTH+SLNGC
Sbjct: 762 VLKLQACKYLTDSSLEPLYKEGALPALEELDLSYGTLCQTAIDDLLACCTHLTHLSLNGC 821

Query: 664 GNMHDLNWGASGCQPFESPSVYNSCGIFPHENIHESIDQPNRLLQNLNCVGCPNIRKVFI 723
            NMHDL+WG++    F+   VY+S      +N  E  +  NRLLQNLNCVGCPNIRKV I
Sbjct: 822 VNMHDLDWGSTSVHLFDYFGVYSS-----SDNTQEPAETANRLLQNLNCVGCPNIRKVLI 876

Query: 724 PPQARCFHLSSLNLSLSANLKEVDVACFNLCFLNLSNCCSLETLKLDCPKLTSLFLQSCN 783
           PP AR +HLS+LNLSLS NLKEVD+ C NL  LNLSNCCSLE LKL CP+L SLFLQSCN
Sbjct: 877 PPAARFYHLSTLNLSLSVNLKEVDLTCSNLVLLNLSNCCSLEVLKLGCPRLASLFLQSCN 936

Query: 784 IDEEGVESAITQCGMLETLDVRFCPKICSTSMGRLRAACPSLKRIFSS 831
           +DE GVE+AI+ C  LETLD+RFCPKI S SM + R  CPSLKR+FSS
Sbjct: 937 MDEAGVEAAISGCSSLETLDLRFCPKISSVSMSKFRTVCPSLKRVFSS 984





Arabidopsis thaliana (taxid: 3702)
>sp|Q9C5D2|FBL4_ARATH F-box/LRR-repeat protein 4 OS=Arabidopsis thaliana GN=FBL4 PE=2 SV=1 Back     alignment and function description
>sp|A6H779|FBXL2_BOVIN F-box/LRR-repeat protein 2 OS=Bos taurus GN=FBXL2 PE=2 SV=1 Back     alignment and function description
>sp|Q96IG2|FXL20_HUMAN F-box/LRR-repeat protein 20 OS=Homo sapiens GN=FBXL20 PE=1 SV=2 Back     alignment and function description
>sp|Q58DG6|FXL20_BOVIN F-box/LRR-repeat protein 20 OS=Bos taurus GN=FBXL20 PE=2 SV=2 Back     alignment and function description
>sp|P34284|YKK7_CAEEL Uncharacterized F-box/LRR-repeat protein C02F5.7 OS=Caenorhabditis elegans GN=C02F5.7 PE=4 SV=3 Back     alignment and function description
>sp|Q8NEE6|FXL13_HUMAN F-box/LRR-repeat protein 13 OS=Homo sapiens GN=FBXL13 PE=2 SV=3 Back     alignment and function description
>sp|Q8BH16|FBXL2_MOUSE F-box/LRR-repeat protein 2 OS=Mus musculus GN=Fbxl2 PE=1 SV=1 Back     alignment and function description
>sp|Q9CZV8|FXL20_MOUSE F-box/LRR-repeat protein 20 OS=Mus musculus GN=Fbxl20 PE=1 SV=3 Back     alignment and function description
>sp|Q9SKK0|EBF1_ARATH EIN3-binding F-box protein 1 OS=Arabidopsis thaliana GN=EBF1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query835
343887327 1068 F-box / LRR-repeat protein [Citrus unshi 0.852 0.666 0.930 0.0
255550167 997 conserved hypothetical protein [Ricinus 0.924 0.774 0.848 0.0
224141687 957 predicted protein [Populus trichocarpa] 0.920 0.803 0.829 0.0
356552386 975 PREDICTED: F-box/LRR-repeat protein 15-l 0.922 0.789 0.799 0.0
356564031 982 PREDICTED: F-box/LRR-repeat protein 15-l 0.917 0.780 0.788 0.0
296081717 957 unnamed protein product [Vitis vinifera] 0.920 0.803 0.803 0.0
356514729893 PREDICTED: F-box/LRR-repeat protein 15-l 0.918 0.858 0.773 0.0
297798620 990 predicted protein [Arabidopsis lyrata su 0.913 0.770 0.747 0.0
334187119 990 F-box/LRR-repeat protein 15 [Arabidopsis 0.913 0.770 0.744 0.0
357437317 1026 F-box/LRR-repeat protein [Medicago trunc 0.923 0.751 0.727 0.0
>gi|343887327|dbj|BAK61873.1| F-box / LRR-repeat protein [Citrus unshiu] Back     alignment and taxonomy information
 Score = 1375 bits (3560), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 711/764 (93%), Positives = 712/764 (93%), Gaps = 52/764 (6%)

Query: 91   EDVCQRYPNATEVNIYGAPAIHLLVMKAVSLLRNLEALTLGRGQLGDAFFHALADCSMLK 150
            EDVCQRYPNATEVNIYGAPAIHLLVMKAVSLLRNLEALTLGRGQLGDAFFHALADCSMLK
Sbjct: 338  EDVCQRYPNATEVNIYGAPAIHLLVMKAVSLLRNLEALTLGRGQLGDAFFHALADCSMLK 397

Query: 151  SLNVNDATLGNGVQEIPINHDQLRRLEITKCRVMRVSIRCPQLEHLSLKRSNMAQAVLNC 210
            SLNVNDATLGNGVQEIPINHDQLRRLEITKCRVMRVSIRCPQLEHLSLKRSNMAQAVLNC
Sbjct: 398  SLNVNDATLGNGVQEIPINHDQLRRLEITKCRVMRVSIRCPQLEHLSLKRSNMAQAVLNC 457

Query: 211  PLLHLLDIASCHKLSDAAIRLAATSCPQLESLDMSNCSCVSDESLREIALSCANLRILNS 270
            PLLHLLDIASCHKLSDAAIRLAATSCPQLESLDMSNCSCVSDESLREIALSCANLRILNS
Sbjct: 458  PLLHLLDIASCHKLSDAAIRLAATSCPQLESLDMSNCSCVSDESLREIALSCANLRILNS 517

Query: 271  SYCPNISLESVRLPMLTVLQLHSCEGITSASMAAISHSYMLEVLELDNCNLLTSVSLELP 330
            SYCPNISLE                                 VLELDNCNLLTSVSLELP
Sbjct: 518  SYCPNISLE---------------------------------VLELDNCNLLTSVSLELP 544

Query: 331  RLQNIRLVHCRKFADLNLRAMMLSSIMVSNCAALHRINITSNSLQKLSLQKQENLTSLAL 390
            RLQNIRLVHCRKFADLNLRAMMLSSIMVSNCAALHRINITSNSLQKLSLQKQENLTSLAL
Sbjct: 545  RLQNIRLVHCRKFADLNLRAMMLSSIMVSNCAALHRINITSNSLQKLSLQKQENLTSLAL 604

Query: 391  QCQCLQEVDLTDCESLTNSVCEVFSDGGGCPMLKSLVLDNCE------------------ 432
            QCQCLQEVDLTDCESLTNSVCEVFSDGGGCPMLKSLVLDNCE                  
Sbjct: 605  QCQCLQEVDLTDCESLTNSVCEVFSDGGGCPMLKSLVLDNCECEEPCSYDGKHCYIKNEK 664

Query: 433  -GLTVVRFCSTSLVSLSLVGCRAITALELKCPILEKVCLDGCDHIESASFVPVALQSLNL 491
             GLTVVRFCSTSLVSLSLVGCRAITALELKCPILEKVCLDGCDHIESASFVPVALQSLNL
Sbjct: 665  GGLTVVRFCSTSLVSLSLVGCRAITALELKCPILEKVCLDGCDHIESASFVPVALQSLNL 724

Query: 492  GICPKLSTLGIEALHMVVLELKGCGVLSDAYINCPLLTSLDASFCSQLKDDCLSATTTSC 551
            GICPKLSTLGIEALHMVVLELKGCGVLSDAYINCPLLTSLDASFCSQLKDDCLSATTTSC
Sbjct: 725  GICPKLSTLGIEALHMVVLELKGCGVLSDAYINCPLLTSLDASFCSQLKDDCLSATTTSC 784

Query: 552  PLIESLILMSCQSIGPDGLYSLRSLQNLTMLDLSYTFLTNLEPVFESCLQLKVLKLQACK 611
            PLIESLILMSCQSIGPDGLYSLRSLQNLTMLDLSYTFLTNLEPVFESCLQLKVLKLQACK
Sbjct: 785  PLIESLILMSCQSIGPDGLYSLRSLQNLTMLDLSYTFLTNLEPVFESCLQLKVLKLQACK 844

Query: 612  YLTNTSLESLYKKGSLPALQELDLSYGTLCQSAIEELLAYCTHLTHVSLNGCGNMHDLNW 671
            YLTNTSLESLYKKGSLPALQELDLSYGTLCQSAIEELLAYCTHLTHVSLNGCGNMHDLNW
Sbjct: 845  YLTNTSLESLYKKGSLPALQELDLSYGTLCQSAIEELLAYCTHLTHVSLNGCGNMHDLNW 904

Query: 672  GASGCQPFESPSVYNSCGIFPHENIHESIDQPNRLLQNLNCVGCPNIRKVFIPPQARCFH 731
            G+SGCQPFESPSVYNSCGIFPHENIHESIDQPNRLLQNLNCVGCPNIRKVFIPPQARCFH
Sbjct: 905  GSSGCQPFESPSVYNSCGIFPHENIHESIDQPNRLLQNLNCVGCPNIRKVFIPPQARCFH 964

Query: 732  LSSLNLSLSANLKEVDVACFNLCFLNLSNCCSLETLKLDCPKLTSLFLQSCNIDEEGVES 791
            LSSLNLSLSANLKEVDVACFNLCFLNLSNCCSLETLKLDCPKLTSLFLQSCNIDEEGVES
Sbjct: 965  LSSLNLSLSANLKEVDVACFNLCFLNLSNCCSLETLKLDCPKLTSLFLQSCNIDEEGVES 1024

Query: 792  AITQCGMLETLDVRFCPKICSTSMGRLRAACPSLKRIFSSLTTS 835
            AITQCGMLETLDVRFCPKICSTSMGRLRAACPSLKRIFSSLTTS
Sbjct: 1025 AITQCGMLETLDVRFCPKICSTSMGRLRAACPSLKRIFSSLTTS 1068




Source: Citrus unshiu

Species: Citrus unshiu

Genus: Citrus

Family: Rutaceae

Order: Sapindales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255550167|ref|XP_002516134.1| conserved hypothetical protein [Ricinus communis] gi|223544620|gb|EEF46136.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|224141687|ref|XP_002324196.1| predicted protein [Populus trichocarpa] gi|222865630|gb|EEF02761.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356552386|ref|XP_003544549.1| PREDICTED: F-box/LRR-repeat protein 15-like [Glycine max] Back     alignment and taxonomy information
>gi|356564031|ref|XP_003550260.1| PREDICTED: F-box/LRR-repeat protein 15-like [Glycine max] Back     alignment and taxonomy information
>gi|296081717|emb|CBI20722.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356514729|ref|XP_003526056.1| PREDICTED: F-box/LRR-repeat protein 15-like [Glycine max] Back     alignment and taxonomy information
>gi|297798620|ref|XP_002867194.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297313030|gb|EFH43453.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|334187119|ref|NP_567916.2| F-box/LRR-repeat protein 15 [Arabidopsis thaliana] gi|124007179|sp|Q9SMY8.2|FBL15_ARATH RecName: Full=F-box/LRR-repeat protein 15 gi|332660791|gb|AEE86191.1| F-box/LRR-repeat protein 15 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|357437317|ref|XP_003588934.1| F-box/LRR-repeat protein [Medicago truncatula] gi|355477982|gb|AES59185.1| F-box/LRR-repeat protein [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query835
TAIR|locus:505006471610 AT4G15475 "AT4G15475" [Arabido 0.520 0.713 0.253 9.3e-19
TAIR|locus:2149805665 AT5G01720 "AT5G01720" [Arabido 0.558 0.700 0.235 6.6e-18
DICTYBASE|DDB_G0287415 1012 DDB_G0287415 "SCF E3 ubiquitin 0.537 0.443 0.218 9.7e-18
RGD|1562243422 Fbxl2 "F-box and leucine-rich 0.368 0.729 0.265 5e-17
MGI|MGI:1919429423 Fbxl2 "F-box and leucine-rich 0.368 0.728 0.265 5e-17
UNIPROTKB|F1PWK1422 FBXL2 "Uncharacterized protein 0.411 0.815 0.258 1.1e-16
TAIR|locus:2145512623 EBF2 "EIN3-binding F box prote 0.621 0.833 0.229 1.2e-16
UNIPROTKB|F1NHD2423 FBXL2 "Uncharacterized protein 0.402 0.794 0.258 2.4e-16
UNIPROTKB|A6H779423 FBXL2 "F-box/LRR-repeat protei 0.4 0.789 0.262 2.4e-16
UNIPROTKB|Q9UKC9423 FBXL2 "F-box/LRR-repeat protei 0.411 0.813 0.258 2.4e-16
TAIR|locus:505006471 AT4G15475 "AT4G15475" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 259 (96.2 bits), Expect = 9.3e-19, P = 9.3e-19
 Identities = 125/494 (25%), Positives = 215/494 (43%)

Query:   193 LEHLSLKRSNMAQAVLNCPLLHLLDIASCHKLSDAAIRLAATSCPQLESLDMSNCSCVSD 252
             +E  SL  + +       P +  L +  C  +S   +   A  C  L+SLD+  C  V D
Sbjct:   122 VESSSLTDTGLTALANGFPRIENLSLIWCPNVSSVGLCSLAQKCTSLKSLDLQGCY-VGD 180

Query:   253 ESLREIALSCANLRILNSSYCPNIS-LESVRLPM-----LTVLQLHSCEGITSASMAAI- 305
             + L  +   C  L  LN  +C  ++ +  + L +     L  + + +   IT  S+ A+ 
Sbjct:   181 QGLAAVGKFCKQLEELNLRFCEGLTDVGVIDLVVGCSKSLKSIGVAASAKITDLSLEAVG 240

Query:   306 SHSYMLEVLELDNCNL----LTSVSLELPRLQNIRLVHCRKFADLNLRAMMLSSIMVSNC 361
             SH  +LEVL LD+  +    L +V+    RL+N++L  C    D+   A+    +    C
Sbjct:   241 SHCKLLEVLYLDSEYIHDKGLIAVAQGCHRLKNLKL-QCVSVTDVAFAAV--GEL----C 293

Query:   362 AALHRINITSNSLQKLSLQKQENLTSLALQCQCLQEVDLTDCESLTNSVCEVFSDGGGCP 421
              +L R+ + S   Q  +    + + ++    + L+++ L+DC  ++    E  + G  C 
Sbjct:   294 TSLERLALYS--FQHFT---DKGMRAIGKGSKKLKDLTLSDCYFVSCKGLEAIAHG--CK 346

Query:   422 MLKSLVLDNCE-----GLTVVRFCSTSLVSLSLVGCRAI--TALE---LKCPILEKVCLD 471
              L+ + ++ C      G+  +      L  L+L+ C+ I  +AL+     C  LE + L 
Sbjct:   347 ELERVEINGCHNIGTRGIEAIGKSCPRLKELALLYCQRIGNSALQEIGKGCKSLEILHLV 406

Query:   472 GCDHIESASFVPVALQSLNLGICPKLSTLGIEALHMVVLELKGCGVLSDAYINCPLLTSL 531
              C  I       +A+ S+  G C  L  L I   +    E+   G++S    +C  LT L
Sbjct:   407 DCSGIGD-----IAMCSIAKG-CRNLKKLHIRRCY----EIGNKGIISIGK-HCKSLTEL 455

Query:   532 DASFCSQLKDDCLSATTTSCPLIESLILMSCQSIGPDGLYSL-RSLQNLTMLDLSYTFLT 590
                FC ++ +  L A    C L + L +  C  I   G+ ++ R    LT LD+S   L 
Sbjct:   456 SLRFCDKVGNKALIAIGKGCSL-QQLNVSGCNQISDAGITAIARGCPQLTHLDISV--LQ 512

Query:   591 N-----LEPVFESCLQLKVLKLQACKYLTNTSLESLYKKGSLPALQELDLSYGTLCQSA- 644
             N     L  + E C  LK L L  C ++T+  L  L +K  L  L+   + Y     SA 
Sbjct:   513 NIGDMPLAELGEGCPMLKDLVLSHCHHITDNGLNHLVQKCKL--LETCHMVYCPGITSAG 570

Query:   645 IEELLAYCTHLTHV 658
             +  +++ C H+  V
Sbjct:   571 VATVVSSCPHIKKV 584


GO:0004842 "ubiquitin-protein ligase activity" evidence=ISS
GO:0005634 "nucleus" evidence=ISM
GO:0006511 "ubiquitin-dependent protein catabolic process" evidence=TAS
GO:0006486 "protein glycosylation" evidence=RCA
TAIR|locus:2149805 AT5G01720 "AT5G01720" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0287415 DDB_G0287415 "SCF E3 ubiquitin ligase complex F-box protein GRR1" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
RGD|1562243 Fbxl2 "F-box and leucine-rich repeat protein 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1919429 Fbxl2 "F-box and leucine-rich repeat protein 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1PWK1 FBXL2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
TAIR|locus:2145512 EBF2 "EIN3-binding F box protein 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|F1NHD2 FBXL2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|A6H779 FBXL2 "F-box/LRR-repeat protein 2" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q9UKC9 FBXL2 "F-box/LRR-repeat protein 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9SMY8FBL15_ARATHNo assigned EC number0.74470.91370.7707yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00032274001
SubName- Full=Chromosome chr4 scaffold_6, whole genome shotgun sequence; (888 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query835
cd09293226 cd09293, AMN1, Antagonist of mitotic exit network 3e-15
cd09293226 cd09293, AMN1, Antagonist of mitotic exit network 1e-08
cd09293226 cd09293, AMN1, Antagonist of mitotic exit network 1e-06
cd09293226 cd09293, AMN1, Antagonist of mitotic exit network 5e-06
cd09293226 cd09293, AMN1, Antagonist of mitotic exit network 9e-06
smart0036726 smart00367, LRR_CC, Leucine-rich repeat - CC (cyst 0.003
PLN032101153 PLN03210, PLN03210, Resistant to P 0.003
>gnl|CDD|187754 cd09293, AMN1, Antagonist of mitotic exit network protein 1 Back     alignment and domain information
 Score = 75.4 bits (186), Expect = 3e-15
 Identities = 51/184 (27%), Positives = 84/184 (45%), Gaps = 21/184 (11%)

Query: 164 QEIPINHDQLRRLEITKCRV----MRVSIRCPQLEHLSLKRSN------MAQAVLNCPLL 213
           Q + I H  L  LE+  C +    +     C +L+ L L  S       +     +CP L
Sbjct: 21  QLLRILHSGLEWLELYMCPISDPPLDQLSNCNKLKKLILPGSKLIDDEGLIALAQSCPNL 80

Query: 214 HLLDIASCHKLSDAAIRLAATSCPQLESLDMS---NCSCVSDESLREIALSCANLRILNS 270
            +LD+ +C  ++D+ I   AT+CP+L+++++    N   ++D SL  +  +C  L+ +  
Sbjct: 81  QVLDLRACENITDSGIVALATNCPKLQTINLGRHRNGHLITDVSLSALGKNCTFLQTVGF 140

Query: 271 SYCP-----NISLESVRLPMLTVLQLHSCEGITSASMAAISHSYM---LEVLELDNCNLL 322
           + C         L S     L  L L++C  +T  S+ AI  S     L VLE   C L+
Sbjct: 141 AGCDVTDKGVWELASGCSKSLERLSLNNCRNLTDQSIPAILASNYFPNLSVLEFRGCPLI 200

Query: 323 TSVS 326
           T  S
Sbjct: 201 TDFS 204


Amn1 has been functionally characterized in Saccharomyces cerevisiae as a component of the Antagonist of MEN pathway (AMEN). The AMEN network is activated by MEN (mitotic exit network) via an active Cdc14, and in turn switches off MEN. Amn1 constitutes one of the alternative mechanisms by which MEN may be disrupted. Specifically, Amn1 binds Tem1 (Termination of M-phase, a GTPase that belongs to the RAS superfamily), and disrupts its association with Cdc15, the primary downstream target. Amn1 is a leucine-rich repeat (LRR) protein, with 12 repeats in the S. cerevisiae ortholog. As a negative regulator of the signal transduction pathway MEN, overexpression of AMN1 slows the growth of wild type cells. The function of the vertebrate members of this family has not been determined experimentally, they have fewer LRRs that determine the extent of this model. Length = 226

>gnl|CDD|187754 cd09293, AMN1, Antagonist of mitotic exit network protein 1 Back     alignment and domain information
>gnl|CDD|187754 cd09293, AMN1, Antagonist of mitotic exit network protein 1 Back     alignment and domain information
>gnl|CDD|187754 cd09293, AMN1, Antagonist of mitotic exit network protein 1 Back     alignment and domain information
>gnl|CDD|187754 cd09293, AMN1, Antagonist of mitotic exit network protein 1 Back     alignment and domain information
>gnl|CDD|197685 smart00367, LRR_CC, Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 835
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.93
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.92
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.91
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.9
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.89
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.87
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.87
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.87
PLN032101153 Resistant to P. syringae 6; Provisional 99.79
PLN032101153 Resistant to P. syringae 6; Provisional 99.78
KOG4341483 consensus F-box protein containing LRR [General fu 99.76
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 99.69
KOG4341483 consensus F-box protein containing LRR [General fu 99.68
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.62
KOG4237498 consensus Extracellular matrix protein slit, conta 99.52
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.52
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.49
KOG4237498 consensus Extracellular matrix protein slit, conta 99.48
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.44
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.33
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.23
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.19
KOG0617264 consensus Ras suppressor protein (contains leucine 99.17
KOG0617264 consensus Ras suppressor protein (contains leucine 99.17
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.06
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 99.01
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.97
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.9
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.84
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.82
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.82
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.82
KOG1947482 consensus Leucine rich repeat proteins, some prote 98.73
KOG1947482 consensus Leucine rich repeat proteins, some prote 98.58
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.56
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.52
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.51
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.38
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.26
PLN03150623 hypothetical protein; Provisional 98.26
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.24
KOG2982 418 consensus Uncharacterized conserved protein [Funct 98.21
PLN03150623 hypothetical protein; Provisional 98.19
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.18
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.13
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 98.1
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.1
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.05
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.03
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.85
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.85
PRK15386426 type III secretion protein GogB; Provisional 97.66
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.66
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 97.55
PRK15386 426 type III secretion protein GogB; Provisional 97.53
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 97.5
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.42
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.16
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.1
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.04
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.97
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.81
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.76
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 96.65
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 96.45
KOG3864221 consensus Uncharacterized conserved protein [Funct 96.44
KOG3864221 consensus Uncharacterized conserved protein [Funct 96.19
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 95.82
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 95.66
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 95.32
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 95.25
KOG4308478 consensus LRR-containing protein [Function unknown 95.14
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.04
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 92.33
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 91.68
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 90.16
KOG4308478 consensus LRR-containing protein [Function unknown 89.75
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 89.37
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 87.04
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 82.66
PF1293747 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 82.1
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 81.47
smart0037026 LRR Leucine-rich repeats, outliers. 81.47
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 80.42
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=100.00  E-value=3.9e-42  Score=417.32  Aligned_cols=241  Identities=19%  Similarity=0.224  Sum_probs=162.6

Q ss_pred             HHHHHhhcCCCCceeeccCCCCCCHHHHHHHHhcCCCeeEEEccCCcchhhHHHHHHhhCCcCcEEEcCCcccChhhHHh
Q 003270           63 WQWRAASAHEDFWRCLNFENRKISVEQFEDVCQRYPNATEVNIYGAPAIHLLVMKAVSLLRNLEALTLGRGQLGDAFFHA  142 (835)
Q Consensus        63 ~~W~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~l~~L~l~~~~~~~~~~~~~l~~~~~L~~L~l~~~~i~~~~~~~  142 (835)
                      ..|. ...+.|.|.++.|++.+              +++.|++++ +.+.+..+..+..+++|+.|++++|.+.+.+|..
T Consensus        49 ~~w~-~~~~~c~w~gv~c~~~~--------------~v~~L~L~~-~~i~~~~~~~~~~l~~L~~L~Ls~n~~~~~ip~~  112 (968)
T PLN00113         49 SNWN-SSADVCLWQGITCNNSS--------------RVVSIDLSG-KNISGKISSAIFRLPYIQTINLSNNQLSGPIPDD  112 (968)
T ss_pred             CCCC-CCCCCCcCcceecCCCC--------------cEEEEEecC-CCccccCChHHhCCCCCCEEECCCCccCCcCChH
Confidence            4684 34568899999986432              799999999 5677777889999999999999999999888876


Q ss_pred             hc-CCCCCCEEEecCCCCCcccccccccCCcccEEeccCcccccc----ccCCCCCcEEEecccchH----HHhhcCCCC
Q 003270          143 LA-DCSMLKSLNVNDATLGNGVQEIPINHDQLRRLEITKCRVMRV----SIRCPQLEHLSLKRSNMA----QAVLNCPLL  213 (835)
Q Consensus       143 l~-~~~~L~~L~l~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~----~~~l~~L~~L~l~~~~i~----~~~~~~~~L  213 (835)
                      +. .+++|++|++++|.+++.+|.  ..+++|++|++++|.+...    ..++++|++|++++|.+.    ..+.++++|
T Consensus       113 ~~~~l~~L~~L~Ls~n~l~~~~p~--~~l~~L~~L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L  190 (968)
T PLN00113        113 IFTTSSSLRYLNLSNNNFTGSIPR--GSIPNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNLTSL  190 (968)
T ss_pred             HhccCCCCCEEECcCCccccccCc--cccCCCCEEECcCCcccccCChHHhcCCCCCEEECccCcccccCChhhhhCcCC
Confidence            55 899999999999999887775  4577888888888776421    234666666666666543    445566666


Q ss_pred             cEEeecCCCCCCHHHHHHHHhcCCCCCEEeCCCCCCCChHHHHHHHHhCCCCcEEecCCCC---CCCccccCCCCCcEEe
Q 003270          214 HLLDIASCHKLSDAAIRLAATSCPQLESLDMSNCSCVSDESLREIALSCANLRILNSSYCP---NISLESVRLPMLTVLQ  290 (835)
Q Consensus       214 ~~L~l~~~~~l~~~~l~~~~~~~~~L~~L~L~~~~~l~~~~~~~~~~~~~~L~~L~l~~~~---~l~~~~~~~~~L~~L~  290 (835)
                      ++|++++|. +. +.+|..++++++|++|++++|. +.+..+..+. .+++|++|++++|.   .+|..++.+++|++|+
T Consensus       191 ~~L~L~~n~-l~-~~~p~~l~~l~~L~~L~L~~n~-l~~~~p~~l~-~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~  266 (968)
T PLN00113        191 EFLTLASNQ-LV-GQIPRELGQMKSLKWIYLGYNN-LSGEIPYEIG-GLTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLF  266 (968)
T ss_pred             CeeeccCCC-Cc-CcCChHHcCcCCccEEECcCCc-cCCcCChhHh-cCCCCCEEECcCceeccccChhHhCCCCCCEEE
Confidence            666666653 33 2345556666666666666665 5545555554 56666666666654   3455555566666666


Q ss_pred             cCCCCCCChhhHHHhhhccCccEEEccCCCcccccc
Q 003270          291 LHSCEGITSASMAAISHSYMLEVLELDNCNLLTSVS  326 (835)
Q Consensus       291 l~~~~~~~~~~~~~l~~~~~L~~L~l~~~~~~~~~~  326 (835)
                      +++| .+.+..+..+..+++|++|++++|.+.+.+|
T Consensus       267 L~~n-~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p  301 (968)
T PLN00113        267 LYQN-KLSGPIPPSIFSLQKLISLDLSDNSLSGEIP  301 (968)
T ss_pred             CcCC-eeeccCchhHhhccCcCEEECcCCeeccCCC
Confidence            6554 4444455555555566666665555444333



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information
>PF12937 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 2OVQ_B 1FS1_A 1FS2_C 1FQV_I 1LDK_E 2AST_B 2ASS_B Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query835
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 3e-36
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 5e-36
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 1e-30
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 6e-29
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 3e-07
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 1e-32
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 1e-30
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 2e-22
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 7e-20
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 4e-24
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 1e-18
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 3e-13
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 4e-11
2ast_B 336 S-phase kinase-associated protein 2; SCF-substrate 1e-07
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-19
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-13
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-12
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-09
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-08
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-08
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-15
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-13
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-10
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-14
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-13
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-10
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-08
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 5e-08
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-14
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-14
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 9e-11
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-14
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-13
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-08
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 8e-14
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 9e-14
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-09
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-13
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-11
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 8e-08
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-13
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-11
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-09
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-08
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-07
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-13
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-09
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-04
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-12
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-10
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-08
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-05
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-12
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-06
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 4e-06
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-05
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-11
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-08
1o6v_A 466 Internalin A; bacterial infection, extracellular r 8e-06
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-05
1o6v_A 466 Internalin A; bacterial infection, extracellular r 5e-05
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 1e-10
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 2e-09
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 2e-09
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 1e-08
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 1e-07
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 1e-07
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 2e-06
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 1e-05
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-08
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-08
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 4e-07
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-08
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-06
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 4e-08
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 4e-07
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 7e-06
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 2e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 4e-04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 9e-08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-04
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-07
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-06
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 9e-06
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-05
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-05
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-07
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-05
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-05
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-04
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-07
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-05
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-04
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-07
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 8e-07
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 4e-06
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-07
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-07
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-05
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-04
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 8e-07
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 4e-04
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-06
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-06
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-05
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-04
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-04
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-06
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-05
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 5e-06
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-04
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 7e-04
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-05
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 8e-05
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-04
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-04
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 6e-04
1qzv_F154 Plant photosystem I: subunit PSAF; photosynthesis, 1e-04
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-04
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-04
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-04
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-04
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-04
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 7e-04
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 6e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 7e-04
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
 Score =  144 bits (364), Expect = 3e-36
 Identities = 85/586 (14%), Positives = 166/586 (28%), Gaps = 125/586 (21%)

Query: 64  QWRAASAHEDFWRCLNFENRKISVEQFEDVCQRYPNATEVNIYGAPAIHLLVMKAVSLLR 123
            W         W                 V +R+P    V + G P              
Sbjct: 36  SWYEIER----WCRRKVFIGNCYAVSPATVIRRFPKVRSVELKGKPHF-----------A 80

Query: 124 NLEALTLGRGQLGDAFFHALAD-CSMLKSLNVNDATLGN-GVQEIPINHDQLRRLEITKC 181
           +   +  G G     +  A++   + L+ + +    + +  ++ I  +    + L ++ C
Sbjct: 81  DFNLVPDGWGGYVYPWIEAMSSSYTWLEEIRLKRMVVTDDCLELIAKSFKNFKVLVLSSC 140

Query: 182 R------VMRVSIRCPQLEHLSLKRSN--------MAQAVLNCPLLHLLDIASCH-KLSD 226
                  +  ++  C  L+ L L+ S+        ++        L  L+I+    ++S 
Sbjct: 141 EGFSTDGLAAIAATCRNLKELDLRESDVDDVSGHWLSHFPDTYTSLVSLNISCLASEVSF 200

Query: 227 AAIRLAATSCPQLESLDMSNCSCVSDESLREIALSCANLRILNSSYCPNISLESVRLPML 286
           +A+    T CP L+SL ++    V  E L  +      L  L +          V   + 
Sbjct: 201 SALERLVTRCPNLKSLKLNRA--VPLEKLATLLQRAPQLEELGTGGYTAEVRPDVYSGLS 258

Query: 287 TVLQ-------LHSCEGITSASMAAI-SHSYMLEVLELDNCNLLTSVSLELPRLQNIRLV 338
             L        L        A + A+ S    L  L L    + +   ++L       L 
Sbjct: 259 VALSGCKELRCLSGFWDAVPAYLPAVYSVCSRLTTLNLSYATVQSYDLVKL-------LC 311

Query: 339 HCRKFADLNLRAMMLSSIMVSNCAALHRINITSNSLQKLSLQKQENLTSLALQCQCLQEV 398
            C K   L +                    I    L+            LA  C+ L+E+
Sbjct: 312 QCPKLQRLWVLD-----------------YIEDAGLE-----------VLASTCKDLREL 343

Query: 399 DLTDCESLTNSVCEVFSDGG------GCPMLKSLVLDNC----EGLTVVRFCSTSLVSLS 448
            +   E          ++ G      GCP L+S++          L  +     ++    
Sbjct: 344 RVFPSEPFVMEPNVALTEQGLVSVSMGCPKLESVLYFCRQMTNAALITIARNRPNMTRFR 403

Query: 449 LVGCRAITALELKCPILEKVCLDGCDHIESASFVPVALQSLNLGICPKLSTLGIEALHMV 508
           L                               F  +         C  L  L +      
Sbjct: 404 LCIIEPKA------------PDYLTLEPLDIGFGAIVEH------CKDLRRLSL------ 439

Query: 509 VLELKGCGVLSDAYI-----NCPLLTSLDASFCSQLKDDCLSATTTSCPLIESLILMSCQ 563
                  G+L+D            +  L  +F     D  +    + C  +  L +  C 
Sbjct: 440 ------SGLLTDKVFEYIGTYAKKMEMLSVAFA-GDSDLGMHHVLSGCDSLRKLEIRDCP 492

Query: 564 SIGPDGLYSLRSLQNLTMLDLSYTFLTN--LEPVFESCLQLKVLKL 607
                 L +   L+ +  L +S   ++    + + +   +L V  +
Sbjct: 493 FGDKALLANASKLETMRSLWMSSCSVSFGACKLLGQKMPKLNVEVI 538


>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query835
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.98
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.97
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.97
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.97
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.97
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.97
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.96
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.96
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.96
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.95
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.95
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.95
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.95
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.95
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.94
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.94
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.94
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.94
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.94
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.92
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.92
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.92
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.91
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.91
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.91
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.9
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.9
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.89
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.89
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.88
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.88
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.86
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.85
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.83
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.83
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.83
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.81
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.8
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.79
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.78
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.78
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.78
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.78
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.78
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.77
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.76
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.75
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.75
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.75
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.74
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.74
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.74
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.74
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.73
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.73
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.73
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.73
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.73
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.72
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.7
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.68
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.68
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.66
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.64
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.63
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.62
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.61
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.6
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.59
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.59
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.58
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.58
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.58
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.57
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.57
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.49
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.47
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.45
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.44
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.43
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.42
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.4
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.4
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.39
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.39
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.39
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.38
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.38
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.35
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.34
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.34
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.34
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.32
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.29
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.29
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.28
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.28
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.28
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.27
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.26
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.26
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.26
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.24
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.24
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.22
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.22
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.21
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.2
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.18
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.17
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.16
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.13
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.12
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.12
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.11
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.08
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.07
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.06
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.03
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.01
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.01
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 99.0
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 98.98
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 98.95
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.94
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 98.93
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.92
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.75
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.74
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.73
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.7
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.7
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.68
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.66
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.61
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.61
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.58
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.46
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.43
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.3
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.3
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 98.02
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.78
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.65
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.65
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 95.81
1fs1_A53 SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L 90.24
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 89.6
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=9.9e-51  Score=478.49  Aligned_cols=634  Identities=18%  Similarity=0.178  Sum_probs=355.9

Q ss_pred             HHHHHHHhhcCCCCceeeccCCCCCCHHHHHHHHhcCCCeeEEEccCCcchhhH---HHHHHhhCCcCcEEEcCCcccCh
Q 003270           61 CIWQWRAASAHEDFWRCLNFENRKISVEQFEDVCQRYPNATEVNIYGAPAIHLL---VMKAVSLLRNLEALTLGRGQLGD  137 (835)
Q Consensus        61 v~~~W~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~l~~L~l~~~~~~~~~---~~~~l~~~~~L~~L~l~~~~i~~  137 (835)
                      +...|. ...++|.|++|.|+ .              .+++.|+++++ .+.+.   +++++..+++|+.++++.+.+..
T Consensus        29 ~l~~W~-~~~~~C~w~gv~C~-~--------------~~v~~L~L~~~-~l~g~~~~l~~~l~~L~~L~~l~~~~~~~~~   91 (768)
T 3rgz_A           29 LLPDWS-SNKNPCTFDGVTCR-D--------------DKVTSIDLSSK-PLNVGFSAVSSSLLSLTGLESLFLSNSHING   91 (768)
T ss_dssp             SSTTCC-TTSCGGGSTTEEEE-T--------------TEEEEEECTTS-CCCEEHHHHHHHTTTCTTCCEEECTTSCEEE
T ss_pred             cccCCC-CCCCCcCCcceEEC-C--------------CcEEEEECCCC-CcCCccCccChhHhccCcccccCCcCCCcCC
Confidence            355796 45678999999996 2              27999999994 55554   77889999999999999887753


Q ss_pred             hhHHhhcCCCCCCEEEecCCCCCccccc--ccccCCcccEEeccCcccccc-----ccCCCCCcEEEecccchHHHhhcC
Q 003270          138 AFFHALADCSMLKSLNVNDATLGNGVQE--IPINHDQLRRLEITKCRVMRV-----SIRCPQLEHLSLKRSNMAQAVLNC  210 (835)
Q Consensus       138 ~~~~~l~~~~~L~~L~l~~~~~~~~~~~--~~~~l~~L~~L~l~~~~~~~~-----~~~l~~L~~L~l~~~~i~~~~~~~  210 (835)
                       +|..++.+++|++|++++|.+.+.+|.  .++++++|++|++++|.+...     ..++++|++|++++|.+.      
T Consensus        92 -l~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~~~~~l~~L~~L~Ls~n~l~------  164 (768)
T 3rgz_A           92 -SVSGFKCSASLTSLDLSRNSLSGPVTTLTSLGSCSGLKFLNVSSNTLDFPGKVSGGLKLNSLEVLDLSANSIS------  164 (768)
T ss_dssp             -CCCCCCCCTTCCEEECCSSEEEEEGGGGGGGGGCTTCCEEECCSSEEECCSSCCSCCCCTTCSEEECCSSCCE------
T ss_pred             -CchhhccCCCCCEEECCCCcCCCcCCChHHHhCCCCCCEEECcCCccCCcCCHHHhccCCCCCEEECCCCccC------
Confidence             567899999999999999999988888  888899999999988876421     124555555555555443      


Q ss_pred             CCCcEEeecCCCCCCHHHHHHH---HhcCCCCCEEeCCCCCCCChHHHHHHHHhCCCCcEEecCCCC---CCCccccCCC
Q 003270          211 PLLHLLDIASCHKLSDAAIRLA---ATSCPQLESLDMSNCSCVSDESLREIALSCANLRILNSSYCP---NISLESVRLP  284 (835)
Q Consensus       211 ~~L~~L~l~~~~~l~~~~l~~~---~~~~~~L~~L~L~~~~~l~~~~~~~~~~~~~~L~~L~l~~~~---~l~~~~~~~~  284 (835)
                                     .. .+..   +.++++|++|++++|. +.+..+.   ..+++|++|++++|.   .+|. ++.++
T Consensus       165 ---------------~~-~~~~~~~~~~l~~L~~L~Ls~n~-l~~~~~~---~~l~~L~~L~Ls~n~l~~~~~~-l~~l~  223 (768)
T 3rgz_A          165 ---------------GA-NVVGWVLSDGCGELKHLAISGNK-ISGDVDV---SRCVNLEFLDVSSNNFSTGIPF-LGDCS  223 (768)
T ss_dssp             ---------------EE-THHHHHHTTCCTTCCEEECCSSE-EESCCBC---TTCTTCCEEECCSSCCCSCCCB-CTTCC
T ss_pred             ---------------Cc-CChhhhhhccCCCCCEEECCCCc-ccccCCc---ccCCcCCEEECcCCcCCCCCcc-cccCC
Confidence                           11 1111   3444555555555544 3221111   145555555555554   2233 55666


Q ss_pred             CCcEEecCCCCCCChhhHHHhhhccCccEEEccCCCccccccccCcccceeeccccccccchhhccccccee---eec-c
Q 003270          285 MLTVLQLHSCEGITSASMAAISHSYMLEVLELDNCNLLTSVSLELPRLQNIRLVHCRKFADLNLRAMMLSSI---MVS-N  360 (835)
Q Consensus       285 ~L~~L~l~~~~~~~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~~~~L~~L~~~~~~~l~~l~l~~~~l~~~---~l~-~  360 (835)
                      +|++|++++| .+.+..+..++.+++|++|++++|.+.+.+|..          .+++|+.+++.++.+++.   .+. .
T Consensus       224 ~L~~L~Ls~n-~l~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~----------~l~~L~~L~L~~n~l~~~ip~~~~~~  292 (768)
T 3rgz_A          224 ALQHLDISGN-KLSGDFSRAISTCTELKLLNISSNQFVGPIPPL----------PLKSLQYLSLAENKFTGEIPDFLSGA  292 (768)
T ss_dssp             SCCEEECCSS-CCCSCHHHHTTTCSSCCEEECCSSCCEESCCCC----------CCTTCCEEECCSSEEEESCCCCSCTT
T ss_pred             CCCEEECcCC-cCCCcccHHHhcCCCCCEEECCCCcccCccCcc----------ccCCCCEEECcCCccCCccCHHHHhh
Confidence            6666666665 566666666777777777777777665554432          222333333333333311   222 2


Q ss_pred             CCCcceeeeccCccccchhhcchhhHHHHhhCCcccEEecCCCcCCchhhhhh-ccCCCCCCCccEEEecCCCCCc-ccc
Q 003270          361 CAALHRINITSNSLQKLSLQKQENLTSLALQCQCLQEVDLTDCESLTNSVCEV-FSDGGGCPMLKSLVLDNCEGLT-VVR  438 (835)
Q Consensus       361 ~~~L~~L~l~~n~l~~~~~~~~~~l~~l~~~~~~L~~L~l~~c~~l~~~~~~~-~~~~~~~~~L~~L~l~~~~~l~-~~~  438 (835)
                      |++|++|++++|.+++..+..+.       .+++|++|++++ +.+++..|.. +   ..+++|++|++++|. ++ .++
T Consensus       293 ~~~L~~L~Ls~n~l~~~~p~~~~-------~l~~L~~L~L~~-n~l~~~ip~~~l---~~l~~L~~L~Ls~n~-l~~~~p  360 (768)
T 3rgz_A          293 CDTLTGLDLSGNHFYGAVPPFFG-------SCSLLESLALSS-NNFSGELPMDTL---LKMRGLKVLDLSFNE-FSGELP  360 (768)
T ss_dssp             CTTCSEEECCSSEEEECCCGGGG-------GCTTCCEEECCS-SEEEEECCHHHH---TTCTTCCEEECCSSE-EEECCC
T ss_pred             cCcCCEEECcCCcCCCccchHHh-------cCCCccEEECCC-CcccCcCCHHHH---hcCCCCCEEeCcCCc-cCcccc
Confidence            47777777777777765443332       346777777777 4666544433 4   567777777777765 22 111


Q ss_pred             ccCCcceEEeccCCcccccccccC-CCCcEEecCCCCCccccccccccccccccCcCCCCcccccccceeEEEeecCCcc
Q 003270          439 FCSTSLVSLSLVGCRAITALELKC-PILEKVCLDGCDHIESASFVPVALQSLNLGICPKLSTLGIEALHMVVLELKGCGV  517 (835)
Q Consensus       439 ~~~~~l~~l~l~~~~~l~~l~~~~-~~L~~l~l~~~~~l~~~~~~p~~L~~L~l~~~~~L~~l~l~~~~l~~l~~~~~~~  517 (835)
                      ..                  ...+ ++|+.++++++.-.+   .+|..+   ....+++|+.+++++|.++       +.
T Consensus       361 ~~------------------l~~l~~~L~~L~Ls~N~l~~---~~~~~~---~~~~~~~L~~L~L~~n~l~-------~~  409 (768)
T 3rgz_A          361 ES------------------LTNLSASLLTLDLSSNNFSG---PILPNL---CQNPKNTLQELYLQNNGFT-------GK  409 (768)
T ss_dssp             TT------------------HHHHTTTCSEEECCSSEEEE---ECCTTT---TCSTTCCCCEEECCSSEEE-------EE
T ss_pred             HH------------------HHhhhcCCcEEEccCCCcCC---CcChhh---hhcccCCccEEECCCCccc-------cc
Confidence            10                  0011 245555555442211   112211   0112455666666666664       55


Q ss_pred             cccccccCCCcceEecccCCCCccchhhhhhhcCCCccEEeccCCCCcCchhhHhhhhccccceeeecCccccC-chHHH
Q 003270          518 LSDAYINCPLLTSLDASFCSQLKDDCLSATTTSCPLIESLILMSCQSIGPDGLYSLRSLQNLTMLDLSYTFLTN-LEPVF  596 (835)
Q Consensus       518 l~~~~~~~~~L~~L~ls~~~~l~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~l~~L~~L~Ls~~~~~~-l~~~~  596 (835)
                      +|..+.++++|++|++++| .+. +.++..+..+++|+.|++++|...+.. +..+..+++|++|++++|++++ +|..+
T Consensus       410 ~p~~l~~l~~L~~L~Ls~N-~l~-~~~p~~l~~l~~L~~L~L~~n~l~~~~-p~~~~~l~~L~~L~L~~N~l~~~~p~~l  486 (768)
T 3rgz_A          410 IPPTLSNCSELVSLHLSFN-YLS-GTIPSSLGSLSKLRDLKLWLNMLEGEI-PQELMYVKTLETLILDFNDLTGEIPSGL  486 (768)
T ss_dssp             CCGGGGGCTTCCEEECCSS-EEE-SCCCGGGGGCTTCCEEECCSSCCCSCC-CGGGGGCTTCCEEECCSSCCCSCCCGGG
T ss_pred             cCHHHhcCCCCCEEECcCC-ccc-CcccHHHhcCCCCCEEECCCCcccCcC-CHHHcCCCCceEEEecCCcccCcCCHHH
Confidence            5666666666666666666 232 234555666666666666666644332 5556666666666666666664 55566


Q ss_pred             hccccccEEecccccccchhhHHHHHhcCCCCCccEEeCCCcccchHHHHHHHhhCCCccEEEccCCCCCcccccccccc
Q 003270          597 ESCLQLKVLKLQACKYLTNTSLESLYKKGSLPALQELDLSYGTLCQSAIEELLAYCTHLTHVSLNGCGNMHDLNWGASGC  676 (835)
Q Consensus       597 ~~~~~L~~L~l~~~~~l~~~~~~~l~~~~~~~~L~~L~l~~n~~~~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~~~~~  676 (835)
                      ..+++|++|++++|+ +++..+..+   +.+++|++|++++|++++ .+|..+..+++|++|++++|+....++...   
T Consensus       487 ~~l~~L~~L~L~~N~-l~~~~p~~~---~~l~~L~~L~L~~N~l~~-~~p~~l~~l~~L~~L~Ls~N~l~g~ip~~~---  558 (768)
T 3rgz_A          487 SNCTNLNWISLSNNR-LTGEIPKWI---GRLENLAILKLSNNSFSG-NIPAELGDCRSLIWLDLNTNLFNGTIPAAM---  558 (768)
T ss_dssp             GGCTTCCEEECCSSC-CCSCCCGGG---GGCTTCCEEECCSSCCEE-ECCGGGGGCTTCCEEECCSSEEESBCCGGG---
T ss_pred             hcCCCCCEEEccCCc-cCCcCChHH---hcCCCCCEEECCCCcccC-cCCHHHcCCCCCCEEECCCCccCCcCChHH---
Confidence            666666666666666 555555443   456666666666666665 455556666666666666665332322111   


Q ss_pred             CCCCCCccccccccC-----------CCC---C------cccccC---ccccccccccccCCCCccccccCcccccCccc
Q 003270          677 QPFESPSVYNSCGIF-----------PHE---N------IHESID---QPNRLLQNLNCVGCPNIRKVFIPPQARCFHLS  733 (835)
Q Consensus       677 ~~~~l~~l~~~~~~~-----------~~~---~------~~~~~~---~~~~~L~~L~i~~~~~l~~~~~~~~~~~~~L~  733 (835)
                        .....+.......           ...   .      ......   .....++.+++.. ..+.....+.++.+++|+
T Consensus       559 --~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~-~~~~g~~~~~~~~l~~L~  635 (768)
T 3rgz_A          559 --FKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITS-RVYGGHTSPTFDNNGSMM  635 (768)
T ss_dssp             --GTTTTCBCCSTTCSCEEEEEECCSCCTTCCSSEEEEECTTCCGGGGGGGGGTCCSCTTS-CEEEEECCCSCSSSBCCC
T ss_pred             --hcccchhhhhccccccccccccccccccccccccccccccccchhhhcccccccccccc-ceecccCchhhhcccccc
Confidence              1100000000000           000   0      000000   0001111111111 011111122355666677


Q ss_pred             eEeccCCC---CccccccccccccEEecccccchhhhhh---cCCccceeecccCcCChhHHHHHHhcCCCcceeecccc
Q 003270          734 SLNLSLSA---NLKEVDVACFNLCFLNLSNCCSLETLKL---DCPKLTSLFLQSCNIDEEGVESAITQCGMLETLDVRFC  807 (835)
Q Consensus       734 ~L~l~~~~---~l~~~~~~~~~L~~L~l~~c~~l~~l~~---~~~~L~~L~l~~~~i~~~~l~~~~~~~~~L~~l~l~~c  807 (835)
                      .|+++++.   .++.....+++|+.|++++|..-..+|.   .+++|++|++++|+++ +.+|..+..+++|++||+++|
T Consensus       636 ~LdLs~N~l~g~ip~~l~~l~~L~~L~Ls~N~l~g~ip~~l~~L~~L~~LdLs~N~l~-g~ip~~l~~l~~L~~L~ls~N  714 (768)
T 3rgz_A          636 FLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLD-GRIPQAMSALTMLTEIDLSNN  714 (768)
T ss_dssp             EEECCSSCCBSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCE-ECCCGGGGGCCCCSEEECCSS
T ss_pred             EEECcCCcccccCCHHHhccccCCEEeCcCCccCCCCChHHhCCCCCCEEECCCCccc-CcCChHHhCCCCCCEEECcCC
Confidence            77776543   3333344566677777777664445553   4566777777777765 456666667777777777766


Q ss_pred             c
Q 003270          808 P  808 (835)
Q Consensus       808 ~  808 (835)
                      +
T Consensus       715 ~  715 (768)
T 3rgz_A          715 N  715 (768)
T ss_dssp             E
T ss_pred             c
Confidence            5



>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 835
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 7e-07
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-04
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 7e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.003
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.004
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: RNI-like
family: Cyclin A/CDK2-associated p19, Skp2
domain: Cyclin A/CDK2-associated p19, Skp2
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 49.3 bits (116), Expect = 7e-07
 Identities = 39/265 (14%), Positives = 76/265 (28%), Gaps = 17/265 (6%)

Query: 580 TMLDLSYTFLTNLEPVFESCLQLKVLKLQACKYLTNTSLESLYKKGSLPALQELDLSYGT 639
             LDL+   L            +   +        +   + L +  S   +Q +DLS   
Sbjct: 3   QTLDLTGKNLHPDVTGRLLSQGVIAFRCPR-----SFMDQPLAEHFSPFRVQHMDLSNSV 57

Query: 640 LCQSAIEELLAYCTHLTHVSLNGCGNMHDLNWGASGCQPFESPSVYNSCGIF-----PHE 694
           +  S +  +L+ C+ L ++SL G      +    +        ++    G          
Sbjct: 58  IEVSTLHGILSQCSKLQNLSLEGLRLSDPIVNTLAKNSNLVRLNLSGCSGFSEFALQTLL 117

Query: 695 NIHESIDQPNRLLQNLNCVGCPNIRKVFIPPQARCFHLSSLNLSLSANLKEVDVACFNLC 754
           +    +D+ N             +    +       +LS    +L  +     V      
Sbjct: 118 SSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNL 177

Query: 755 FLNLSNCCSLETLKL-----DCPKLTSLFLQSCNIDEEGVESAITQCGMLETLDVRFCPK 809
                +   +              L  L L  C          + +   L+TL V     
Sbjct: 178 VHLDLSDSVMLKNDCFQEFFQLNYLQHLSLSRCYDIIPETLLELGEIPTLKTLQVFGI-- 235

Query: 810 ICSTSMGRLRAACPSLKRIFSSLTT 834
           +   ++  L+ A P L+   S  TT
Sbjct: 236 VPDGTLQLLKEALPHLQINCSHFTT 260


>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query835
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.83
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.81
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.81
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.75
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.73
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.73
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.72
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.71
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.68
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.66
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.58
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.58
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.55
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.5
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.49
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.43
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.41
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.4
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.37
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.36
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.35
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.34
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.33
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.3
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.2
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.19
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.12
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.11
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.1
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.1
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.08
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.05
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.94
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.87
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.62
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.51
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.39
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 98.13
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.97
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.93
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.85
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.7
d1fs1a141 Skp2 {Human (Homo sapiens) [TaxId: 9606]} 90.38
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
Probab=99.83  E-value=4.2e-19  Score=189.46  Aligned_cols=81  Identities=12%  Similarity=0.119  Sum_probs=43.8

Q ss_pred             hhcCCCccEEeccCCCCcCchhhHhhhhccccceeeecCccccCchHHHhccccccEEecccccccchhhHHHHHhcCCC
Q 003270          548 TTSCPLIESLILMSCQSIGPDGLYSLRSLQNLTMLDLSYTFLTNLEPVFESCLQLKVLKLQACKYLTNTSLESLYKKGSL  627 (835)
Q Consensus       548 ~~~~~~L~~L~l~~~~~~~~~~~~~~~~l~~L~~L~Ls~~~~~~l~~~~~~~~~L~~L~l~~~~~l~~~~~~~l~~~~~~  627 (835)
                      +..+++++.|++++|...+.   ..+..+++|++|++++|++++++ .+.++++|++|++++|+ +++..+     +.++
T Consensus       303 ~~~~~~l~~L~ls~n~l~~l---~~l~~l~~L~~L~L~~n~l~~l~-~l~~l~~L~~L~l~~N~-l~~l~~-----l~~l  372 (384)
T d2omza2         303 ISNLKNLTYLTLYFNNISDI---SPVSSLTKLQRLFFANNKVSDVS-SLANLTNINWLSAGHNQ-ISDLTP-----LANL  372 (384)
T ss_dssp             GGGCTTCSEEECCSSCCSCC---GGGGGCTTCCEEECCSSCCCCCG-GGGGCTTCCEEECCSSC-CCBCGG-----GTTC
T ss_pred             cchhcccCeEECCCCCCCCC---cccccCCCCCEEECCCCCCCCCh-hHcCCCCCCEEECCCCc-CCCChh-----hccC
Confidence            34445555555555543321   23555566666666666665554 35556666666666665 554432     2456


Q ss_pred             CCccEEeCCCc
Q 003270          628 PALQELDLSYG  638 (835)
Q Consensus       628 ~~L~~L~l~~n  638 (835)
                      ++|+.|++++|
T Consensus       373 ~~L~~L~L~~N  383 (384)
T d2omza2         373 TRITQLGLNDQ  383 (384)
T ss_dssp             TTCSEEECCCE
T ss_pred             CCCCEeeCCCC
Confidence            66666666655



>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure