Citrus Sinensis ID: 003297
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 833 | ||||||
| 225423909 | 827 | PREDICTED: uncharacterized protein LOC10 | 0.828 | 0.834 | 0.815 | 0.0 | |
| 297737854 | 815 | unnamed protein product [Vitis vinifera] | 0.815 | 0.833 | 0.803 | 0.0 | |
| 224111730 | 796 | predicted protein [Populus trichocarpa] | 0.818 | 0.856 | 0.798 | 0.0 | |
| 449434652 | 858 | PREDICTED: mediator of RNA polymerase II | 0.811 | 0.787 | 0.725 | 0.0 | |
| 356502460 | 879 | PREDICTED: uncharacterized protein LOC10 | 0.813 | 0.771 | 0.727 | 0.0 | |
| 312283021 | 852 | unnamed protein product [Thellungiella h | 0.797 | 0.779 | 0.678 | 0.0 | |
| 30689268 | 836 | phytochrome and flowering time regulator | 0.799 | 0.796 | 0.669 | 0.0 | |
| 297845606 | 832 | hypothetical protein ARALYDRAFT_472815 [ | 0.799 | 0.800 | 0.673 | 0.0 | |
| 255576521 | 561 | conserved hypothetical protein [Ricinus | 0.633 | 0.941 | 0.779 | 0.0 | |
| 449519677 | 595 | PREDICTED: mediator of RNA polymerase II | 0.707 | 0.989 | 0.689 | 0.0 |
| >gi|225423909|ref|XP_002278845.1| PREDICTED: uncharacterized protein LOC100259509 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 1098 bits (2839), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 565/693 (81%), Positives = 622/693 (89%), Gaps = 3/693 (0%)
Query: 1 MSEKQLIVAVEGTAAMGPYWQSIVSDYLEKIIRCFCVNELAGQT-SASNVELSLVTFNTH 59
M+EKQL+VAVEGTAAMGPYWQ++VSDYL+KIIR FC NELAGQ S+SN ELSLV FN H
Sbjct: 1 MAEKQLVVAVEGTAAMGPYWQAVVSDYLDKIIRYFCGNELAGQKPSSSNFELSLVMFNAH 60
Query: 60 GSYCACLVQRSGWTKDVDIFLHWLSTIPFAGGGFNDAAIAEGLSEALMMFSVAPNGSQNQ 119
GSYC+CLVQRSGWT+DVD+FL WLS +PFAGGGFNDAAIAEGL+EALMMFSVA NGSQ Q
Sbjct: 61 GSYCSCLVQRSGWTRDVDLFLQWLSALPFAGGGFNDAAIAEGLAEALMMFSVAANGSQTQ 120
Query: 120 QNVDGQRHCILVAASNPHPLPTPVYRPQMQNLDQNENNEAQAESRLSDAETVAKSFVQCS 179
QNVDGQRHCILVAA+NP+PLPTPVY+PQMQN++QNE+ E+Q ESRLSDAE VAKSF QCS
Sbjct: 121 QNVDGQRHCILVAANNPYPLPTPVYQPQMQNMEQNESIESQTESRLSDAEAVAKSFAQCS 180
Query: 180 VSLSVICPKQLPKLTAIYNAAKRNPRAADPPVDNSKNPHFLVLISENFMEARAALSRPGV 239
VSLSVICPKQLPKL +IYNA KRNPR ADPPVDN KNPHFLVLIS++FMEARAALSRPG+
Sbjct: 181 VSLSVICPKQLPKLKSIYNAGKRNPRVADPPVDNVKNPHFLVLISDSFMEARAALSRPGL 240
Query: 240 ANLAPNQNPVKMDIAPVTSVTGPAPTSIPSVNGI-NRPPISVGNVPTATVKVEPSTVTSM 298
+N+ NQ+PVKMDIA V V+ P SIPSVNGI NRP I+VG VPTATVKVEPSTVTS+
Sbjct: 241 SNMTANQSPVKMDIASVPQVSAAPPASIPSVNGIMNRPTIAVGAVPTATVKVEPSTVTSI 300
Query: 299 VNGPTFPHIPSVPRPASQGVPSLQTSSPSSTSQEMITSGDSVPEVKPLVSGMSQPLRPMA 358
+GP FPHIPSVPR ASQGVPSLQTSSPSSTSQEMI++GD+V ++KP+VSG+SQ LRP+
Sbjct: 301 TSGPGFPHIPSVPRAASQGVPSLQTSSPSSTSQEMISNGDNVQDLKPIVSGISQTLRPVV 360
Query: 359 PAAANVNILNNLSQARQVMNNAALTGGTSIGLQSMGQTPMAMHMSNMISSGMASSVPTSQ 418
PAAANV+ILNNLSQARQVM++AAL+GGTSIGLQSMG T MAMHMSNMISSGMASSVP +Q
Sbjct: 361 PAAANVSILNNLSQARQVMHSAALSGGTSIGLQSMGGTSMAMHMSNMISSGMASSVPATQ 420
Query: 419 PVFSSAQSGITSIGGSGTLTGTSQVPQNSGLNSFTSAPSNLSGNSNPSISQPMGTLQGGA 478
VFSS QS ++SI GSGTL GT+QV QNS L SFTSA SN+S NSN ISQP+ LQGG
Sbjct: 421 TVFSSGQSAVSSITGSGTLAGTAQVAQNSALGSFTSATSNMSVNSNLGISQPLSNLQGGV 480
Query: 479 SMGQSV-GMSQGNHSGGQMVQNGISMNQNMMSGLGPSGVSSGTGTMIPTPGMSQQAQSGM 537
SMGQ+V GMSQGN GGQMVQ+GI MNQNMMSGLGPSG+SSGTGTMIPTPGMSQQ Q GM
Sbjct: 481 SMGQTVPGMSQGNLPGGQMVQSGIGMNQNMMSGLGPSGISSGTGTMIPTPGMSQQVQPGM 540
Query: 538 QPLSVNNNTAVNMQLSQQTSSALHSSQSKYVKVWEGSLSGQRQGQPVFITKLEGYRSASA 597
L VNNN A NM L QQTS A+ ++QSKYVKVWEG+LSGQRQGQPVFIT+LEGYRSASA
Sbjct: 541 PSLGVNNNAAANMPLPQQTSGAMQTAQSKYVKVWEGNLSGQRQGQPVFITRLEGYRSASA 600
Query: 598 SETLAANWPPTMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKKLCAVIQL 657
SE+LAANWP TMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKKLCAVIQL
Sbjct: 601 SESLAANWPATMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKKLCAVIQL 660
Query: 658 PSQTLLLSVSDKACRLIGMLFPGDMVVFKPQIS 690
PSQTLLLSVSDKACRLIGMLFPGDMVVFKPQI+
Sbjct: 661 PSQTLLLSVSDKACRLIGMLFPGDMVVFKPQIT 693
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|297737854|emb|CBI27055.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224111730|ref|XP_002315956.1| predicted protein [Populus trichocarpa] gi|222864996|gb|EEF02127.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|449434652|ref|XP_004135110.1| PREDICTED: mediator of RNA polymerase II transcription subunit 25-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356502460|ref|XP_003520037.1| PREDICTED: uncharacterized protein LOC100801664 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|312283021|dbj|BAJ34376.1| unnamed protein product [Thellungiella halophila] | Back alignment and taxonomy information |
|---|
| >gi|30689268|ref|NP_173925.3| phytochrome and flowering time regulatory protein 1 [Arabidopsis thaliana] gi|75145501|sp|Q7XYY2.1|MED25_ARATH RecName: Full=Mediator of RNA polymerase II transcription subunit 25; Short=AtMED25; AltName: Full=Phytochrome and flowering time 1 protein; AltName: Full=Phytochrome and flowering time regulatory protein 1 gi|32478899|gb|AAO39425.1| phytochrome and flowering time 1 protein [Arabidopsis thaliana] gi|332192518|gb|AEE30639.1| phytochrome and flowering time regulatory protein 1 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297845606|ref|XP_002890684.1| hypothetical protein ARALYDRAFT_472815 [Arabidopsis lyrata subsp. lyrata] gi|297336526|gb|EFH66943.1| hypothetical protein ARALYDRAFT_472815 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|255576521|ref|XP_002529152.1| conserved hypothetical protein [Ricinus communis] gi|223531431|gb|EEF33265.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|449519677|ref|XP_004166861.1| PREDICTED: mediator of RNA polymerase II transcription subunit 25-like, partial [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 833 | ||||||
| TAIR|locus:2031200 | 836 | PFT1 "PHYTOCHROME AND FLOWERIN | 0.794 | 0.791 | 0.622 | 1.6e-219 | |
| UNIPROTKB|F1N3D4 | 743 | MED25 "Mediator of RNA polymer | 0.154 | 0.173 | 0.328 | 2.3e-12 | |
| UNIPROTKB|F1RHT9 | 746 | MED25 "Uncharacterized protein | 0.154 | 0.172 | 0.328 | 6.4e-12 | |
| MGI|MGI:1922863 | 745 | Med25 "mediator of RNA polymer | 0.154 | 0.173 | 0.328 | 7.3e-12 | |
| UNIPROTKB|A2VE44 | 746 | MED25 "Mediator of RNA polymer | 0.154 | 0.172 | 0.328 | 7.3e-12 | |
| UNIPROTKB|Q71SY5 | 747 | MED25 "Mediator of RNA polymer | 0.154 | 0.172 | 0.328 | 3.1e-10 | |
| ZFIN|ZDB-GENE-040426-2850 | 701 | med25 "mediator of RNA polymer | 0.289 | 0.343 | 0.266 | 6.3e-10 | |
| DICTYBASE|DDB_G0286967 | 1553 | med25 "putative mediator compl | 0.145 | 0.077 | 0.276 | 8.6e-08 | |
| WB|WBGene00019435 | 2232 | K06A9.1 [Caenorhabditis elegan | 0.385 | 0.143 | 0.219 | 1.2e-05 | |
| FB|FBgn0038760 | 863 | MED25 "Mediator complex subuni | 0.214 | 0.207 | 0.225 | 2.6e-05 |
| TAIR|locus:2031200 PFT1 "PHYTOCHROME AND FLOWERING TIME 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 2080 (737.3 bits), Expect = 1.6e-219, Sum P(2) = 1.6e-219
Identities = 430/691 (62%), Positives = 513/691 (74%)
Query: 4 KQLIVAVEGTAAMGPYWQSIVSDYLEKIIRCFCVNELAGQTS-ASNVELSLVTFNTHGSY 62
KQLIV EGTAA+GPYWQ+IVSDYLEKIIR FC +EL G+ + S VELSLV FN+HGSY
Sbjct: 6 KQLIVVAEGTAALGPYWQTIVSDYLEKIIRSFCGSELNGERNPVSTVELSLVIFNSHGSY 65
Query: 63 CACLVQRSGWTKDVDIFLHWLSTIPFAGGGFNDAAIAEGLSEALMMFSVAPNGSQNQQNV 122
CACLVQRSGWT+DVDIFLHWLS+I F GGGFN+ A AEGL+EALMMFS P+G Q Q +
Sbjct: 66 CACLVQRSGWTRDVDIFLHWLSSIQFGGGGFNEVATAEGLAEALMMFS-PPSG-QAQPSN 123
Query: 123 DGQRHCILVAASNPHPLPTPVYRPQMQNLDQNENNEAQAESRLSDAETVAKSFVQCSVSL 182
D +RHCIL+ ASNPH LPTPVYRP++QN+++NEN +AQAESRLSDAETVA F +CSVSL
Sbjct: 124 DLKRHCILITASNPHILPTPVYRPRLQNVERNENGDAQAESRLSDAETVASYFAKCSVSL 183
Query: 183 SVICPKQLPKLTAIYNAAKRNPRAADPPVDNSKNPHFLVLISENFMEARAALSRPGVANL 242
SV+CPKQLP + A+YNA K N ++AD +D +KN +LVLISENF+EA AALS NL
Sbjct: 184 SVVCPKQLPTIRALYNAGKPNQQSADLSIDTAKNTFYLVLISENFVEACAALSH-SATNL 242
Query: 243 APNQNPVKMD---IAPVTSVTGPAPTSIPSVNGI--NRPPISVGNVPTATVKVEPSTVTS 297
Q+PVK+D +AP VTG P + S NG NR P+SVG VPTATVKVEPSTVTS
Sbjct: 243 PQTQSPVKVDRATVAPSIPVTGQPPAPVSSANGPIQNRQPVSVGPVPTATVKVEPSTVTS 302
Query: 298 MVNGPTFPHIPSVPRPASQGVXXXXXXXXXXXXXEMITSGDSVPEVKPLVSGMSQPLRPM 357
M P+FPHIP+V RPA+Q + +M+++ ++ P++KP+V P
Sbjct: 303 MAPVPSFPHIPAVARPATQAIPSIQTSSASPVSQDMVSNAENAPDIKPVVVSGMTPPLRT 362
Query: 358 APAAANVNILNNLSQARQVMN--NAALTGGTSIGLQSMGQTPMAMHMSNMISSGMASSVP 415
P N+ N L+ QV ++A G + S+GQ+ +AMHMSNMIS+GMA+S+P
Sbjct: 363 GPPGG-ANV-NLLNNLSQVRQVMSSAALAGAA---SSVGQSAVAMHMSNMISTGMATSLP 417
Query: 416 TSQPVFSSAQXXXXXXXXXXXXXXXXQVPQNSGLNSFTSAPSNLSGNSNPSISQPMGTLQ 475
SQ VFS+ Q Q Q+ G N+ S + + SN +SQPM
Sbjct: 418 PSQTVFSTGQQGITSMAGSGALMGSAQTGQSPGPNNAFSPQTTSNVASNLGVSQPMQ--- 474
Query: 476 GGASMGQSVGMSQGNHSGGQMVQNGISMNQNMMSGLGPSGVSSGTGTMIPTPGMSQQAQS 535
GM+QG+HSG M+Q GISMNQNMMSGLG VSSGTG M+PTPG+ QQAQS
Sbjct: 475 ---------GMNQGSHSGA-MMQGGISMNQNMMSGLGQGNVSSGTGGMMPTPGVGQQAQS 524
Query: 536 GMQPLSVNNNTAVNMQLSQQTSSALHSSQSKYVKVWEGSLSGQRQGQPVFITKLEGYRSA 595
G+Q L +N++A NMQLSQ +S A+ +SQSKYVKVWEG+LSGQRQGQPV IT+LEGYRSA
Sbjct: 525 GIQQLGGSNSSAPNMQLSQPSSGAMQTSQSKYVKVWEGNLSGQRQGQPVLITRLEGYRSA 584
Query: 596 SASETLAANWPPTMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKKLCAVI 655
SAS++LAANWPPTMQIVRLISQDHMNNKQYVGKADFLVFRAM+QHGFLGQLQ+KKLCAVI
Sbjct: 585 SASDSLAANWPPTMQIVRLISQDHMNNKQYVGKADFLVFRAMSQHGFLGQLQDKKLCAVI 644
Query: 656 QLPSQTLLLSVSDKACRLIGMLFPGDMVVFK 686
QLPSQTLLLSVSDKACRLIGMLFPGDMVVFK
Sbjct: 645 QLPSQTLLLSVSDKACRLIGMLFPGDMVVFK 675
|
|
| UNIPROTKB|F1N3D4 MED25 "Mediator of RNA polymerase II transcription subunit 25" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RHT9 MED25 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1922863 Med25 "mediator of RNA polymerase II transcription, subunit 25 homolog (yeast)" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A2VE44 MED25 "Mediator of RNA polymerase II transcription subunit 25" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q71SY5 MED25 "Mediator of RNA polymerase II transcription subunit 25" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040426-2850 med25 "mediator of RNA polymerase II transcription, subunit 25 homolog (yeast)" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0286967 med25 "putative mediator complex subunit 25" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00019435 K06A9.1 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0038760 MED25 "Mediator complex subunit 25" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| fgenesh4_pg.C_LG_X001175 | hypothetical protein (796 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 833 | |||
| pfam11265 | 226 | pfam11265, Med25_VWA, Mediator complex subunit 25 | 4e-67 | |
| pfam13779 | 820 | pfam13779, DUF4175, Domain of unknown function (DU | 1e-15 | |
| pfam13779 | 820 | pfam13779, DUF4175, Domain of unknown function (DU | 9e-15 | |
| pfam13779 | 820 | pfam13779, DUF4175, Domain of unknown function (DU | 2e-14 | |
| pfam09770 | 804 | pfam09770, PAT1, Topoisomerase II-associated prote | 2e-14 | |
| pfam09770 | 804 | pfam09770, PAT1, Topoisomerase II-associated prote | 3e-14 | |
| pfam09770 | 804 | pfam09770, PAT1, Topoisomerase II-associated prote | 5e-14 | |
| pfam09770 | 804 | pfam09770, PAT1, Topoisomerase II-associated prote | 2e-13 | |
| pfam09770 | 804 | pfam09770, PAT1, Topoisomerase II-associated prote | 3e-13 | |
| pfam13779 | 820 | pfam13779, DUF4175, Domain of unknown function (DU | 2e-12 | |
| pfam13779 | 820 | pfam13779, DUF4175, Domain of unknown function (DU | 6e-11 | |
| pfam09770 | 804 | pfam09770, PAT1, Topoisomerase II-associated prote | 8e-11 | |
| pfam09770 | 804 | pfam09770, PAT1, Topoisomerase II-associated prote | 9e-11 | |
| pfam13779 | 820 | pfam13779, DUF4175, Domain of unknown function (DU | 1e-10 | |
| pfam09770 | 804 | pfam09770, PAT1, Topoisomerase II-associated prote | 5e-10 | |
| pfam09606 | 768 | pfam09606, Med15, ARC105 or Med15 subunit of Media | 2e-09 | |
| pfam09606 | 768 | pfam09606, Med15, ARC105 or Med15 subunit of Media | 2e-09 | |
| pfam09606 | 768 | pfam09606, Med15, ARC105 or Med15 subunit of Media | 3e-09 | |
| pfam09770 | 804 | pfam09770, PAT1, Topoisomerase II-associated prote | 4e-09 | |
| PRK09510 | 387 | PRK09510, tolA, cell envelope integrity inner memb | 6e-09 | |
| pfam09606 | 768 | pfam09606, Med15, ARC105 or Med15 subunit of Media | 9e-09 | |
| pfam09606 | 768 | pfam09606, Med15, ARC105 or Med15 subunit of Media | 1e-08 | |
| COG3064 | 387 | COG3064, TolA, Membrane protein involved in colici | 1e-08 | |
| PRK00286 | 438 | PRK00286, xseA, exodeoxyribonuclease VII large sub | 1e-08 | |
| pfam11498 | 476 | pfam11498, Activator_LAG-3, Transcriptional activa | 1e-08 | |
| pfam09606 | 768 | pfam09606, Med15, ARC105 or Med15 subunit of Media | 2e-08 | |
| PRK00286 | 438 | PRK00286, xseA, exodeoxyribonuclease VII large sub | 3e-08 | |
| PRK09510 | 387 | PRK09510, tolA, cell envelope integrity inner memb | 5e-08 | |
| PRK10263 | 1355 | PRK10263, PRK10263, DNA translocase FtsK; Provisio | 8e-08 | |
| pfam09606 | 768 | pfam09606, Med15, ARC105 or Med15 subunit of Media | 1e-07 | |
| PRK00286 | 438 | PRK00286, xseA, exodeoxyribonuclease VII large sub | 2e-07 | |
| PRK00286 | 438 | PRK00286, xseA, exodeoxyribonuclease VII large sub | 2e-07 | |
| PRK12757 | 256 | PRK12757, PRK12757, cell division protein FtsN; Pr | 2e-07 | |
| pfam09606 | 768 | pfam09606, Med15, ARC105 or Med15 subunit of Media | 3e-07 | |
| pfam09770 | 804 | pfam09770, PAT1, Topoisomerase II-associated prote | 6e-07 | |
| pfam04702 | 147 | pfam04702, Vicilin_N, Vicilin N terminal region | 6e-07 | |
| PRK10263 | 1355 | PRK10263, PRK10263, DNA translocase FtsK; Provisio | 8e-07 | |
| smart00818 | 165 | smart00818, Amelogenin, Amelogenins, cell adhesion | 1e-06 | |
| COG1570 | 440 | COG1570, XseA, Exonuclease VII, large subunit [DNA | 2e-06 | |
| COG3264 | 835 | COG3264, COG3264, Small-conductance mechanosensiti | 2e-06 | |
| TIGR00618 | 1042 | TIGR00618, sbcc, exonuclease SbcC | 4e-06 | |
| pfam11498 | 476 | pfam11498, Activator_LAG-3, Transcriptional activa | 5e-06 | |
| COG3264 | 835 | COG3264, COG3264, Small-conductance mechanosensiti | 5e-06 | |
| pfam12128 | 1198 | pfam12128, DUF3584, Protein of unknown function (D | 5e-06 | |
| PRK04863 | 1486 | PRK04863, mukB, cell division protein MukB; Provis | 5e-06 | |
| PRK04863 | 1486 | PRK04863, mukB, cell division protein MukB; Provis | 5e-06 | |
| TIGR00237 | 432 | TIGR00237, xseA, exodeoxyribonuclease VII, large s | 5e-06 | |
| COG3064 | 387 | COG3064, TolA, Membrane protein involved in colici | 7e-06 | |
| PRK04863 | 1486 | PRK04863, mukB, cell division protein MukB; Provis | 7e-06 | |
| PRK06800 | 228 | PRK06800, fliH, flagellar assembly protein H; Vali | 7e-06 | |
| pfam11932 | 250 | pfam11932, DUF3450, Protein of unknown function (D | 8e-06 | |
| PRK10927 | 319 | PRK10927, PRK10927, essential cell division protei | 9e-06 | |
| smart00818 | 165 | smart00818, Amelogenin, Amelogenins, cell adhesion | 1e-05 | |
| PRK04863 | 1486 | PRK04863, mukB, cell division protein MukB; Provis | 1e-05 | |
| pfam02050 | 122 | pfam02050, FliJ, Flagellar FliJ protein | 1e-05 | |
| PRK03427 | 333 | PRK03427, PRK03427, cell division protein ZipA; Pr | 1e-05 | |
| PRK10246 | 1047 | PRK10246, PRK10246, exonuclease subunit SbcC; Prov | 1e-05 | |
| pfam11498 | 476 | pfam11498, Activator_LAG-3, Transcriptional activa | 2e-05 | |
| COG1570 | 440 | COG1570, XseA, Exonuclease VII, large subunit [DNA | 2e-05 | |
| PRK04863 | 1486 | PRK04863, mukB, cell division protein MukB; Provis | 2e-05 | |
| PRK10246 | 1047 | PRK10246, PRK10246, exonuclease subunit SbcC; Prov | 2e-05 | |
| TIGR04211 | 198 | TIGR04211, SH3_and_anchor, SH3 domain protein | 2e-05 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 2e-05 | |
| TIGR01628 | 562 | TIGR01628, PABP-1234, polyadenylate binding protei | 3e-05 | |
| pfam03280 | 189 | pfam03280, Lipase_chap, Proteobacterial lipase cha | 3e-05 | |
| PRK01294 | 336 | PRK01294, PRK01294, lipase chaperone; Provisional | 3e-05 | |
| PRK12757 | 256 | PRK12757, PRK12757, cell division protein FtsN; Pr | 4e-05 | |
| COG3264 | 835 | COG3264, COG3264, Small-conductance mechanosensiti | 4e-05 | |
| PRK10927 | 319 | PRK10927, PRK10927, essential cell division protei | 4e-05 | |
| PRK10927 | 319 | PRK10927, PRK10927, essential cell division protei | 4e-05 | |
| TIGR00618 | 1042 | TIGR00618, sbcc, exonuclease SbcC | 5e-05 | |
| pfam03153 | 332 | pfam03153, TFIIA, Transcription factor IIA, alpha/ | 5e-05 | |
| COG4372 | 499 | COG4372, COG4372, Uncharacterized protein conserve | 5e-05 | |
| PRK10246 | 1047 | PRK10246, PRK10246, exonuclease subunit SbcC; Prov | 6e-05 | |
| TIGR02473 | 141 | TIGR02473, flagell_FliJ, flagellar export protein | 6e-05 | |
| PRK09510 | 387 | PRK09510, tolA, cell envelope integrity inner memb | 7e-05 | |
| pfam13388 | 422 | pfam13388, DUF4106, Protein of unknown function (D | 7e-05 | |
| pfam11068 | 131 | pfam11068, DUF2869, Protein of unknown function (D | 8e-05 | |
| PRK09510 | 387 | PRK09510, tolA, cell envelope integrity inner memb | 9e-05 | |
| PRK10920 | 390 | PRK10920, PRK10920, putative uroporphyrinogen III | 9e-05 | |
| PRK10263 | 1355 | PRK10263, PRK10263, DNA translocase FtsK; Provisio | 1e-04 | |
| PRK12757 | 256 | PRK12757, PRK12757, cell division protein FtsN; Pr | 1e-04 | |
| pfam04702 | 147 | pfam04702, Vicilin_N, Vicilin N terminal region | 1e-04 | |
| pfam04702 | 147 | pfam04702, Vicilin_N, Vicilin N terminal region | 1e-04 | |
| TIGR00618 | 1042 | TIGR00618, sbcc, exonuclease SbcC | 1e-04 | |
| TIGR00237 | 432 | TIGR00237, xseA, exodeoxyribonuclease VII, large s | 1e-04 | |
| pfam02050 | 122 | pfam02050, FliJ, Flagellar FliJ protein | 1e-04 | |
| pfam03280 | 189 | pfam03280, Lipase_chap, Proteobacterial lipase cha | 1e-04 | |
| pfam03280 | 189 | pfam03280, Lipase_chap, Proteobacterial lipase cha | 1e-04 | |
| TIGR02473 | 141 | TIGR02473, flagell_FliJ, flagellar export protein | 1e-04 | |
| pfam11068 | 131 | pfam11068, DUF2869, Protein of unknown function (D | 1e-04 | |
| COG2959 | 391 | COG2959, HemX, Uncharacterized enzyme of heme bios | 1e-04 | |
| pfam12474 | 142 | pfam12474, PKK, Polo kinase kinase | 1e-04 | |
| COG1322 | 448 | COG1322, COG1322, Predicted nuclease of restrictio | 1e-04 | |
| PRK09510 | 387 | PRK09510, tolA, cell envelope integrity inner memb | 2e-04 | |
| PRK10263 | 1355 | PRK10263, PRK10263, DNA translocase FtsK; Provisio | 2e-04 | |
| TIGR00237 | 432 | TIGR00237, xseA, exodeoxyribonuclease VII, large s | 2e-04 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 2e-04 | |
| PRK11448 | 1123 | PRK11448, hsdR, type I restriction enzyme EcoKI su | 2e-04 | |
| PRK11281 | 1113 | PRK11281, PRK11281, hypothetical protein; Provisio | 2e-04 | |
| pfam13904 | 261 | pfam13904, DUF4207, Domain of unknown function (DU | 2e-04 | |
| COG3166 | 206 | COG3166, PilN, Tfp pilus assembly protein PilN [Ce | 2e-04 | |
| COG3166 | 206 | COG3166, PilN, Tfp pilus assembly protein PilN [Ce | 2e-04 | |
| pfam13868 | 349 | pfam13868, Trichoplein, Tumour suppressor, Mitosta | 2e-04 | |
| TIGR00618 | 1042 | TIGR00618, sbcc, exonuclease SbcC | 3e-04 | |
| pfam11932 | 250 | pfam11932, DUF3450, Protein of unknown function (D | 3e-04 | |
| PRK03427 | 333 | PRK03427, PRK03427, cell division protein ZipA; Pr | 3e-04 | |
| TIGR04211 | 198 | TIGR04211, SH3_and_anchor, SH3 domain protein | 3e-04 | |
| pfam12795 | 239 | pfam12795, MscS_porin, Mechanosensitive ion channe | 3e-04 | |
| COG3115 | 324 | COG3115, ZipA, Cell division protein [Cell divisio | 3e-04 | |
| PRK11637 | 428 | PRK11637, PRK11637, AmiB activator; Provisional | 3e-04 | |
| TIGR00618 | 1042 | TIGR00618, sbcc, exonuclease SbcC | 4e-04 | |
| PRK03427 | 333 | PRK03427, PRK03427, cell division protein ZipA; Pr | 4e-04 | |
| TIGR01628 | 562 | TIGR01628, PABP-1234, polyadenylate binding protei | 4e-04 | |
| COG2959 | 391 | COG2959, HemX, Uncharacterized enzyme of heme bios | 4e-04 | |
| pfam13868 | 349 | pfam13868, Trichoplein, Tumour suppressor, Mitosta | 4e-04 | |
| pfam12795 | 239 | pfam12795, MscS_porin, Mechanosensitive ion channe | 4e-04 | |
| pfam07223 | 357 | pfam07223, DUF1421, Protein of unknown function (D | 4e-04 | |
| PRK10246 | 1047 | PRK10246, PRK10246, exonuclease subunit SbcC; Prov | 5e-04 | |
| pfam11068 | 131 | pfam11068, DUF2869, Protein of unknown function (D | 5e-04 | |
| PRK10920 | 390 | PRK10920, PRK10920, putative uroporphyrinogen III | 5e-04 | |
| PRK10920 | 390 | PRK10920, PRK10920, putative uroporphyrinogen III | 5e-04 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 5e-04 | |
| pfam11068 | 131 | pfam11068, DUF2869, Protein of unknown function (D | 6e-04 | |
| pfam13868 | 349 | pfam13868, Trichoplein, Tumour suppressor, Mitosta | 6e-04 | |
| PRK03427 | 333 | PRK03427, PRK03427, cell division protein ZipA; Pr | 7e-04 | |
| pfam03153 | 332 | pfam03153, TFIIA, Transcription factor IIA, alpha/ | 7e-04 | |
| pfam03153 | 332 | pfam03153, TFIIA, Transcription factor IIA, alpha/ | 7e-04 | |
| PRK10920 | 390 | PRK10920, PRK10920, putative uroporphyrinogen III | 7e-04 | |
| PRK11281 | 1113 | PRK11281, PRK11281, hypothetical protein; Provisio | 7e-04 | |
| pfam13868 | 349 | pfam13868, Trichoplein, Tumour suppressor, Mitosta | 7e-04 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 7e-04 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 7e-04 | |
| TIGR02302 | 851 | TIGR02302, aProt_lowcomp, TIGR02302 family protein | 7e-04 | |
| pfam04702 | 147 | pfam04702, Vicilin_N, Vicilin N terminal region | 8e-04 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 8e-04 | |
| pfam13388 | 422 | pfam13388, DUF4106, Protein of unknown function (D | 8e-04 | |
| pfam12128 | 1198 | pfam12128, DUF3584, Protein of unknown function (D | 9e-04 | |
| pfam13388 | 422 | pfam13388, DUF4106, Protein of unknown function (D | 9e-04 | |
| PRK11637 | 428 | PRK11637, PRK11637, AmiB activator; Provisional | 9e-04 | |
| pfam12037 | 276 | pfam12037, DUF3523, Domain of unknown function (DU | 9e-04 | |
| smart00818 | 165 | smart00818, Amelogenin, Amelogenins, cell adhesion | 0.001 | |
| TIGR00618 | 1042 | TIGR00618, sbcc, exonuclease SbcC | 0.001 | |
| TIGR00237 | 432 | TIGR00237, xseA, exodeoxyribonuclease VII, large s | 0.001 | |
| pfam11932 | 250 | pfam11932, DUF3450, Protein of unknown function (D | 0.001 | |
| PRK10246 | 1047 | PRK10246, PRK10246, exonuclease subunit SbcC; Prov | 0.001 | |
| TIGR01628 | 562 | TIGR01628, PABP-1234, polyadenylate binding protei | 0.001 | |
| pfam13388 | 422 | pfam13388, DUF4106, Protein of unknown function (D | 0.001 | |
| PRK10920 | 390 | PRK10920, PRK10920, putative uroporphyrinogen III | 0.001 | |
| PRK11281 | 1113 | PRK11281, PRK11281, hypothetical protein; Provisio | 0.001 | |
| pfam13868 | 349 | pfam13868, Trichoplein, Tumour suppressor, Mitosta | 0.001 | |
| pfam12037 | 276 | pfam12037, DUF3523, Domain of unknown function (DU | 0.001 | |
| pfam11180 | 192 | pfam11180, DUF2968, Protein of unknown function (D | 0.001 | |
| pfam03938 | 157 | pfam03938, OmpH, Outer membrane protein (OmpH-like | 0.001 | |
| pfam03938 | 157 | pfam03938, OmpH, Outer membrane protein (OmpH-like | 0.001 | |
| PRK01741 | 332 | PRK01741, PRK01741, cell division protein ZipA; Pr | 0.001 | |
| COG0845 | 372 | COG0845, AcrA, Membrane-fusion protein [Cell envel | 0.001 | |
| TIGR01843 | 423 | TIGR01843, type_I_hlyD, type I secretion membrane | 0.001 | |
| COG5380 | 283 | COG5380, LimK, Lipase chaperone [Posttranslational | 0.001 | |
| COG3064 | 387 | COG3064, TolA, Membrane protein involved in colici | 0.002 | |
| TIGR00618 | 1042 | TIGR00618, sbcc, exonuclease SbcC | 0.002 | |
| pfam02050 | 122 | pfam02050, FliJ, Flagellar FliJ protein | 0.002 | |
| TIGR04211 | 198 | TIGR04211, SH3_and_anchor, SH3 domain protein | 0.002 | |
| PRK01294 | 336 | PRK01294, PRK01294, lipase chaperone; Provisional | 0.002 | |
| PRK01294 | 336 | PRK01294, PRK01294, lipase chaperone; Provisional | 0.002 | |
| pfam13388 | 422 | pfam13388, DUF4106, Protein of unknown function (D | 0.002 | |
| pfam13388 | 422 | pfam13388, DUF4106, Protein of unknown function (D | 0.002 | |
| pfam13388 | 422 | pfam13388, DUF4106, Protein of unknown function (D | 0.002 | |
| PRK11448 | 1123 | PRK11448, hsdR, type I restriction enzyme EcoKI su | 0.002 | |
| PRK11281 | 1113 | PRK11281, PRK11281, hypothetical protein; Provisio | 0.002 | |
| pfam13868 | 349 | pfam13868, Trichoplein, Tumour suppressor, Mitosta | 0.002 | |
| pfam07223 | 357 | pfam07223, DUF1421, Protein of unknown function (D | 0.002 | |
| TIGR02302 | 851 | TIGR02302, aProt_lowcomp, TIGR02302 family protein | 0.002 | |
| PRK12704 | 520 | PRK12704, PRK12704, phosphodiesterase; Provisional | 0.002 | |
| pfam07321 | 152 | pfam07321, YscO, Type III secretion protein YscO | 0.002 | |
| PRK11147 | 635 | PRK11147, PRK11147, ABC transporter ATPase compone | 0.002 | |
| pfam04375 | 372 | pfam04375, HemX, HemX | 0.002 | |
| COG1570 | 440 | COG1570, XseA, Exonuclease VII, large subunit [DNA | 0.003 | |
| TIGR00618 | 1042 | TIGR00618, sbcc, exonuclease SbcC | 0.003 | |
| pfam12128 | 1198 | pfam12128, DUF3584, Protein of unknown function (D | 0.003 | |
| PRK10246 | 1047 | PRK10246, PRK10246, exonuclease subunit SbcC; Prov | 0.003 | |
| pfam03153 | 332 | pfam03153, TFIIA, Transcription factor IIA, alpha/ | 0.003 | |
| PRK11281 | 1113 | PRK11281, PRK11281, hypothetical protein; Provisio | 0.003 | |
| COG3166 | 206 | COG3166, PilN, Tfp pilus assembly protein PilN [Ce | 0.003 | |
| pfam13868 | 349 | pfam13868, Trichoplein, Tumour suppressor, Mitosta | 0.003 | |
| TIGR02302 | 851 | TIGR02302, aProt_lowcomp, TIGR02302 family protein | 0.003 | |
| pfam07321 | 152 | pfam07321, YscO, Type III secretion protein YscO | 0.003 | |
| pfam07321 | 152 | pfam07321, YscO, Type III secretion protein YscO | 0.003 | |
| COG4942 | 420 | COG4942, COG4942, Membrane-bound metallopeptidase | 0.003 | |
| pfam12203 | 92 | pfam12203, HDAC4_Gln, Glutamine rich N terminal do | 0.003 | |
| COG4487 | 438 | COG4487, COG4487, Uncharacterized protein conserve | 0.003 | |
| PRK00286 | 438 | PRK00286, xseA, exodeoxyribonuclease VII large sub | 0.004 | |
| smart00818 | 165 | smart00818, Amelogenin, Amelogenins, cell adhesion | 0.004 | |
| pfam13388 | 422 | pfam13388, DUF4106, Protein of unknown function (D | 0.004 | |
| pfam13868 | 349 | pfam13868, Trichoplein, Tumour suppressor, Mitosta | 0.004 | |
| COG3115 | 324 | COG3115, ZipA, Cell division protein [Cell divisio | 0.004 | |
| PRK01741 | 332 | PRK01741, PRK01741, cell division protein ZipA; Pr | 0.004 | |
| COG5380 | 283 | COG5380, LimK, Lipase chaperone [Posttranslational | 0.004 |
| >gnl|CDD|221051 pfam11265, Med25_VWA, Mediator complex subunit 25 von Willebrand factor type A | Back alignment and domain information |
|---|
Score = 222 bits (567), Expect = 4e-67
Identities = 77/230 (33%), Positives = 109/230 (47%), Gaps = 21/230 (9%)
Query: 3 EKQLIVAVEGTAAMGPYWQSIVSDYLEKIIRCFCVNELAGQ---TSASNVELSLVTFNTH 59
++ +EGTA +GPY++++ ++Y+ II F A + SLV FNT
Sbjct: 13 VADVVFVIEGTANLGPYFETLKTNYILPIIEYFNGGPPAETDFGGEYGGTQYSLVVFNTV 72
Query: 60 GSYCACLVQRSGWTKDVDIFLHWLSTIPFAGGGFNDAA-IAEGLSEALMMFSVAPNGSQN 118
S VQ G T+DVD FLHWL +I F GGG + IAEGL+EAL +F Q
Sbjct: 73 ASAPESYVQCHGPTRDVDEFLHWLDSIQFMGGGGESCSLIAEGLAEALQLFDDFSEMRQQ 132
Query: 119 QQNVDGQRHCILVAASNPHPLPTPVYRPQMQNLDQNENNEAQAESRLSDAETVAKSFVQC 178
D RHCIL+ S P+ LPT A E + SD +
Sbjct: 133 IGQTDLHRHCILICNSPPYLLPT--------------VESASYEGKTSDQLAAI--IYER 176
Query: 179 SVSLSVICPKQLPKLTAIYNAAKRN-PRAADPPVDNSKNPHFLVLISENF 227
+ LS+I P++LP L ++ AK + +D +KNP +VL+ F
Sbjct: 177 GIHLSIIAPRKLPALRLLFEKAKPDQQLPMKSSIDYAKNPFHMVLLRGIF 226
|
The overall function of the full-length Med25 is efficiently to coordinate the transcriptional activation of RAR/RXR (retinoic acid receptor/retinoic X receptor) in higher eukaryotic cells. Human Med25 consists of several domains with different binding properties, the N-terminal, VWA domain which is this one, an SD2 domain from residues 229-381, a PTOV(B) or ACID domain from 395-545, an SD2 domain from residues 564-645 and a C-terminal NR box-containing domain (646-650) from 646-747. This VWA or von Willebrand factor type A domain when bound to RAR and the histone acetyltransferase CBP is responsible for recruiting Med1 to the rest of the Mediator complex. Length = 226 |
| >gnl|CDD|222374 pfam13779, DUF4175, Domain of unknown function (DUF4175) | Back alignment and domain information |
|---|
| >gnl|CDD|222374 pfam13779, DUF4175, Domain of unknown function (DUF4175) | Back alignment and domain information |
|---|
| >gnl|CDD|222374 pfam13779, DUF4175, Domain of unknown function (DUF4175) | Back alignment and domain information |
|---|
| >gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 | Back alignment and domain information |
|---|
| >gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 | Back alignment and domain information |
|---|
| >gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 | Back alignment and domain information |
|---|
| >gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 | Back alignment and domain information |
|---|
| >gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 | Back alignment and domain information |
|---|
| >gnl|CDD|222374 pfam13779, DUF4175, Domain of unknown function (DUF4175) | Back alignment and domain information |
|---|
| >gnl|CDD|222374 pfam13779, DUF4175, Domain of unknown function (DUF4175) | Back alignment and domain information |
|---|
| >gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 | Back alignment and domain information |
|---|
| >gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 | Back alignment and domain information |
|---|
| >gnl|CDD|222374 pfam13779, DUF4175, Domain of unknown function (DUF4175) | Back alignment and domain information |
|---|
| >gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 | Back alignment and domain information |
|---|
| >gnl|CDD|220309 pfam09606, Med15, ARC105 or Med15 subunit of Mediator complex non-fungal | Back alignment and domain information |
|---|
| >gnl|CDD|220309 pfam09606, Med15, ARC105 or Med15 subunit of Mediator complex non-fungal | Back alignment and domain information |
|---|
| >gnl|CDD|220309 pfam09606, Med15, ARC105 or Med15 subunit of Mediator complex non-fungal | Back alignment and domain information |
|---|
| >gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 | Back alignment and domain information |
|---|
| >gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220309 pfam09606, Med15, ARC105 or Med15 subunit of Mediator complex non-fungal | Back alignment and domain information |
|---|
| >gnl|CDD|220309 pfam09606, Med15, ARC105 or Med15 subunit of Mediator complex non-fungal | Back alignment and domain information |
|---|
| >gnl|CDD|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|234714 PRK00286, xseA, exodeoxyribonuclease VII large subunit; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|151935 pfam11498, Activator_LAG-3, Transcriptional activator LAG-3 | Back alignment and domain information |
|---|
| >gnl|CDD|220309 pfam09606, Med15, ARC105 or Med15 subunit of Mediator complex non-fungal | Back alignment and domain information |
|---|
| >gnl|CDD|234714 PRK00286, xseA, exodeoxyribonuclease VII large subunit; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236669 PRK10263, PRK10263, DNA translocase FtsK; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220309 pfam09606, Med15, ARC105 or Med15 subunit of Mediator complex non-fungal | Back alignment and domain information |
|---|
| >gnl|CDD|234714 PRK00286, xseA, exodeoxyribonuclease VII large subunit; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|234714 PRK00286, xseA, exodeoxyribonuclease VII large subunit; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237191 PRK12757, PRK12757, cell division protein FtsN; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220309 pfam09606, Med15, ARC105 or Med15 subunit of Mediator complex non-fungal | Back alignment and domain information |
|---|
| >gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 | Back alignment and domain information |
|---|
| >gnl|CDD|218218 pfam04702, Vicilin_N, Vicilin N terminal region | Back alignment and domain information |
|---|
| >gnl|CDD|236669 PRK10263, PRK10263, DNA translocase FtsK; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|197891 smart00818, Amelogenin, Amelogenins, cell adhesion proteins, play a role in the biomineralisation of teeth | Back alignment and domain information |
|---|
| >gnl|CDD|224486 COG1570, XseA, Exonuclease VII, large subunit [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|225803 COG3264, COG3264, Small-conductance mechanosensitive channel [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|129705 TIGR00618, sbcc, exonuclease SbcC | Back alignment and domain information |
|---|
| >gnl|CDD|151935 pfam11498, Activator_LAG-3, Transcriptional activator LAG-3 | Back alignment and domain information |
|---|
| >gnl|CDD|225803 COG3264, COG3264, Small-conductance mechanosensitive channel [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|221432 pfam12128, DUF3584, Protein of unknown function (DUF3584) | Back alignment and domain information |
|---|
| >gnl|CDD|235316 PRK04863, mukB, cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235316 PRK04863, mukB, cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|161783 TIGR00237, xseA, exodeoxyribonuclease VII, large subunit | Back alignment and domain information |
|---|
| >gnl|CDD|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|235316 PRK04863, mukB, cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180700 PRK06800, fliH, flagellar assembly protein H; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|204784 pfam11932, DUF3450, Protein of unknown function (DUF3450) | Back alignment and domain information |
|---|
| >gnl|CDD|236797 PRK10927, PRK10927, essential cell division protein FtsN; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|197891 smart00818, Amelogenin, Amelogenins, cell adhesion proteins, play a role in the biomineralisation of teeth | Back alignment and domain information |
|---|
| >gnl|CDD|235316 PRK04863, mukB, cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|202101 pfam02050, FliJ, Flagellar FliJ protein | Back alignment and domain information |
|---|
| >gnl|CDD|235124 PRK03427, PRK03427, cell division protein ZipA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182330 PRK10246, PRK10246, exonuclease subunit SbcC; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|151935 pfam11498, Activator_LAG-3, Transcriptional activator LAG-3 | Back alignment and domain information |
|---|
| >gnl|CDD|224486 COG1570, XseA, Exonuclease VII, large subunit [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|235316 PRK04863, mukB, cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182330 PRK10246, PRK10246, exonuclease subunit SbcC; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234501 TIGR04211, SH3_and_anchor, SH3 domain protein | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family | Back alignment and domain information |
|---|
| >gnl|CDD|217472 pfam03280, Lipase_chap, Proteobacterial lipase chaperone protein | Back alignment and domain information |
|---|
| >gnl|CDD|234937 PRK01294, PRK01294, lipase chaperone; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237191 PRK12757, PRK12757, cell division protein FtsN; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225803 COG3264, COG3264, Small-conductance mechanosensitive channel [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|236797 PRK10927, PRK10927, essential cell division protein FtsN; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236797 PRK10927, PRK10927, essential cell division protein FtsN; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|129705 TIGR00618, sbcc, exonuclease SbcC | Back alignment and domain information |
|---|
| >gnl|CDD|217392 pfam03153, TFIIA, Transcription factor IIA, alpha/beta subunit | Back alignment and domain information |
|---|
| >gnl|CDD|226809 COG4372, COG4372, Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|182330 PRK10246, PRK10246, exonuclease subunit SbcC; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|131526 TIGR02473, flagell_FliJ, flagellar export protein FliJ | Back alignment and domain information |
|---|
| >gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222095 pfam13388, DUF4106, Protein of unknown function (DUF4106) | Back alignment and domain information |
|---|
| >gnl|CDD|220964 pfam11068, DUF2869, Protein of unknown function (DUF2869) | Back alignment and domain information |
|---|
| >gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236795 PRK10920, PRK10920, putative uroporphyrinogen III C-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236669 PRK10263, PRK10263, DNA translocase FtsK; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237191 PRK12757, PRK12757, cell division protein FtsN; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218218 pfam04702, Vicilin_N, Vicilin N terminal region | Back alignment and domain information |
|---|
| >gnl|CDD|218218 pfam04702, Vicilin_N, Vicilin N terminal region | Back alignment and domain information |
|---|
| >gnl|CDD|129705 TIGR00618, sbcc, exonuclease SbcC | Back alignment and domain information |
|---|
| >gnl|CDD|161783 TIGR00237, xseA, exodeoxyribonuclease VII, large subunit | Back alignment and domain information |
|---|
| >gnl|CDD|202101 pfam02050, FliJ, Flagellar FliJ protein | Back alignment and domain information |
|---|
| >gnl|CDD|217472 pfam03280, Lipase_chap, Proteobacterial lipase chaperone protein | Back alignment and domain information |
|---|
| >gnl|CDD|217472 pfam03280, Lipase_chap, Proteobacterial lipase chaperone protein | Back alignment and domain information |
|---|
| >gnl|CDD|131526 TIGR02473, flagell_FliJ, flagellar export protein FliJ | Back alignment and domain information |
|---|
| >gnl|CDD|220964 pfam11068, DUF2869, Protein of unknown function (DUF2869) | Back alignment and domain information |
|---|
| >gnl|CDD|225507 COG2959, HemX, Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|204935 pfam12474, PKK, Polo kinase kinase | Back alignment and domain information |
|---|
| >gnl|CDD|224241 COG1322, COG1322, Predicted nuclease of restriction endonuclease-like fold, RmuC family [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236669 PRK10263, PRK10263, DNA translocase FtsK; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|161783 TIGR00237, xseA, exodeoxyribonuclease VII, large subunit | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|236912 PRK11448, hsdR, type I restriction enzyme EcoKI subunit R; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236892 PRK11281, PRK11281, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222447 pfam13904, DUF4207, Domain of unknown function (DUF4207) | Back alignment and domain information |
|---|
| >gnl|CDD|225707 COG3166, PilN, Tfp pilus assembly protein PilN [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >gnl|CDD|225707 COG3166, PilN, Tfp pilus assembly protein PilN [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin | Back alignment and domain information |
|---|
| >gnl|CDD|129705 TIGR00618, sbcc, exonuclease SbcC | Back alignment and domain information |
|---|
| >gnl|CDD|204784 pfam11932, DUF3450, Protein of unknown function (DUF3450) | Back alignment and domain information |
|---|
| >gnl|CDD|235124 PRK03427, PRK03427, cell division protein ZipA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234501 TIGR04211, SH3_and_anchor, SH3 domain protein | Back alignment and domain information |
|---|
| >gnl|CDD|221776 pfam12795, MscS_porin, Mechanosensitive ion channel porin domain | Back alignment and domain information |
|---|
| >gnl|CDD|225657 COG3115, ZipA, Cell division protein [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|236942 PRK11637, PRK11637, AmiB activator; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|129705 TIGR00618, sbcc, exonuclease SbcC | Back alignment and domain information |
|---|
| >gnl|CDD|235124 PRK03427, PRK03427, cell division protein ZipA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family | Back alignment and domain information |
|---|
| >gnl|CDD|225507 COG2959, HemX, Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin | Back alignment and domain information |
|---|
| >gnl|CDD|221776 pfam12795, MscS_porin, Mechanosensitive ion channel porin domain | Back alignment and domain information |
|---|
| >gnl|CDD|219339 pfam07223, DUF1421, Protein of unknown function (DUF1421) | Back alignment and domain information |
|---|
| >gnl|CDD|182330 PRK10246, PRK10246, exonuclease subunit SbcC; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220964 pfam11068, DUF2869, Protein of unknown function (DUF2869) | Back alignment and domain information |
|---|
| >gnl|CDD|236795 PRK10920, PRK10920, putative uroporphyrinogen III C-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236795 PRK10920, PRK10920, putative uroporphyrinogen III C-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|220964 pfam11068, DUF2869, Protein of unknown function (DUF2869) | Back alignment and domain information |
|---|
| >gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin | Back alignment and domain information |
|---|
| >gnl|CDD|235124 PRK03427, PRK03427, cell division protein ZipA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217392 pfam03153, TFIIA, Transcription factor IIA, alpha/beta subunit | Back alignment and domain information |
|---|
| >gnl|CDD|217392 pfam03153, TFIIA, Transcription factor IIA, alpha/beta subunit | Back alignment and domain information |
|---|
| >gnl|CDD|236795 PRK10920, PRK10920, putative uroporphyrinogen III C-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236892 PRK11281, PRK11281, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|233816 TIGR02302, aProt_lowcomp, TIGR02302 family protein | Back alignment and domain information |
|---|
| >gnl|CDD|218218 pfam04702, Vicilin_N, Vicilin N terminal region | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|222095 pfam13388, DUF4106, Protein of unknown function (DUF4106) | Back alignment and domain information |
|---|
| >gnl|CDD|221432 pfam12128, DUF3584, Protein of unknown function (DUF3584) | Back alignment and domain information |
|---|
| >gnl|CDD|222095 pfam13388, DUF4106, Protein of unknown function (DUF4106) | Back alignment and domain information |
|---|
| >gnl|CDD|236942 PRK11637, PRK11637, AmiB activator; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|221389 pfam12037, DUF3523, Domain of unknown function (DUF3523) | Back alignment and domain information |
|---|
| >gnl|CDD|197891 smart00818, Amelogenin, Amelogenins, cell adhesion proteins, play a role in the biomineralisation of teeth | Back alignment and domain information |
|---|
| >gnl|CDD|129705 TIGR00618, sbcc, exonuclease SbcC | Back alignment and domain information |
|---|
| >gnl|CDD|161783 TIGR00237, xseA, exodeoxyribonuclease VII, large subunit | Back alignment and domain information |
|---|
| >gnl|CDD|204784 pfam11932, DUF3450, Protein of unknown function (DUF3450) | Back alignment and domain information |
|---|
| >gnl|CDD|182330 PRK10246, PRK10246, exonuclease subunit SbcC; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family | Back alignment and domain information |
|---|
| >gnl|CDD|222095 pfam13388, DUF4106, Protein of unknown function (DUF4106) | Back alignment and domain information |
|---|
| >gnl|CDD|236795 PRK10920, PRK10920, putative uroporphyrinogen III C-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236892 PRK11281, PRK11281, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin | Back alignment and domain information |
|---|
| >gnl|CDD|221389 pfam12037, DUF3523, Domain of unknown function (DUF3523) | Back alignment and domain information |
|---|
| >gnl|CDD|221016 pfam11180, DUF2968, Protein of unknown function (DUF2968) | Back alignment and domain information |
|---|
| >gnl|CDD|217803 pfam03938, OmpH, Outer membrane protein (OmpH-like) | Back alignment and domain information |
|---|
| >gnl|CDD|217803 pfam03938, OmpH, Outer membrane protein (OmpH-like) | Back alignment and domain information |
|---|
| >gnl|CDD|234977 PRK01741, PRK01741, cell division protein ZipA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223914 COG0845, AcrA, Membrane-fusion protein [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|130902 TIGR01843, type_I_hlyD, type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >gnl|CDD|227671 COG5380, LimK, Lipase chaperone [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|129705 TIGR00618, sbcc, exonuclease SbcC | Back alignment and domain information |
|---|
| >gnl|CDD|202101 pfam02050, FliJ, Flagellar FliJ protein | Back alignment and domain information |
|---|
| >gnl|CDD|234501 TIGR04211, SH3_and_anchor, SH3 domain protein | Back alignment and domain information |
|---|
| >gnl|CDD|234937 PRK01294, PRK01294, lipase chaperone; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234937 PRK01294, PRK01294, lipase chaperone; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222095 pfam13388, DUF4106, Protein of unknown function (DUF4106) | Back alignment and domain information |
|---|
| >gnl|CDD|222095 pfam13388, DUF4106, Protein of unknown function (DUF4106) | Back alignment and domain information |
|---|
| >gnl|CDD|222095 pfam13388, DUF4106, Protein of unknown function (DUF4106) | Back alignment and domain information |
|---|
| >gnl|CDD|236912 PRK11448, hsdR, type I restriction enzyme EcoKI subunit R; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236892 PRK11281, PRK11281, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin | Back alignment and domain information |
|---|
| >gnl|CDD|219339 pfam07223, DUF1421, Protein of unknown function (DUF1421) | Back alignment and domain information |
|---|
| >gnl|CDD|233816 TIGR02302, aProt_lowcomp, TIGR02302 family protein | Back alignment and domain information |
|---|
| >gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|148750 pfam07321, YscO, Type III secretion protein YscO | Back alignment and domain information |
|---|
| >gnl|CDD|236861 PRK11147, PRK11147, ABC transporter ATPase component; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|113156 pfam04375, HemX, HemX | Back alignment and domain information |
|---|
| >gnl|CDD|224486 COG1570, XseA, Exonuclease VII, large subunit [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|129705 TIGR00618, sbcc, exonuclease SbcC | Back alignment and domain information |
|---|
| >gnl|CDD|221432 pfam12128, DUF3584, Protein of unknown function (DUF3584) | Back alignment and domain information |
|---|
| >gnl|CDD|182330 PRK10246, PRK10246, exonuclease subunit SbcC; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217392 pfam03153, TFIIA, Transcription factor IIA, alpha/beta subunit | Back alignment and domain information |
|---|
| >gnl|CDD|236892 PRK11281, PRK11281, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225707 COG3166, PilN, Tfp pilus assembly protein PilN [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin | Back alignment and domain information |
|---|
| >gnl|CDD|233816 TIGR02302, aProt_lowcomp, TIGR02302 family protein | Back alignment and domain information |
|---|
| >gnl|CDD|148750 pfam07321, YscO, Type III secretion protein YscO | Back alignment and domain information |
|---|
| >gnl|CDD|148750 pfam07321, YscO, Type III secretion protein YscO | Back alignment and domain information |
|---|
| >gnl|CDD|227278 COG4942, COG4942, Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|204848 pfam12203, HDAC4_Gln, Glutamine rich N terminal domain of histone deacetylase 4 | Back alignment and domain information |
|---|
| >gnl|CDD|226889 COG4487, COG4487, Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|234714 PRK00286, xseA, exodeoxyribonuclease VII large subunit; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|197891 smart00818, Amelogenin, Amelogenins, cell adhesion proteins, play a role in the biomineralisation of teeth | Back alignment and domain information |
|---|
| >gnl|CDD|222095 pfam13388, DUF4106, Protein of unknown function (DUF4106) | Back alignment and domain information |
|---|
| >gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin | Back alignment and domain information |
|---|
| >gnl|CDD|225657 COG3115, ZipA, Cell division protein [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|234977 PRK01741, PRK01741, cell division protein ZipA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227671 COG5380, LimK, Lipase chaperone [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 833 | |||
| PF11265 | 226 | Med25_VWA: Mediator complex subunit 25 von Willebr | 100.0 | |
| cd01480 | 186 | vWA_collagen_alpha_1-VI-type VWA_collagen alpha(VI | 99.12 | |
| cd01472 | 164 | vWA_collagen von Willebrand factor (vWF) type A do | 99.02 | |
| PF13519 | 172 | VWA_2: von Willebrand factor type A domain; PDB: 3 | 99.01 | |
| cd01450 | 161 | vWFA_subfamily_ECM Von Willebrand factor type A (v | 99.0 | |
| cd01481 | 165 | vWA_collagen_alpha3-VI-like VWA_collagen alpha 3(V | 98.99 | |
| cd01482 | 164 | vWA_collagen_alphaI-XII-like Collagen: The extrace | 98.97 | |
| cd01469 | 177 | vWA_integrins_alpha_subunit Integrins are a class | 98.94 | |
| cd01473 | 192 | vWA_CTRP CTRP for CS protein-TRAP-related protein: | 98.9 | |
| cd01474 | 185 | vWA_ATR ATR (Anthrax Toxin Receptor): Anthrax toxi | 98.85 | |
| cd01453 | 183 | vWA_transcription_factor_IIH_type Transcription fa | 98.83 | |
| cd01475 | 224 | vWA_Matrilin VWA_Matrilin: In cartilaginous plate, | 98.79 | |
| cd01476 | 163 | VWA_integrin_invertebrates VWA_integrin (invertebr | 98.79 | |
| cd01477 | 193 | vWA_F09G8-8_type VWA F09G8.8 type: Von Willebrand | 98.68 | |
| PF00092 | 178 | VWA: von Willebrand factor type A domain; InterPro | 98.66 | |
| cd01471 | 186 | vWA_micronemal_protein Micronemal proteins: The To | 98.66 | |
| cd00198 | 161 | vWFA Von Willebrand factor type A (vWA) domain was | 98.57 | |
| smart00187 | 423 | INB Integrin beta subunits (N-terminal portion of | 98.47 | |
| cd01467 | 180 | vWA_BatA_type VWA BatA type: Von Willebrand factor | 98.45 | |
| cd01452 | 187 | VWA_26S_proteasome_subunit 26S proteasome plays a | 98.41 | |
| PF13768 | 155 | VWA_3: von Willebrand factor type A domain | 98.36 | |
| smart00327 | 177 | VWA von Willebrand factor (vWF) type A domain. VWA | 98.35 | |
| cd01463 | 190 | vWA_VGCC_like VWA Voltage gated Calcium channel li | 98.34 | |
| COG1240 | 261 | ChlD Mg-chelatase subunit ChlD [Coenzyme metabolis | 98.34 | |
| cd01456 | 206 | vWA_ywmD_type VWA ywmD type:Von Willebrand factor | 98.33 | |
| cd01470 | 198 | vWA_complement_factors Complement factors B and C2 | 98.32 | |
| PTZ00441 | 576 | sporozoite surface protein 2 (SSP2); Provisional | 98.29 | |
| PRK13685 | 326 | hypothetical protein; Provisional | 98.27 | |
| cd01465 | 170 | vWA_subgroup VWA subgroup: Von Willebrand factor t | 98.25 | |
| cd01454 | 174 | vWA_norD_type norD type: Denitrifying bacteria con | 98.17 | |
| cd01451 | 178 | vWA_Magnesium_chelatase Magnesium chelatase: Mg-ch | 98.16 | |
| TIGR03436 | 296 | acidobact_VWFA VWFA-related Acidobacterial domain. | 98.15 | |
| cd01461 | 171 | vWA_interalpha_trypsin_inhibitor vWA_interalpha tr | 98.14 | |
| cd01466 | 155 | vWA_C3HC4_type VWA C3HC4-type: Von Willebrand fact | 98.13 | |
| cd01464 | 176 | vWA_subfamily VWA subfamily: Von Willebrand factor | 98.13 | |
| cd01458 | 218 | vWA_ku Ku70/Ku80 N-terminal domain. The Ku78 heter | 98.03 | |
| PRK13406 | 584 | bchD magnesium chelatase subunit D; Provisional | 98.0 | |
| TIGR02031 | 589 | BchD-ChlD magnesium chelatase ATPase subunit D. Th | 97.96 | |
| cd01462 | 152 | VWA_YIEM_type VWA YIEM type: Von Willebrand factor | 97.82 | |
| TIGR02442 | 633 | Cob-chelat-sub cobaltochelatase subunit. A number | 97.78 | |
| PF00362 | 426 | Integrin_beta: Integrin, beta chain; InterPro: IPR | 97.77 | |
| TIGR00868 | 863 | hCaCC calcium-activated chloride channel protein 1 | 97.58 | |
| cd01460 | 266 | vWA_midasin VWA_Midasin: Midasin is a member of th | 97.57 | |
| TIGR03788 | 596 | marine_srt_targ marine proteobacterial sortase tar | 97.53 | |
| PF03731 | 224 | Ku_N: Ku70/Ku80 N-terminal alpha/beta domain; Inte | 97.44 | |
| PF04056 | 193 | Ssl1: Ssl1-like; InterPro: IPR007198 Ssl1-like pro | 97.28 | |
| cd01455 | 191 | vWA_F11C1-5a_type Von Willebrand factor type A (vW | 97.22 | |
| cd01457 | 199 | vWA_ORF176_type VWA ORF176 type: Von Willebrand fa | 97.18 | |
| COG4245 | 207 | TerY Uncharacterized protein encoded in toxicity p | 97.03 | |
| PF04811 | 243 | Sec23_trunk: Sec23/Sec24 trunk domain; InterPro: I | 96.95 | |
| KOG3598 | 2220 | consensus Thyroid hormone receptor-associated prot | 96.81 | |
| cd01468 | 239 | trunk_domain trunk domain. COPII-coated vesicles c | 96.14 | |
| KOG3598 | 2220 | consensus Thyroid hormone receptor-associated prot | 95.93 | |
| TIGR00578 | 584 | ku70 ATP-dependent DNA helicase ii, 70 kDa subunit | 95.91 | |
| cd01479 | 244 | Sec24-like Sec24-like: Protein and membrane traffi | 95.74 | |
| PF11498 | 468 | Activator_LAG-3: Transcriptional activator LAG-3; | 94.54 | |
| KOG2807 | 378 | consensus RNA polymerase II transcription initiati | 94.08 | |
| PF05762 | 222 | VWA_CoxE: VWA domain containing CoxE-like protein; | 93.92 | |
| PF06707 | 205 | DUF1194: Protein of unknown function (DUF1194); In | 93.75 | |
| PRK10997 | 487 | yieM hypothetical protein; Provisional | 93.16 | |
| COG5148 | 243 | RPN10 26S proteasome regulatory complex, subunit R | 92.3 | |
| cd01478 | 267 | Sec23-like Sec23-like: Protein and membrane traffi | 91.85 | |
| PF10138 | 200 | vWA-TerF-like: vWA found in TerF C terminus ; Inte | 91.5 | |
| KOG1226 | 783 | consensus Integrin beta subunit (N-terminal portio | 91.32 | |
| PF11235 | 168 | Med25_SD1: Mediator complex subunit 25 synapsin 1; | 91.2 | |
| KOG1984 | 1007 | consensus Vesicle coat complex COPII, subunit SFB3 | 90.83 | |
| PTZ00395 | 1560 | Sec24-related protein; Provisional | 89.2 | |
| PLN00162 | 761 | transport protein sec23; Provisional | 86.65 | |
| KOG2884 | 259 | consensus 26S proteasome regulatory complex, subun | 86.61 | |
| KOG2353 | 1104 | consensus L-type voltage-dependent Ca2+ channel, a | 86.06 | |
| COG5151 | 421 | SSL1 RNA polymerase II transcription initiation/nu | 86.05 | |
| TIGR00627 | 279 | tfb4 transcription factor tfb4. This family is bas | 86.02 | |
| PF09967 | 126 | DUF2201: VWA-like domain (DUF2201); InterPro: IPR0 | 85.61 | |
| COG2425 | 437 | Uncharacterized protein containing a von Willebran | 81.08 | |
| PF03850 | 276 | Tfb4: Transcription factor Tfb4; InterPro: IPR0046 | 80.11 |
| >PF11265 Med25_VWA: Mediator complex subunit 25 von Willebrand factor type A; InterPro: IPR021419 The overall function of the full-length Med25 is efficiently to coordinate the transcriptional activation of RAR/RXR (retinoic acid receptor/retinoic X receptor) in higher eukaryotic cells | Back alignment and domain information |
|---|
Probab=100.00 E-value=3.8e-65 Score=524.57 Aligned_cols=209 Identities=43% Similarity=0.703 Sum_probs=192.7
Q ss_pred CccEEEEEeCCccchHhHHHHHHHHHHHHHHHhhcccCccCccC---CccEEEEEEeecCCCccccceeeccCCCCHHHH
Q 003297 3 EKQLIVAVEGTAAMGPYWQSIVSDYLEKIIRCFCVNELAGQTSA---SNVELSLVTFNTHGSYCACLVQRSGWTKDVDIF 79 (833)
Q Consensus 3 ~~dvVFVID~Tasmg~y~~~lkt~YI~p~le~f~~~~l~~~~~g---~~~~~gLV~Y~d~~~~~~~lv~~~gfT~d~~~f 79 (833)
++|||||||+||+||+||++||+|||+|++|||+++++.|++++ .+++||||+||+||||++++|++++||+|+++|
T Consensus 13 ~~~vVfvvEgTAalgpy~~~Lkt~Yl~P~le~f~~g~~~e~~~~~~~~~t~y~LVvf~t~d~~~~~~v~~~g~T~~~~~f 92 (226)
T PF11265_consen 13 QAQVVFVVEGTAALGPYWNTLKTNYLDPILEYFNGGPIAERDFGGDYSNTEYGLVVFNTADCYPEPIVQRSGPTSSPQKF 92 (226)
T ss_pred cceEEEEEecchhhhhhHHHHHHHHHHHHHHHhcCCCcccccccccCCCceEEEEEEeccCCCcccceeccCCcCCHHHH
Confidence 58999999999999999999999999999999999999999973 479999999999999999999999999999999
Q ss_pred HHHHccCccCCCCCch-hHHHHHHHHHHhccccCCCCCCCCCCcCCCcEEEEeecCCCCCCCCCcccCCccccccccchh
Q 003297 80 LHWLSTIPFAGGGFND-AAIAEGLSEALMMFSVAPNGSQNQQNVDGQRHCILVAASNPHPLPTPVYRPQMQNLDQNENNE 158 (833)
Q Consensus 80 l~~Ld~I~f~GGG~~~-~AvaEGLa~AL~~f~~~~~~~~~~~~~~~qk~cILIa~SpP~~lp~pvy~p~~~~~~~~e~~~ 158 (833)
++|||+|+|.|||+++ ++|+|||++||+|||+.+..++...+.+.+||||||||||||++|+.. .+.
T Consensus 93 l~~L~~I~f~GGG~e~~a~iaEGLa~AL~~fd~~~~~r~~~~~~~~~khcILI~nSpP~~~p~~~------------~~~ 160 (226)
T PF11265_consen 93 LQWLDAIQFSGGGFESCAAIAEGLAEALQCFDDFKQMRQQQQQTDVQKHCILICNSPPYRLPVNE------------CPQ 160 (226)
T ss_pred HHHHHccCcCCCCcccchhHHHHHHHHHHHhcchhhhccccCcccccceEEEEeCCCCccccccC------------CCc
Confidence 9999999999999875 559999999999999888776666777799999999999999999732 222
Q ss_pred hhhcccCCCHHHHHHHHhhcCcEEEEeccCcchhHHHHHHHhcCCCCC-CCCCCCCCCCCCeEEEeeccc
Q 003297 159 AQAESRLSDAETVAKSFVQCSVSLSVICPKQLPKLTAIYNAAKRNPRA-ADPPVDNSKNPHFLVLISENF 227 (833)
Q Consensus 159 ~~~~~~l~d~e~la~~~~e~~I~LSvIsPrklp~l~~lf~ka~~~~~~-~~~~~~~ak~p~hlVLlsg~~ 227 (833)
+ +..++|++|.++.||+|+||||||||+|+|++||||+++|.++ +++++||||||||||||||+|
T Consensus 161 ~----~~~~~d~la~~~~~~~I~LSiisPrklP~l~~Lfeka~~~~~~~~~~~~~~ak~p~hlVLl~g~~ 226 (226)
T PF11265_consen 161 Y----SGKTCDQLAVLISERNISLSIISPRKLPSLRSLFEKAKGNPRAAADPSKDYAKDPRHLVLLRGYF 226 (226)
T ss_pred c----cCCCHHHHHHHHHhcCceEEEEcCccCHHHHHHHHhcCCCcccccccccccccCCCeEEEeecCC
Confidence 2 2348899999999999999999999999999999999999998 699999999999999999986
|
Human Med25 consists of several domains with different binding properties, the N-terminal, VWA domain which is this one, an SD2 domain from residues 229-381, a PTOV(B) or ACID domain from 395-545, an SD2 domain from residues 564-645 and a C-terminal NR box-containing domain (646-650) from 646-747. This VWA or von Willebrand factor type A domain when bound to RAR and the histone acetyltransferase CBP is responsible for recruiting Med1 to the rest of the Mediator complex []. |
| >cd01480 vWA_collagen_alpha_1-VI-type VWA_collagen alpha(VI) type: The extracellular matrix represents a complex alloy of variable members of diverse protein families defining structural integrity and various physiological functions | Back alignment and domain information |
|---|
| >cd01472 vWA_collagen von Willebrand factor (vWF) type A domain; equivalent to the I-domain of integrins | Back alignment and domain information |
|---|
| >PF13519 VWA_2: von Willebrand factor type A domain; PDB: 3IBS_B 3RAG_B 2X5N_A | Back alignment and domain information |
|---|
| >cd01450 vWFA_subfamily_ECM Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) | Back alignment and domain information |
|---|
| >cd01481 vWA_collagen_alpha3-VI-like VWA_collagen alpha 3(VI) like: The extracellular matrix represents a complex alloy of variable members of diverse protein families defining structural integrity and various physiological functions | Back alignment and domain information |
|---|
| >cd01482 vWA_collagen_alphaI-XII-like Collagen: The extracellular matrix represents a complex alloy of variable members of diverse protein families defining structural integrity and various physiological functions | Back alignment and domain information |
|---|
| >cd01469 vWA_integrins_alpha_subunit Integrins are a class of adhesion receptors that link the extracellular matrix to the cytoskeleton and cooperate with growth factor receptors to promote celll survival, cell cycle progression and cell migration | Back alignment and domain information |
|---|
| >cd01473 vWA_CTRP CTRP for CS protein-TRAP-related protein: Adhesion of Plasmodium to host cells is an important phenomenon in parasite invasion and in malaria associated pathology | Back alignment and domain information |
|---|
| >cd01474 vWA_ATR ATR (Anthrax Toxin Receptor): Anthrax toxin is a key virulence factor for Bacillus anthracis, the causative agent of anthrax | Back alignment and domain information |
|---|
| >cd01453 vWA_transcription_factor_IIH_type Transcription factors IIH type: TFIIH is a multiprotein complex that is one of the five general transcription factors that binds RNA polymerase II holoenzyme | Back alignment and domain information |
|---|
| >cd01475 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity | Back alignment and domain information |
|---|
| >cd01476 VWA_integrin_invertebrates VWA_integrin (invertebrates): Integrins are a family of cell surface receptors that have diverse functions in cell-cell and cell-extracellular matrix interactions | Back alignment and domain information |
|---|
| >cd01477 vWA_F09G8-8_type VWA F09G8 | Back alignment and domain information |
|---|
| >PF00092 VWA: von Willebrand factor type A domain; InterPro: IPR002035 The von Willebrand factor is a large multimeric glycoprotein found in blood plasma | Back alignment and domain information |
|---|
| >cd01471 vWA_micronemal_protein Micronemal proteins: The Toxoplasma lytic cycle begins when the parasite actively invades a target cell | Back alignment and domain information |
|---|
| >cd00198 vWFA Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) | Back alignment and domain information |
|---|
| >smart00187 INB Integrin beta subunits (N-terminal portion of extracellular region) | Back alignment and domain information |
|---|
| >cd01467 vWA_BatA_type VWA BatA type: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) | Back alignment and domain information |
|---|
| >cd01452 VWA_26S_proteasome_subunit 26S proteasome plays a major role in eukaryotic protein breakdown, especially for ubiquitin-tagged proteins | Back alignment and domain information |
|---|
| >PF13768 VWA_3: von Willebrand factor type A domain | Back alignment and domain information |
|---|
| >smart00327 VWA von Willebrand factor (vWF) type A domain | Back alignment and domain information |
|---|
| >cd01463 vWA_VGCC_like VWA Voltage gated Calcium channel like: Voltage-gated calcium channels are a complex of five proteins: alpha 1, beta 1, gamma, alpha 2 and delta | Back alignment and domain information |
|---|
| >COG1240 ChlD Mg-chelatase subunit ChlD [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >cd01456 vWA_ywmD_type VWA ywmD type:Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) | Back alignment and domain information |
|---|
| >cd01470 vWA_complement_factors Complement factors B and C2 are two critical proteases for complement activation | Back alignment and domain information |
|---|
| >PTZ00441 sporozoite surface protein 2 (SSP2); Provisional | Back alignment and domain information |
|---|
| >PRK13685 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd01465 vWA_subgroup VWA subgroup: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) | Back alignment and domain information |
|---|
| >cd01454 vWA_norD_type norD type: Denitrifying bacteria contain both membrane bound and periplasmic nitrate reductases | Back alignment and domain information |
|---|
| >cd01451 vWA_Magnesium_chelatase Magnesium chelatase: Mg-chelatase catalyses the insertion of Mg into protoporphyrin IX (Proto) | Back alignment and domain information |
|---|
| >TIGR03436 acidobact_VWFA VWFA-related Acidobacterial domain | Back alignment and domain information |
|---|
| >cd01461 vWA_interalpha_trypsin_inhibitor vWA_interalpha trypsin inhibitor (ITI): ITI is a glycoprotein composed of three polypeptides- two heavy chains and one light chain (bikunin) | Back alignment and domain information |
|---|
| >cd01466 vWA_C3HC4_type VWA C3HC4-type: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) | Back alignment and domain information |
|---|
| >cd01464 vWA_subfamily VWA subfamily: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) | Back alignment and domain information |
|---|
| >cd01458 vWA_ku Ku70/Ku80 N-terminal domain | Back alignment and domain information |
|---|
| >PRK13406 bchD magnesium chelatase subunit D; Provisional | Back alignment and domain information |
|---|
| >TIGR02031 BchD-ChlD magnesium chelatase ATPase subunit D | Back alignment and domain information |
|---|
| >cd01462 VWA_YIEM_type VWA YIEM type: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) | Back alignment and domain information |
|---|
| >TIGR02442 Cob-chelat-sub cobaltochelatase subunit | Back alignment and domain information |
|---|
| >PF00362 Integrin_beta: Integrin, beta chain; InterPro: IPR002369 Integrins are the major metazoan receptors for cell adhesion to extracellular matrix proteins and, in vertebrates, also play important roles in certain cell-cell adhesions, make transmembrane connections to the cytoskeleton and activate many intracellular signalling pathways [, ] | Back alignment and domain information |
|---|
| >TIGR00868 hCaCC calcium-activated chloride channel protein 1 | Back alignment and domain information |
|---|
| >cd01460 vWA_midasin VWA_Midasin: Midasin is a member of the AAA ATPase family | Back alignment and domain information |
|---|
| >TIGR03788 marine_srt_targ marine proteobacterial sortase target protein | Back alignment and domain information |
|---|
| >PF03731 Ku_N: Ku70/Ku80 N-terminal alpha/beta domain; InterPro: IPR005161 The Ku heterodimer (composed of Ku70 P12956 from SWISSPROT and Ku80 P13010 from SWISSPROT) contributes to genomic integrity through its ability to bind DNA double-strand breaks and facilitate repair by the non-homologous end-joining pathway | Back alignment and domain information |
|---|
| >PF04056 Ssl1: Ssl1-like; InterPro: IPR007198 Ssl1-like proteins are 40 kDa subunits of the transcription factor II H complex | Back alignment and domain information |
|---|
| >cd01455 vWA_F11C1-5a_type Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) | Back alignment and domain information |
|---|
| >cd01457 vWA_ORF176_type VWA ORF176 type: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) | Back alignment and domain information |
|---|
| >COG4245 TerY Uncharacterized protein encoded in toxicity protection region of plasmid R478, contains von Willebrand factor (vWF) domain [General function prediction only] | Back alignment and domain information |
|---|
| >PF04811 Sec23_trunk: Sec23/Sec24 trunk domain; InterPro: IPR006896 COPII (coat protein complex II)-coated vesicles carry proteins from the endoplasmic reticulum (ER) to the Golgi complex [] | Back alignment and domain information |
|---|
| >KOG3598 consensus Thyroid hormone receptor-associated protein complex, subunit TRAP230 [Transcription] | Back alignment and domain information |
|---|
| >cd01468 trunk_domain trunk domain | Back alignment and domain information |
|---|
| >KOG3598 consensus Thyroid hormone receptor-associated protein complex, subunit TRAP230 [Transcription] | Back alignment and domain information |
|---|
| >TIGR00578 ku70 ATP-dependent DNA helicase ii, 70 kDa subunit (ku70) | Back alignment and domain information |
|---|
| >cd01479 Sec24-like Sec24-like: Protein and membrane traffic in eukaryotes is mediated by at least in part by the budding and fusion of intracellular transport vesicles that selectively carry cargo proteins and lipids from donor to acceptor organelles | Back alignment and domain information |
|---|
| >PF11498 Activator_LAG-3: Transcriptional activator LAG-3; InterPro: IPR021587 The C | Back alignment and domain information |
|---|
| >KOG2807 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF05762 VWA_CoxE: VWA domain containing CoxE-like protein; InterPro: IPR008912 This group of proteins contains a VWA type domain and the function of this family is unknown | Back alignment and domain information |
|---|
| >PF06707 DUF1194: Protein of unknown function (DUF1194); InterPro: IPR010607 This family consists of several hypothetical Rhizobiales specific proteins of around 270 residues in length | Back alignment and domain information |
|---|
| >PRK10997 yieM hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG5148 RPN10 26S proteasome regulatory complex, subunit RPN10/PSMD4 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd01478 Sec23-like Sec23-like: Protein and membrane traffic in eukaryotes is mediated by at least in part by the budding and fusion of intracellular transport vesicles that selectively carry cargo proteins and lipids from donor to acceptor organelles | Back alignment and domain information |
|---|
| >PF10138 vWA-TerF-like: vWA found in TerF C terminus ; InterPro: IPR019303 This entry represents the N-terminal domain of a family of proteins that confer resistance to the metalloid element tellurium and its salts | Back alignment and domain information |
|---|
| >KOG1226 consensus Integrin beta subunit (N-terminal portion of extracellular region) [Signal transduction mechanisms; Extracellular structures] | Back alignment and domain information |
|---|
| >PF11235 Med25_SD1: Mediator complex subunit 25 synapsin 1; InterPro: IPR021397 The overall function of the full-length Med25 is efficiently to coordinate the transcriptional activation of RAR/RXR (retinoic acid receptor/retinoic X receptor) in higher eukaryotic cells | Back alignment and domain information |
|---|
| >KOG1984 consensus Vesicle coat complex COPII, subunit SFB3 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PTZ00395 Sec24-related protein; Provisional | Back alignment and domain information |
|---|
| >PLN00162 transport protein sec23; Provisional | Back alignment and domain information |
|---|
| >KOG2884 consensus 26S proteasome regulatory complex, subunit RPN10/PSMD4 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2353 consensus L-type voltage-dependent Ca2+ channel, alpha2/delta subunit [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG5151 SSL1 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR00627 tfb4 transcription factor tfb4 | Back alignment and domain information |
|---|
| >PF09967 DUF2201: VWA-like domain (DUF2201); InterPro: IPR018698 This family of various hypothetical bacterial proteins has no known function | Back alignment and domain information |
|---|
| >COG2425 Uncharacterized protein containing a von Willebrand factor type A (vWA) domain [General function prediction only] | Back alignment and domain information |
|---|
| >PF03850 Tfb4: Transcription factor Tfb4; InterPro: IPR004600 Members of this family are part of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 833 | |||
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 2e-10 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 4e-10 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 1e-09 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 2e-09 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 4e-08 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 1e-07 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 4e-07 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 5e-07 | |
| 3lj5_A | 725 | Portal protein, protein GP1; DNA ejection, molecul | 1e-09 | |
| 3lj5_A | 725 | Portal protein, protein GP1; DNA ejection, molecul | 3e-09 | |
| 3lj5_A | 725 | Portal protein, protein GP1; DNA ejection, molecul | 4e-09 | |
| 3lj5_A | 725 | Portal protein, protein GP1; DNA ejection, molecul | 7e-09 | |
| 3lj5_A | 725 | Portal protein, protein GP1; DNA ejection, molecul | 1e-07 | |
| 3lj5_A | 725 | Portal protein, protein GP1; DNA ejection, molecul | 9e-06 | |
| 3lj5_A | 725 | Portal protein, protein GP1; DNA ejection, molecul | 1e-05 | |
| 3lj5_A | 725 | Portal protein, protein GP1; DNA ejection, molecul | 7e-04 | |
| 1yvl_A | 683 | Signal transducer and activator of transcription 1 | 1e-07 | |
| 1yvl_A | 683 | Signal transducer and activator of transcription 1 | 8e-06 | |
| 1yvl_A | 683 | Signal transducer and activator of transcription 1 | 1e-05 | |
| 1yvl_A | 683 | Signal transducer and activator of transcription 1 | 2e-05 | |
| 1yvl_A | 683 | Signal transducer and activator of transcription 1 | 3e-05 | |
| 1yvl_A | 683 | Signal transducer and activator of transcription 1 | 4e-05 | |
| 1yvl_A | 683 | Signal transducer and activator of transcription 1 | 3e-04 | |
| 1yvl_A | 683 | Signal transducer and activator of transcription 1 | 5e-04 | |
| 1yvl_A | 683 | Signal transducer and activator of transcription 1 | 6e-04 | |
| 1f5n_A | 592 | Interferon-induced guanylate-binding protein 1; GB | 2e-07 | |
| 1f5n_A | 592 | Interferon-induced guanylate-binding protein 1; GB | 2e-07 | |
| 1f5n_A | 592 | Interferon-induced guanylate-binding protein 1; GB | 3e-07 | |
| 1f5n_A | 592 | Interferon-induced guanylate-binding protein 1; GB | 4e-06 | |
| 1f5n_A | 592 | Interferon-induced guanylate-binding protein 1; GB | 2e-05 | |
| 1f5n_A | 592 | Interferon-induced guanylate-binding protein 1; GB | 7e-05 | |
| 3ghg_C | 411 | Fibrinogen gamma chain; triple-stranded coiled coi | 2e-07 | |
| 3ghg_C | 411 | Fibrinogen gamma chain; triple-stranded coiled coi | 3e-05 | |
| 3ghg_C | 411 | Fibrinogen gamma chain; triple-stranded coiled coi | 6e-05 | |
| 1m1j_B | 464 | Fibrinogen beta chain; coiled coils, disulfide rin | 5e-07 | |
| 1m1j_B | 464 | Fibrinogen beta chain; coiled coils, disulfide rin | 3e-06 | |
| 1m1j_B | 464 | Fibrinogen beta chain; coiled coils, disulfide rin | 3e-05 | |
| 1bg1_A | 596 | Protein (transcription factor STAT3B); protein-DNA | 2e-06 | |
| 1bg1_A | 596 | Protein (transcription factor STAT3B); protein-DNA | 4e-06 | |
| 1bg1_A | 596 | Protein (transcription factor STAT3B); protein-DNA | 8e-06 | |
| 1bg1_A | 596 | Protein (transcription factor STAT3B); protein-DNA | 2e-05 | |
| 1bg1_A | 596 | Protein (transcription factor STAT3B); protein-DNA | 2e-05 | |
| 1bg1_A | 596 | Protein (transcription factor STAT3B); protein-DNA | 3e-05 | |
| 1bg1_A | 596 | Protein (transcription factor STAT3B); protein-DNA | 3e-05 | |
| 1uur_A | 473 | Stata protein, STAT protein; transcription activat | 3e-06 | |
| 1uur_A | 473 | Stata protein, STAT protein; transcription activat | 5e-06 | |
| 1uur_A | 473 | Stata protein, STAT protein; transcription activat | 2e-05 | |
| 1uur_A | 473 | Stata protein, STAT protein; transcription activat | 7e-04 | |
| 2es4_D | 332 | Lipase chaperone; protein-protein complex, steric | 5e-06 | |
| 2es4_D | 332 | Lipase chaperone; protein-protein complex, steric | 1e-04 | |
| 1bf5_A | 575 | Signal transducer and activator of transcription 1 | 1e-05 | |
| 1bf5_A | 575 | Signal transducer and activator of transcription 1 | 1e-05 | |
| 1bf5_A | 575 | Signal transducer and activator of transcription 1 | 1e-05 | |
| 1bf5_A | 575 | Signal transducer and activator of transcription 1 | 4e-05 | |
| 1bf5_A | 575 | Signal transducer and activator of transcription 1 | 5e-05 | |
| 1bf5_A | 575 | Signal transducer and activator of transcription 1 | 7e-05 | |
| 3ibp_A | 302 | Chromosome partition protein MUKB; structural main | 1e-05 | |
| 3ibp_A | 302 | Chromosome partition protein MUKB; structural main | 3e-05 | |
| 3ibp_A | 302 | Chromosome partition protein MUKB; structural main | 3e-04 | |
| 2v71_A | 189 | Nuclear distribution protein NUDE-like 1; developm | 1e-05 | |
| 1lwu_C | 323 | Fibrinogen gamma chain; heterotrimer, protein-pept | 2e-05 | |
| 1lwu_C | 323 | Fibrinogen gamma chain; heterotrimer, protein-pept | 5e-05 | |
| 1y1u_A | 585 | Signal transducer and activator of transcription; | 4e-05 | |
| 1y1u_A | 585 | Signal transducer and activator of transcription; | 8e-05 | |
| 1y1u_A | 585 | Signal transducer and activator of transcription; | 1e-04 | |
| 1y1u_A | 585 | Signal transducer and activator of transcription; | 2e-04 | |
| 1y1u_A | 585 | Signal transducer and activator of transcription; | 2e-04 | |
| 1y1u_A | 585 | Signal transducer and activator of transcription; | 5e-04 | |
| 1m1j_C | 409 | Fibrinogen gamma chain; coiled coils, disulfide ri | 1e-04 | |
| 3c8j_A | 203 | Natural killer cell receptor LY49C; MHC, virus, im | 1e-04 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 2e-04 | |
| 3ghg_A | 562 | Fibrinogen alpha chain; triple-stranded coiled coi | 3e-04 | |
| 3ajw_A | 150 | Flagellar FLIJ protein; flagellum, type III secret | 3e-04 | |
| 3o0z_A | 168 | RHO-associated protein kinase 1; coiled-coil, tran | 3e-04 | |
| 1vt0_M | 602 | Portal protein, protein GP1; portal protein, DNA e | 5e-04 | |
| 2h8n_A | 112 | HD4, histone deacetylase 4; alpha helix, polar zip | 6e-04 | |
| 1jad_A | 251 | PLC-beta, phospholipase C beta; alpha helical coil | 7e-04 |
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
Score = 63.7 bits (154), Expect = 2e-10
Identities = 20/133 (15%), Positives = 36/133 (27%)
Query: 689 ISSQQQQQLQQQQQQQQHQQMQSQLQHQQLSQLQQQQQQLPQLQQQIPQLQQQQQIPQLQ 748
+S +++ Q Q Q Q Q + + Q +P + Q Q
Sbjct: 1 MSHHKKRVYPQAQLQYGQNATPLQQPAQFMPPQDPAAAGMSYGQMGMPPQGAVPSMGQQQ 60
Query: 749 QQSMPQLQQQQQLPQLQQQQQLPQMQQQQQLPQLQQQQQLSQPQQMVGSGMGQGYVQGPG 808
+ Q Q QQ+ Q + + Q Q Q + P
Sbjct: 61 FLTPAQEQLHQQIDQATTSMNDMHLHNVPLVDPNAYMQPQVPVQMGTPLQQQQQPMAAPA 120
Query: 809 RTQLVSQGQVSSQ 821
Q + + +
Sbjct: 121 YGQPSAAMGQNMR 133
|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >3lj5_A Portal protein, protein GP1; DNA ejection, molecular motor, DNA packaging podoviridae, virus assembly, tail tube, trunk domain; 7.50A {Enterobacteria phage P22} Length = 725 | Back alignment and structure |
|---|
| >3lj5_A Portal protein, protein GP1; DNA ejection, molecular motor, DNA packaging podoviridae, virus assembly, tail tube, trunk domain; 7.50A {Enterobacteria phage P22} Length = 725 | Back alignment and structure |
|---|
| >3lj5_A Portal protein, protein GP1; DNA ejection, molecular motor, DNA packaging podoviridae, virus assembly, tail tube, trunk domain; 7.50A {Enterobacteria phage P22} Length = 725 | Back alignment and structure |
|---|
| >3lj5_A Portal protein, protein GP1; DNA ejection, molecular motor, DNA packaging podoviridae, virus assembly, tail tube, trunk domain; 7.50A {Enterobacteria phage P22} Length = 725 | Back alignment and structure |
|---|
| >3lj5_A Portal protein, protein GP1; DNA ejection, molecular motor, DNA packaging podoviridae, virus assembly, tail tube, trunk domain; 7.50A {Enterobacteria phage P22} Length = 725 | Back alignment and structure |
|---|
| >3lj5_A Portal protein, protein GP1; DNA ejection, molecular motor, DNA packaging podoviridae, virus assembly, tail tube, trunk domain; 7.50A {Enterobacteria phage P22} Length = 725 | Back alignment and structure |
|---|
| >3lj5_A Portal protein, protein GP1; DNA ejection, molecular motor, DNA packaging podoviridae, virus assembly, tail tube, trunk domain; 7.50A {Enterobacteria phage P22} Length = 725 | Back alignment and structure |
|---|
| >3lj5_A Portal protein, protein GP1; DNA ejection, molecular motor, DNA packaging podoviridae, virus assembly, tail tube, trunk domain; 7.50A {Enterobacteria phage P22} Length = 725 | Back alignment and structure |
|---|
| >1yvl_A Signal transducer and activator of transcription 1-alpha/beta; signaling protein; HET: PTR; 3.00A {Homo sapiens} Length = 683 | Back alignment and structure |
|---|
| >1yvl_A Signal transducer and activator of transcription 1-alpha/beta; signaling protein; HET: PTR; 3.00A {Homo sapiens} Length = 683 | Back alignment and structure |
|---|
| >1yvl_A Signal transducer and activator of transcription 1-alpha/beta; signaling protein; HET: PTR; 3.00A {Homo sapiens} Length = 683 | Back alignment and structure |
|---|
| >1yvl_A Signal transducer and activator of transcription 1-alpha/beta; signaling protein; HET: PTR; 3.00A {Homo sapiens} Length = 683 | Back alignment and structure |
|---|
| >1yvl_A Signal transducer and activator of transcription 1-alpha/beta; signaling protein; HET: PTR; 3.00A {Homo sapiens} Length = 683 | Back alignment and structure |
|---|
| >1yvl_A Signal transducer and activator of transcription 1-alpha/beta; signaling protein; HET: PTR; 3.00A {Homo sapiens} Length = 683 | Back alignment and structure |
|---|
| >1yvl_A Signal transducer and activator of transcription 1-alpha/beta; signaling protein; HET: PTR; 3.00A {Homo sapiens} Length = 683 | Back alignment and structure |
|---|
| >1yvl_A Signal transducer and activator of transcription 1-alpha/beta; signaling protein; HET: PTR; 3.00A {Homo sapiens} Length = 683 | Back alignment and structure |
|---|
| >1yvl_A Signal transducer and activator of transcription 1-alpha/beta; signaling protein; HET: PTR; 3.00A {Homo sapiens} Length = 683 | Back alignment and structure |
|---|
| >1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Length = 592 | Back alignment and structure |
|---|
| >1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Length = 592 | Back alignment and structure |
|---|
| >1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Length = 592 | Back alignment and structure |
|---|
| >1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Length = 592 | Back alignment and structure |
|---|
| >1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Length = 592 | Back alignment and structure |
|---|
| >1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Length = 592 | Back alignment and structure |
|---|
| >3ghg_C Fibrinogen gamma chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 1deq_C Length = 411 | Back alignment and structure |
|---|
| >3ghg_C Fibrinogen gamma chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 1deq_C Length = 411 | Back alignment and structure |
|---|
| >3ghg_C Fibrinogen gamma chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 1deq_C Length = 411 | Back alignment and structure |
|---|
| >1m1j_B Fibrinogen beta chain; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: d.171.1.1 h.1.8.1 PDB: 1ei3_B* Length = 464 | Back alignment and structure |
|---|
| >1m1j_B Fibrinogen beta chain; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: d.171.1.1 h.1.8.1 PDB: 1ei3_B* Length = 464 | Back alignment and structure |
|---|
| >1m1j_B Fibrinogen beta chain; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: d.171.1.1 h.1.8.1 PDB: 1ei3_B* Length = 464 | Back alignment and structure |
|---|
| >1bg1_A Protein (transcription factor STAT3B); protein-DNA complex, cytokine activation, complex (transcription factor/DNA), transcription/DNA complex; HET: DNA PTR; 2.25A {Mus musculus} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 PDB: 3cwg_A Length = 596 | Back alignment and structure |
|---|
| >1bg1_A Protein (transcription factor STAT3B); protein-DNA complex, cytokine activation, complex (transcription factor/DNA), transcription/DNA complex; HET: DNA PTR; 2.25A {Mus musculus} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 PDB: 3cwg_A Length = 596 | Back alignment and structure |
|---|
| >1bg1_A Protein (transcription factor STAT3B); protein-DNA complex, cytokine activation, complex (transcription factor/DNA), transcription/DNA complex; HET: DNA PTR; 2.25A {Mus musculus} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 PDB: 3cwg_A Length = 596 | Back alignment and structure |
|---|
| >1bg1_A Protein (transcription factor STAT3B); protein-DNA complex, cytokine activation, complex (transcription factor/DNA), transcription/DNA complex; HET: DNA PTR; 2.25A {Mus musculus} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 PDB: 3cwg_A Length = 596 | Back alignment and structure |
|---|
| >1bg1_A Protein (transcription factor STAT3B); protein-DNA complex, cytokine activation, complex (transcription factor/DNA), transcription/DNA complex; HET: DNA PTR; 2.25A {Mus musculus} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 PDB: 3cwg_A Length = 596 | Back alignment and structure |
|---|
| >1bg1_A Protein (transcription factor STAT3B); protein-DNA complex, cytokine activation, complex (transcription factor/DNA), transcription/DNA complex; HET: DNA PTR; 2.25A {Mus musculus} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 PDB: 3cwg_A Length = 596 | Back alignment and structure |
|---|
| >1bg1_A Protein (transcription factor STAT3B); protein-DNA complex, cytokine activation, complex (transcription factor/DNA), transcription/DNA complex; HET: DNA PTR; 2.25A {Mus musculus} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 PDB: 3cwg_A Length = 596 | Back alignment and structure |
|---|
| >1uur_A Stata protein, STAT protein; transcription activator, SH2, signal transduction, transducer, transcription factor; HET: PTR; 2.7A {Dictyostelium discoideum} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 PDB: 1uus_A* Length = 473 | Back alignment and structure |
|---|
| >1uur_A Stata protein, STAT protein; transcription activator, SH2, signal transduction, transducer, transcription factor; HET: PTR; 2.7A {Dictyostelium discoideum} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 PDB: 1uus_A* Length = 473 | Back alignment and structure |
|---|
| >1uur_A Stata protein, STAT protein; transcription activator, SH2, signal transduction, transducer, transcription factor; HET: PTR; 2.7A {Dictyostelium discoideum} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 PDB: 1uus_A* Length = 473 | Back alignment and structure |
|---|
| >1uur_A Stata protein, STAT protein; transcription activator, SH2, signal transduction, transducer, transcription factor; HET: PTR; 2.7A {Dictyostelium discoideum} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 PDB: 1uus_A* Length = 473 | Back alignment and structure |
|---|
| >2es4_D Lipase chaperone; protein-protein complex, steric chaperone, triacylglycerol hydrolase, all alpha helix protein, A/B hydrolase fold; 1.85A {Burkholderia glumae} SCOP: a.137.15.1 Length = 332 | Back alignment and structure |
|---|
| >2es4_D Lipase chaperone; protein-protein complex, steric chaperone, triacylglycerol hydrolase, all alpha helix protein, A/B hydrolase fold; 1.85A {Burkholderia glumae} SCOP: a.137.15.1 Length = 332 | Back alignment and structure |
|---|
| >1bf5_A Signal transducer and activator of transcription 1-alpha/beta; complex (SH2 domain/DNA), SH2 domain, transcription factor; HET: DNA PTR; 2.90A {Homo sapiens} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 Length = 575 | Back alignment and structure |
|---|
| >1bf5_A Signal transducer and activator of transcription 1-alpha/beta; complex (SH2 domain/DNA), SH2 domain, transcription factor; HET: DNA PTR; 2.90A {Homo sapiens} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 Length = 575 | Back alignment and structure |
|---|
| >1bf5_A Signal transducer and activator of transcription 1-alpha/beta; complex (SH2 domain/DNA), SH2 domain, transcription factor; HET: DNA PTR; 2.90A {Homo sapiens} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 Length = 575 | Back alignment and structure |
|---|
| >1bf5_A Signal transducer and activator of transcription 1-alpha/beta; complex (SH2 domain/DNA), SH2 domain, transcription factor; HET: DNA PTR; 2.90A {Homo sapiens} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 Length = 575 | Back alignment and structure |
|---|
| >1bf5_A Signal transducer and activator of transcription 1-alpha/beta; complex (SH2 domain/DNA), SH2 domain, transcription factor; HET: DNA PTR; 2.90A {Homo sapiens} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 Length = 575 | Back alignment and structure |
|---|
| >1bf5_A Signal transducer and activator of transcription 1-alpha/beta; complex (SH2 domain/DNA), SH2 domain, transcription factor; HET: DNA PTR; 2.90A {Homo sapiens} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 Length = 575 | Back alignment and structure |
|---|
| >3ibp_A Chromosome partition protein MUKB; structural maintenance of chromosomes, SMC, condensin, chromosome segregation, hinge, dimerization domain; 3.10A {Escherichia coli} Length = 302 | Back alignment and structure |
|---|
| >3ibp_A Chromosome partition protein MUKB; structural maintenance of chromosomes, SMC, condensin, chromosome segregation, hinge, dimerization domain; 3.10A {Escherichia coli} Length = 302 | Back alignment and structure |
|---|
| >3ibp_A Chromosome partition protein MUKB; structural maintenance of chromosomes, SMC, condensin, chromosome segregation, hinge, dimerization domain; 3.10A {Escherichia coli} Length = 302 | Back alignment and structure |
|---|
| >2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Length = 189 | Back alignment and structure |
|---|
| >1lwu_C Fibrinogen gamma chain; heterotrimer, protein-peptide complex, blood clotting; HET: NDG MAN NAG BMA GAL; 2.80A {Petromyzon marinus} SCOP: d.171.1.1 h.1.8.1 PDB: 1n73_C* Length = 323 | Back alignment and structure |
|---|
| >1lwu_C Fibrinogen gamma chain; heterotrimer, protein-peptide complex, blood clotting; HET: NDG MAN NAG BMA GAL; 2.80A {Petromyzon marinus} SCOP: d.171.1.1 h.1.8.1 PDB: 1n73_C* Length = 323 | Back alignment and structure |
|---|
| >1y1u_A Signal transducer and activator of transcription; STAT, DNA-binding, SH2 domain, transcription REGU signaling protein; 3.21A {Mus musculus} Length = 585 | Back alignment and structure |
|---|
| >1y1u_A Signal transducer and activator of transcription; STAT, DNA-binding, SH2 domain, transcription REGU signaling protein; 3.21A {Mus musculus} Length = 585 | Back alignment and structure |
|---|
| >1y1u_A Signal transducer and activator of transcription; STAT, DNA-binding, SH2 domain, transcription REGU signaling protein; 3.21A {Mus musculus} Length = 585 | Back alignment and structure |
|---|
| >1y1u_A Signal transducer and activator of transcription; STAT, DNA-binding, SH2 domain, transcription REGU signaling protein; 3.21A {Mus musculus} Length = 585 | Back alignment and structure |
|---|
| >1y1u_A Signal transducer and activator of transcription; STAT, DNA-binding, SH2 domain, transcription REGU signaling protein; 3.21A {Mus musculus} Length = 585 | Back alignment and structure |
|---|
| >1y1u_A Signal transducer and activator of transcription; STAT, DNA-binding, SH2 domain, transcription REGU signaling protein; 3.21A {Mus musculus} Length = 585 | Back alignment and structure |
|---|
| >1m1j_C Fibrinogen gamma chain; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: d.171.1.1 h.1.8.1 PDB: 1ei3_C Length = 409 | Back alignment and structure |
|---|
| >3c8j_A Natural killer cell receptor LY49C; MHC, virus, immune system; 2.60A {Mus musculus} SCOP: d.169.1.1 PDB: 3c8k_D 1p4l_D 1ja3_A 1p1z_D Length = 203 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* Length = 562 | Back alignment and structure |
|---|
| >3ajw_A Flagellar FLIJ protein; flagellum, type III secretion, coiled-coil, protein transpor; 2.10A {Salmonella typhimurium} Length = 150 | Back alignment and structure |
|---|
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Length = 168 | Back alignment and structure |
|---|
| >1vt0_M Portal protein, protein GP1; portal protein, DNA ejection, molecular motor, DNA packaging podoviridae; 3.25A {Enterobacteria phage P22} PDB: 3lj4_A Length = 602 | Back alignment and structure |
|---|
| >2h8n_A HD4, histone deacetylase 4; alpha helix, polar zipper, transcription; 2.60A {Homo sapiens} PDB: 2o94_A Length = 112 | Back alignment and structure |
|---|
| >1jad_A PLC-beta, phospholipase C beta; alpha helical coiled coil, hydrolase; 2.40A {Meleagris gallopavo} SCOP: h.4.10.1 Length = 251 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 833 | |||
| 2iue_A | 212 | Pactolus I-domain; membrane protein, CD, ITC, limb | 99.61 | |
| 3vi3_B | 454 | Integrin beta-1; beta propeller fold, rossman fold | 99.39 | |
| 3fcs_B | 690 | Integrin beta-3; beta propeller, rossmann fold, EG | 99.38 | |
| 3t3p_B | 472 | Integrin beta-3; integrin, cell adhesion, blood cl | 99.37 | |
| 3v4v_B | 503 | Integrin beta-7; cell adhesion, madcam-1, membrane | 99.35 | |
| 3k6s_B | 687 | Integrin beta-2; cell receptor, adhesion molecule, | 99.32 | |
| 1ijb_A | 202 | VON willebrand factor; dinucleotide-binding fold, | 98.98 | |
| 2xgg_A | 178 | Microneme protein 2; A/I domain, cell adhesion, hy | 98.97 | |
| 1v7p_C | 200 | Integrin alpha-2; snake venom, C-type lectin, anta | 98.93 | |
| 1atz_A | 189 | VON willebrand factor; collagen-binding, hemostasi | 98.93 | |
| 3n2n_F | 185 | Anthrax toxin receptor 1; rossmann fold; 1.80A {Ho | 98.86 | |
| 3ibs_A | 218 | Conserved hypothetical protein BATB; structural ge | 98.84 | |
| 2b2x_A | 223 | Integrin alpha-1; computational design, antibody-a | 98.82 | |
| 1mf7_A | 194 | Integrin alpha M; cell adhesion; 1.25A {Homo sapie | 98.8 | |
| 1pt6_A | 213 | Integrin alpha-1; cell adhesion; 1.87A {Homo sapie | 98.79 | |
| 1n3y_A | 198 | Integrin alpha-X; alpha/beta rossmann fold, cell a | 98.78 | |
| 1shu_X | 182 | Anthrax toxin receptor 2; alpha/beta rossmann fold | 98.77 | |
| 4hqo_A | 266 | Sporozoite surface protein 2; malaria, gliding mot | 98.74 | |
| 1q0p_A | 223 | Complement factor B; VON willebrand factor, MAC-1, | 98.7 | |
| 4b4t_W | 268 | RPN10, 26S proteasome regulatory subunit RPN10; hy | 98.69 | |
| 4hqf_A | 281 | Thrombospondin-related anonymous protein, trap; ma | 98.65 | |
| 3zqk_A | 199 | VON willebrand factor; blood clotting, adamts-13, | 98.63 | |
| 2x5n_A | 192 | SPRPN10, 26S proteasome regulatory subunit RPN10; | 98.57 | |
| 1rrk_A | 497 | Complement factor B; BB, hydrolase; 2.00A {Homo sa | 98.52 | |
| 2odp_A | 509 | Complement C2; C3/C5 convertase, complement serin | 98.51 | |
| 3hrz_D | 741 | Complement factor B; serine protease, glycosilated | 98.45 | |
| 1mjn_A | 179 | Integrin alpha-L; rossmann fold, immune system; 1. | 98.38 | |
| 4fx5_A | 464 | VON willebrand factor type A; structural genomics, | 98.26 | |
| 3k6s_A | 1095 | Integrin alpha-X; cell receptor, adhesion molecule | 98.2 | |
| 2x31_A | 189 | Magnesium-chelatase 60 kDa subunit; ligase, bacter | 98.1 | |
| 1jey_B | 565 | KU80; double-strand DNA break repair, non-homologo | 98.0 | |
| 1jey_A | 609 | KU70; double-strand DNA break repair, non-homologo | 97.85 | |
| 3rag_A | 242 | Uncharacterized protein; structural genomics, PSI- | 97.78 | |
| 2ww8_A | 893 | RRGA, cell WALL surface anchor family protein; IGG | 97.2 | |
| 1yvr_A | 538 | RO autoantigen, 60-kDa SS-A/RO ribonucleoprotein, | 95.65 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 94.49 | |
| 3eh1_A | 751 | Protein transport protein SEC24B; copii coat prote | 94.46 | |
| 1pcx_A | 810 | Protein transport protein SEC24; 2.50A {Saccharomy | 94.43 | |
| 3iot_A | 449 | Maltose-binding protein, huntingtin fusion protei; | 94.39 | |
| 2nut_A | 769 | Protein transport protein SEC23A; human copii SEC2 | 93.16 | |
| 3iot_A | 449 | Maltose-binding protein, huntingtin fusion protei; | 92.37 | |
| 3efo_B | 770 | SEC24 related gene family, member D; copii, coat p | 91.76 | |
| 1m2o_A | 768 | SEC23, protein transport protein SEC23, SEC23P; zi | 91.13 | |
| 3eh2_A | 766 | Protein transport protein SEC24C; copii-coat prote | 90.43 | |
| 2nvo_A | 535 | RO sixty-related protein, RSR; alpha helical repea | 90.11 |
| >2iue_A Pactolus I-domain; membrane protein, CD, ITC, limbs, midas, admidas, membrane, integrin, titration, rossman fold, cell adhesion, transmembrane; NMR {Mus musculus} | Back alignment and structure |
|---|
Probab=99.61 E-value=4.3e-15 Score=152.58 Aligned_cols=170 Identities=9% Similarity=0.070 Sum_probs=123.1
Q ss_pred ccEEEEEeCCccchHhHHHHHHHHHHHHHHHhhcccCccCccCCccEEEEEEeecCCCccccceeeccCCCCHHHHHHHH
Q 003297 4 KQLIVAVEGTAAMGPYWQSIVSDYLEKIIRCFCVNELAGQTSASNVELSLVTFNTHGSYCACLVQRSGWTKDVDIFLHWL 83 (833)
Q Consensus 4 ~dvVFVID~Tasmg~y~~~lkt~YI~p~le~f~~~~l~~~~~g~~~~~gLV~Y~d~~~~~~~lv~~~gfT~d~~~fl~~L 83 (833)
.|||||+|.|+||++|++.+|+.. ..+++.+.. +..++|||++.|+|+ .| ...+.||+|.++|.+++
T Consensus 4 vDl~fl~D~S~SM~~di~~lk~~~-~~l~~~l~~-------~~~~~r~Gfg~f~Dk----~~-~~~l~lT~d~~~F~~~v 70 (212)
T 2iue_A 4 VDLYFLMGLSGSAQGHLSNVQTLG-SDLLKALNE-------ISRSGRIGFGSIVNM----TF-QHILKLTADSSQFQREL 70 (212)
T ss_dssp EEEEEEEECCGGGTTTHHHHHHHH-HHHHHHHHH-------HCSCEEEEEEEESSS----CE-EEEEEEESCHHHHHHHH
T ss_pred eEEEEEEeCCCcchhHHHHHHHHH-HHHHHHHHh-------hCcCceEEEEEEEcC----cc-eecCCcCCCHHHHHHHH
Confidence 799999999999999999999664 666666652 112589999999999 23 56788999999999999
Q ss_pred ccCccCCCCCchhHHHHHHHHHHhcc---ccCCCCCCCCCCcCCCcEEEEeecCCCCCCCCC----cccCCcc--ccccc
Q 003297 84 STIPFAGGGFNDAAIAEGLSEALMMF---SVAPNGSQNQQNVDGQRHCILVAASNPHPLPTP----VYRPQMQ--NLDQN 154 (833)
Q Consensus 84 d~I~f~GGG~~~~AvaEGLa~AL~~f---~~~~~~~~~~~~~~~qk~cILIa~SpP~~lp~p----vy~p~~~--~~~~~ 154 (833)
+++..+||+|.+|+..|||..|+.|. .|+ . ..|.+||++|++||..... .+.|.-- .++.|
T Consensus 71 ~~~~vsg~~D~PE~g~dal~qa~~c~~~i~Wr---------~-a~rllvl~TDa~~H~~gDg~l~gi~~pnd~~chl~~g 140 (212)
T 2iue_A 71 RKQLVSGKLATPKGQLDAVVQVAICLGEIGWR---------N-GTRFLVLVTDNDFHLAKDKTLGTRQNTSDGRCHLDDG 140 (212)
T ss_dssp HTCCCCCCSSSSBCHHHHHHHHHHCHHHHTCC---------S-SEEEEEEECSSCBCCTTGGGGGTCCSCCCSSCCBSSS
T ss_pred hhccccCCCCCCchHHHHHHHHHHhhhhcccC---------C-ccEEEEEECcCCccccCCccccccccCCccccccCCC
Confidence 99999999999999999999999874 362 2 4699999999999997542 1111000 00111
Q ss_pred cchhhhhcccCCCHHHHHHHHhhcCcEEEE-eccCcchhHHHHH
Q 003297 155 ENNEAQAESRLSDAETVAKSFVQCSVSLSV-ICPKQLPKLTAIY 197 (833)
Q Consensus 155 e~~~~~~~~~l~d~e~la~~~~e~~I~LSv-IsPrklp~l~~lf 197 (833)
+ +........-+++++.+.+.+++|.+.. |+-.....+++|-
T Consensus 141 ~-y~~s~~~Dyps~~q~~~~l~~~~i~~ifavt~~~~~~Y~~l~ 183 (212)
T 2iue_A 141 M-YRSRGEPDYQSVVQLASKLAENNIQPIFVVPSRMVKTYEKLT 183 (212)
T ss_dssp B-BGGGGSSCCCCHHHHHHHHHHHTCEEEEEEEHHHHHHHHHHH
T ss_pred e-eccCcccCCCCHHHHHHHHHhcCCcEEEEEccchhHHHHHHH
Confidence 0 0111111235789999999999999766 5544444444443
|
| >3vi3_B Integrin beta-1; beta propeller fold, rossman fold, beta sandwich, fibronecti receptor, cell adhesion-immune system complex; HET: NAG BMA MAN; 2.90A {Homo sapiens} PDB: 3vi4_B* | Back alignment and structure |
|---|
| >3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* | Back alignment and structure |
|---|
| >3t3p_B Integrin beta-3; integrin, cell adhesion, blood clotting, fibrinogen, platele; HET: NAG BMA MAN; 2.20A {Homo sapiens} PDB: 3t3m_B* 3nig_B* 3nif_B* 3nid_B* 2vdr_B* 2vc2_B* 2vdk_B* 2vdm_B* 2vdn_B* 2vdl_B* 2vdp_B* 2vdq_B* 2vdo_B* 3fcu_B* 1txv_B* 1ty3_B* 1ty5_B* 1ty6_B* 1ty7_B* 1tye_B* | Back alignment and structure |
|---|
| >3v4v_B Integrin beta-7; cell adhesion, madcam-1, membrane; HET: NAG BMA MAN 0DU; 3.10A {Homo sapiens} PDB: 3v4p_B* | Back alignment and structure |
|---|
| >3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* | Back alignment and structure |
|---|
| >1ijb_A VON willebrand factor; dinucleotide-binding fold, blood clotting; 1.80A {Homo sapiens} SCOP: c.62.1.1 PDB: 1ijk_A 1auq_A 1u0n_A 3hxo_A 1uex_C 3hxq_A 1sq0_A 1m10_A 1fns_A 1oak_A 1u0o_C | Back alignment and structure |
|---|
| >2xgg_A Microneme protein 2; A/I domain, cell adhesion, hydrolase; 2.05A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >1v7p_C Integrin alpha-2; snake venom, C-type lectin, antagonist, cell adhes glycoprotein, toxin-cell adhesion complex; HET: NAG; 1.90A {Homo sapiens} SCOP: c.62.1.1 PDB: 1aox_A 1dzi_A | Back alignment and structure |
|---|
| >1atz_A VON willebrand factor; collagen-binding, hemostasis, dinucleotide binding fold; 1.80A {Homo sapiens} SCOP: c.62.1.1 PDB: 4dmu_B 2adf_A 1fe8_A 1ao3_A | Back alignment and structure |
|---|
| >3n2n_F Anthrax toxin receptor 1; rossmann fold; 1.80A {Homo sapiens} SCOP: c.62.1.1 | Back alignment and structure |
|---|
| >3ibs_A Conserved hypothetical protein BATB; structural genomics, protein structure, midwest center for S genomics, MCSG, PSI-2; HET: MSE; 2.10A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2b2x_A Integrin alpha-1; computational design, antibody-antigen complex, immune syste; 2.20A {Rattus norvegicus} SCOP: c.62.1.1 | Back alignment and structure |
|---|
| >1mf7_A Integrin alpha M; cell adhesion; 1.25A {Homo sapiens} SCOP: c.62.1.1 PDB: 1na5_A 1jlm_A 1ido_A 1m1u_A 3q3g_G 1n9z_A 1bhq_1 1bho_1 1idn_1 3qa3_G | Back alignment and structure |
|---|
| >1pt6_A Integrin alpha-1; cell adhesion; 1.87A {Homo sapiens} SCOP: c.62.1.1 PDB: 4a0q_A 1qcy_A 1qc5_A 1qc5_B 1ck4_A 1mhp_A | Back alignment and structure |
|---|
| >1n3y_A Integrin alpha-X; alpha/beta rossmann fold, cell adhesion; 1.65A {Homo sapiens} SCOP: c.62.1.1 | Back alignment and structure |
|---|
| >1shu_X Anthrax toxin receptor 2; alpha/beta rossmann fold, membrane protein; 1.50A {Homo sapiens} SCOP: c.62.1.1 PDB: 1tzn_a 1sht_X 1t6b_Y* | Back alignment and structure |
|---|
| >4hqo_A Sporozoite surface protein 2; malaria, gliding motility, VWA domain, TSR domain, extensibl ribbon, receptor on sporozoite, vaccine target; HET: FUC BGC; 2.19A {Plasmodium vivax} PDB: 4hql_A* 4hqn_A* | Back alignment and structure |
|---|
| >1q0p_A Complement factor B; VON willebrand factor, MAC-1, I domain, A domain, hydrolase; 1.80A {Homo sapiens} SCOP: c.62.1.1 | Back alignment and structure |
|---|
| >4b4t_W RPN10, 26S proteasome regulatory subunit RPN10; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4hqf_A Thrombospondin-related anonymous protein, trap; malaria, parasite motility, I domain, TSR domain, receptor O sporozoite, vaccine target; 2.20A {Plasmodium falciparum} PDB: 4hqk_A 2bbx_A | Back alignment and structure |
|---|
| >3zqk_A VON willebrand factor; blood clotting, adamts-13, force sensor, VON willebrand DISE domain, haemostasis; HET: NAG; 1.70A {Homo sapiens} PDB: 3ppv_A 3ppx_A 3ppw_A 3ppy_A 3gxb_A* | Back alignment and structure |
|---|
| >2x5n_A SPRPN10, 26S proteasome regulatory subunit RPN10; nuclear protein, nucleus, ubiquitin; 1.30A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >1rrk_A Complement factor B; BB, hydrolase; 2.00A {Homo sapiens} SCOP: b.47.1.2 c.62.1.1 PDB: 1rs0_A* 1rtk_A* 2win_I* 1dle_A | Back alignment and structure |
|---|
| >2odp_A Complement C2; C3/C5 convertase, complement serin protease, human complement system, glycoprotein, SP, VWFA,; HET: NAG; 1.90A {Homo sapiens} PDB: 2odq_A* 2i6q_A* 2i6s_A* | Back alignment and structure |
|---|
| >3hrz_D Complement factor B; serine protease, glycosilated, multi-domain, complement SYST convertase, complement alternate pathway; HET: NAG P6G; 2.20A {Homo sapiens} PDB: 2xwj_I* 3hs0_D* 2ok5_A* 2xwb_F* | Back alignment and structure |
|---|
| >1mjn_A Integrin alpha-L; rossmann fold, immune system; 1.30A {Homo sapiens} SCOP: c.62.1.1 PDB: 3hi6_A 1mq8_B* 3eoa_I 3eob_I 1rd4_A* 1lfa_A 1zon_A 1zoo_A 1zop_A 1dgq_A 1xdd_A* 1xdg_A* 1xuo_A* 3e2m_A* 3bqn_B* 1cqp_A* 3bqm_B* 2ica_A* 2o7n_A* 3m6f_A* ... | Back alignment and structure |
|---|
| >4fx5_A VON willebrand factor type A; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, blood clotting; HET: MSE; 1.73A {Catenulispora acidiphila} | Back alignment and structure |
|---|
| >3k6s_A Integrin alpha-X; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_A* 3k72_A* | Back alignment and structure |
|---|
| >2x31_A Magnesium-chelatase 60 kDa subunit; ligase, bacteriochlorophyll biosynthesis, photosynthesis; 7.50A {Rhodobacter capsulatus} | Back alignment and structure |
|---|
| >1jey_B KU80; double-strand DNA break repair, non-homologous END-joining, protein/nucleic acid complex, alpha/beta domain, beta barrel; HET: DNA; 2.50A {Homo sapiens} SCOP: b.131.1.2 c.62.1.4 PDB: 1jeq_B* | Back alignment and structure |
|---|
| >1jey_A KU70; double-strand DNA break repair, non-homologous END-joining, protein/nucleic acid complex, alpha/beta domain, beta barrel; HET: DNA; 2.50A {Homo sapiens} SCOP: b.131.1.1 c.62.1.3 PDB: 1jeq_A* 3rzx_B | Back alignment and structure |
|---|
| >3rag_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tructural genomics; 1.80A {Alicyclobacillus acidocaldarius subsp} | Back alignment and structure |
|---|
| >2ww8_A RRGA, cell WALL surface anchor family protein; IGG, pilus, CNA_B, adhesin, integrin, cell adhesion; HET: EPE; 1.90A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >1yvr_A RO autoantigen, 60-kDa SS-A/RO ribonucleoprotein, 60 kDa; heat repeat, VON willebrand factor A, rossmann fold, midas motif', RNA binding protein; 1.95A {Xenopus laevis} SCOP: a.118.25.1 c.62.1.5 PDB: 1yvp_A 2i91_A | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 | Back alignment and structure |
|---|
| >3eh1_A Protein transport protein SEC24B; copii coat protein, vesicle transport, transport signal sequence, cytoplasm, endoplasmic reticulum; 1.80A {Homo sapiens} PDB: 2nut_B 2nup_B 3egd_B 3egx_B | Back alignment and structure |
|---|
| >1pcx_A Protein transport protein SEC24; 2.50A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 PDB: 1pd0_A 1pd1_A | Back alignment and structure |
|---|
| >3iot_A Maltose-binding protein, huntingtin fusion protei; HTT-EX1, HD, sugar transport, transport, apoptos disease mutation, nucleus; 3.50A {Escherichia coli k-12} PDB: 3io6_A 3io4_A 3ior_A 3iou_A 3iov_A 3iow_A | Back alignment and structure |
|---|
| >2nut_A Protein transport protein SEC23A; human copii SEC23/24 complexed with SEC22, protein transport; 2.30A {Homo sapiens} PDB: 2nup_A 3egd_A 3eg9_A 3egx_A 3efo_A | Back alignment and structure |
|---|
| >3iot_A Maltose-binding protein, huntingtin fusion protei; HTT-EX1, HD, sugar transport, transport, apoptos disease mutation, nucleus; 3.50A {Escherichia coli k-12} PDB: 3io6_A 3io4_A 3ior_A 3iou_A 3iov_A 3iow_A | Back alignment and structure |
|---|
| >3efo_B SEC24 related gene family, member D; copii, coat protein, transport signal, disease mutation, endoplasmic reticulum, ER-golgi transport, golgi apparatus, membrane; 2.70A {Homo sapiens} PDB: 3eg9_B | Back alignment and structure |
|---|
| >1m2o_A SEC23, protein transport protein SEC23, SEC23P; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 PDB: 1m2v_A 2qtv_A* | Back alignment and structure |
|---|
| >3eh2_A Protein transport protein SEC24C; copii-coat protein, vesicle transport, cytoplasm, endoplasmic reticulum, ER-golgi transport, golgi apparatus; 2.35A {Homo sapiens} | Back alignment and structure |
|---|
| >2nvo_A RO sixty-related protein, RSR; alpha helical repeats, VON willebrand factor A domain, beta- RNA binding protein; 1.89A {Deinococcus radiodurans} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 833 | ||||
| d1f5na1 | 300 | a.114.1.1 (A:284-583) Interferon-induced guanylate | 6e-09 | |
| d1f5na1 | 300 | a.114.1.1 (A:284-583) Interferon-induced guanylate | 3e-07 | |
| d1f5na1 | 300 | a.114.1.1 (A:284-583) Interferon-induced guanylate | 4e-07 | |
| d1f5na1 | 300 | a.114.1.1 (A:284-583) Interferon-induced guanylate | 2e-04 | |
| d2es4d1 | 280 | a.137.15.1 (D:53-332) Lipase chaperone LifO (LipB) | 5e-08 | |
| d2es4d1 | 280 | a.137.15.1 (D:53-332) Lipase chaperone LifO (LipB) | 6e-08 | |
| d2es4d1 | 280 | a.137.15.1 (D:53-332) Lipase chaperone LifO (LipB) | 6e-08 | |
| d2es4d1 | 280 | a.137.15.1 (D:53-332) Lipase chaperone LifO (LipB) | 2e-07 | |
| d2es4d1 | 280 | a.137.15.1 (D:53-332) Lipase chaperone LifO (LipB) | 8e-07 | |
| d2es4d1 | 280 | a.137.15.1 (D:53-332) Lipase chaperone LifO (LipB) | 1e-06 | |
| d2es4d1 | 280 | a.137.15.1 (D:53-332) Lipase chaperone LifO (LipB) | 1e-06 | |
| d2es4d1 | 280 | a.137.15.1 (D:53-332) Lipase chaperone LifO (LipB) | 2e-06 | |
| d2es4d1 | 280 | a.137.15.1 (D:53-332) Lipase chaperone LifO (LipB) | 1e-05 | |
| d2es4d1 | 280 | a.137.15.1 (D:53-332) Lipase chaperone LifO (LipB) | 3e-05 | |
| d2es4d1 | 280 | a.137.15.1 (D:53-332) Lipase chaperone LifO (LipB) | 4e-05 | |
| d2es4d1 | 280 | a.137.15.1 (D:53-332) Lipase chaperone LifO (LipB) | 4e-04 | |
| d1s6da_ | 103 | a.52.1.3 (A:) Methionine-rich 2S protein (albumin | 0.001 | |
| g1pnb.1 | 106 | a.52.1.3 (A:,B:) Napin BNIb {Rape (Brassica napus) | 0.001 | |
| d2oeza1 | 245 | e.68.1.1 (A:1-245) Uncharacterized protein VP2528 | 0.001 | |
| d1psya_ | 125 | a.52.1.3 (A:) 2S albumin RicC3 {Castor bean (Ricin | 0.003 |
| >d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 300 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain superfamily: Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain family: Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain domain: Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain species: Human (Homo sapiens) [TaxId: 9606]
Score = 55.9 bits (134), Expect = 6e-09
Identities = 17/104 (16%), Positives = 44/104 (42%), Gaps = 3/104 (2%)
Query: 682 MVVFKPQISSQQQQQLQQQQQQQQHQQMQSQLQHQQLSQLQQQQQQLPQLQQQIPQLQQQ 741
+ + +I ++ + Q + +MQ + + + + Q+ L QL +++ + Q
Sbjct: 199 LTEKEKEIEVERVKAESAQASAKMLHEMQRKNEQMMEQKERSYQEHLKQLTEKMENDRVQ 258
Query: 742 QQIPQLQQQSMPQLQQQQQLPQLQQQQQLPQMQQQQQLPQLQQQ 785
+Q+ L+ Q+Q L++ Q + ++ LQ +
Sbjct: 259 LLK---EQERTLALKLQEQEQLLKEGFQKESRIMKNEIQDLQTK 299
|
| >d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 300 | Back information, alignment and structure |
|---|
| >d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 300 | Back information, alignment and structure |
|---|
| >d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 300 | Back information, alignment and structure |
|---|
| >d1s6da_ a.52.1.3 (A:) Methionine-rich 2S protein (albumin 8) {Common sunflower (Helianthus annuus) [TaxId: 4232]} Length = 103 | Back information, alignment and structure |
|---|
| >d1psya_ a.52.1.3 (A:) 2S albumin RicC3 {Castor bean (Ricinus communis) [TaxId: 3988]} Length = 125 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 833 | |||
| d1tyeb2 | 248 | Integrin beta A domain {Human (Homo sapiens) [TaxI | 99.73 | |
| d1pt6a_ | 192 | Integrin alpha1-beta1 {Human (Homo sapiens) [TaxId | 99.01 | |
| d1v7pc_ | 193 | Integrin alpha2-beta1 {Human (Homo sapiens) [TaxId | 98.96 | |
| d1atza_ | 184 | von Willebrand factor A3 domain, vWA3 {Human (Homo | 98.96 | |
| d1n3ya_ | 189 | Integrin alpha-x beta2 {Human (Homo sapiens) [TaxI | 98.95 | |
| d1shux_ | 181 | Capillary morphogenesis protein 2 domain {Human (H | 98.94 | |
| d1ijba_ | 202 | von Willebrand factor A1 domain, vWA1 {Human (Homo | 98.91 | |
| d1mf7a_ | 194 | Integrin alpha M (CR3, CD11b/CD18, Mac-1 alpha sub | 98.83 | |
| d1q0pa_ | 209 | Complement factor B domain {Human (Homo sapiens) [ | 98.72 | |
| d1mjna_ | 179 | Integrin CD11a/CD18 (Leukocyte function associated | 98.63 | |
| d1jeyb2 | 236 | Ku80 subunit N-terminal domain {Human (Homo sapien | 98.31 | |
| d1jeya2 | 220 | Ku70 subunit N-terminal domain {Human (Homo sapien | 97.86 | |
| d2qtva3 | 271 | Sec23 {Baker's yeast (Saccharomyces cerevisiae) [T | 96.6 | |
| d1pd0a3 | 252 | Sec24 {Baker's yeast (Saccharomyces cerevisiae) [T | 96.29 | |
| d1yvra2 | 174 | 60-kda SS-A/Ro ribonucleoprotein, RoRNP {African c | 96.23 |
| >d1tyeb2 c.62.1.1 (B:107-354) Integrin beta A domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: vWA-like superfamily: vWA-like family: Integrin A (or I) domain domain: Integrin beta A domain species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.73 E-value=3.8e-17 Score=168.44 Aligned_cols=177 Identities=9% Similarity=-0.004 Sum_probs=126.1
Q ss_pred ccEEEEEeCCccchHhHHHHHHHHHHHHHHHhhcccCccCccCCccEEEEEEeecCCCccc-------------------
Q 003297 4 KQLIVAVEGTAAMGPYWQSIVSDYLEKIIRCFCVNELAGQTSASNVELSLVTFNTHGSYCA------------------- 64 (833)
Q Consensus 4 ~dvVFVID~Tasmg~y~~~lkt~YI~p~le~f~~~~l~~~~~g~~~~~gLV~Y~d~~~~~~------------------- 64 (833)
.|||||||+|+||++||+.+|+. +..+++.+..- ...+|||+|.|+|+..-+.
T Consensus 6 vDl~Fv~D~TgSM~~~i~~vk~~-i~~i~~~l~~~-------~~~~r~g~~~f~D~~~~p~~~~~~~~~~~~p~~~~~~~ 77 (248)
T d1tyeb2 6 VDIYYLMDLSYSMKDDLWSIQNL-GTKLATQMRKL-------TSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTT 77 (248)
T ss_dssp EEEEEEEECSGGGGGGHHHHHHH-HHHHHHHHHHH-------CSCEEEEEEEECCCSSTTTSCCCSGGGGTCGGGGGTSC
T ss_pred eeEEEEEECCcCHHHHHHHHHHH-HHHHHHHHHhh-------CcCceEEEEEEEecccCccccccchhhccCcccccccc
Confidence 69999999999999999999986 46777777641 1248999999999864321
Q ss_pred ----cce-eeccCCCCHHHHHHHHccCccCCCCCchhHHHHHHHHHHhc---cccCCCCCCCCCCcCCCcEEEEeecCCC
Q 003297 65 ----CLV-QRSGWTKDVDIFLHWLSTIPFAGGGFNDAAIAEGLSEALMM---FSVAPNGSQNQQNVDGQRHCILVAASNP 136 (833)
Q Consensus 65 ----~lv-~~~gfT~d~~~fl~~Ld~I~f~GGG~~~~AvaEGLa~AL~~---f~~~~~~~~~~~~~~~qk~cILIa~SpP 136 (833)
|.. ..+.||+|.++|..+|+++...||||.+|++.+||..|+.| +.|++ +..|.+|||+|+||
T Consensus 78 ~~~~f~~~~~~~~t~d~~~f~~~l~~~~~~GggD~pE~~~~Al~~a~~~~~~i~Wr~---------~a~r~viliTDA~~ 148 (248)
T d1tyeb2 78 CLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRN---------DASHLLVFTTDAKT 148 (248)
T ss_dssp CCCCCSEEEEEEEESCHHHHHHHHTTCCCCCCSSSSBCHHHHHHHHHHCHHHHTCCT---------TSEEEEEEEESSCB
T ss_pred ccccccceecCCCCCCHHHHHHHHhheecccCCCCcchHHHHHHHHHHHhhhCCCCC---------CccEEEEEECCCCc
Confidence 111 23578999999999999999999999999999999998854 45533 45689999999999
Q ss_pred CCCCCCc---------ccCCccccccccchhhhhcccCCCHHHHHHHHhhcCcEEEE-eccCcchhHHHHHHHh
Q 003297 137 HPLPTPV---------YRPQMQNLDQNENNEAQAESRLSDAETVAKSFVQCSVSLSV-ICPKQLPKLTAIYNAA 200 (833)
Q Consensus 137 ~~lp~pv---------y~p~~~~~~~~e~~~~~~~~~l~d~e~la~~~~e~~I~LSv-IsPrklp~l~~lf~ka 200 (833)
|.....- ....+. ..++-++ ......-.+++|++.+.+++|.+.+ +..+....+++|.+.-
T Consensus 149 H~~~d~~l~g~~~~~d~~~~~~--~~~~~~~-~~~~dyps~~ql~~~l~~~~i~~ifavt~~~~~~Y~~l~~~~ 219 (248)
T d1tyeb2 149 HIALDGRLAGIVQPNDGQCHVG--SDNHYSA-STTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELI 219 (248)
T ss_dssp CCTTGGGGGTCCSCCCCCCCBC--TTSBBGG-GGTSCCCCHHHHHHHHHHTTEEEEEEECGGGHHHHHHHHHTS
T ss_pred ccccccccccccccCCCccccC--CCCcccc-cccccCCCHHHHHHHHHHhCcEEEEEECchhhHHHHHHHHhc
Confidence 9755310 000000 0011111 1111223579999999999999655 5555567777777754
|
| >d1pt6a_ c.62.1.1 (A:) Integrin alpha1-beta1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v7pc_ c.62.1.1 (C:) Integrin alpha2-beta1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1atza_ c.62.1.1 (A:) von Willebrand factor A3 domain, vWA3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n3ya_ c.62.1.1 (A:) Integrin alpha-x beta2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1shux_ c.62.1.1 (X:) Capillary morphogenesis protein 2 domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ijba_ c.62.1.1 (A:) von Willebrand factor A1 domain, vWA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mf7a_ c.62.1.1 (A:) Integrin alpha M (CR3, CD11b/CD18, Mac-1 alpha subunit) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q0pa_ c.62.1.1 (A:) Complement factor B domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mjna_ c.62.1.1 (A:) Integrin CD11a/CD18 (Leukocyte function associated antigen-1, LFA-1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jeyb2 c.62.1.4 (B:6-241) Ku80 subunit N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jeya2 c.62.1.3 (A:34-253) Ku70 subunit N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2qtva3 c.62.1.2 (A:120-390) Sec23 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1pd0a3 c.62.1.2 (A:301-552) Sec24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1yvra2 c.62.1.5 (A:364-537) 60-kda SS-A/Ro ribonucleoprotein, RoRNP {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|