Citrus Sinensis ID: 003297


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830---
MSEKQLIVAVEGTAAMGPYWQSIVSDYLEKIIRCFCVNELAGQTSASNVELSLVTFNTHGSYCACLVQRSGWTKDVDIFLHWLSTIPFAGGGFNDAAIAEGLSEALMMFSVAPNGSQNQQNVDGQRHCILVAASNPHPLPTPVYRPQMQNLDQNENNEAQAESRLSDAETVAKSFVQCSVSLSVICPKQLPKLTAIYNAAKRNPRAADPPVDNSKNPHFLVLISENFMEARAALSRPGVANLAPNQNPVKMDIAPVTSVTGPAPTSIPSVNGINRPPISVGNVPTATVKVEPSTVTSMVNGPTFPHIPSVPRPASQGVPSLQTSSPSSTSQEMITSGDSVPEVKPLVSGMSQPLRPMAPAAANVNILNNLSQARQVMNNAALTGGTSIGLQSMGQTPMAMHMSNMISSGMASSVPTSQPVFSSAQSGITSIGGSGTLTGTSQVPQNSGLNSFTSAPSNLSGNSNPSISQPMGTLQGGASMGQSVGMSQGNHSGGQMVQNGISMNQNMMSGLGPSGVSSGTGTMIPTPGMSQQAQSGMQPLSVNNNTAVNMQLSQQTSSALHSSQSKYVKVWEGSLSGQRQGQPVFITKLEGYRSASASETLAANWPPTMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKKLCAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQISSQQQQQLQQQQQQQQHQQMQSQLQHQQLSQLQQQQQQLPQLQQQIPQLQQQQQIPQLQQQSMPQLQQQQQLPQLQQQQQLPQMQQQQQLPQLQQQQQLSQPQQMVGSGMGQGYVQGPGRTQLVSQGQVSSQGAPNIPGGGFMS
cccccEEEEEEccccccccHHHHHHHHHHHHHHHHcccccccccccccEEEEEEEEEcccccccccEEEccccccHHHHHHHHcccccccccccHHHHHHHHHHHHHHHcccccccccccccccccEEEEEccccccccccccccccccccccccccccccccccccHHHHHHHHHcccEEEEEEccccccHHHHHHHHHccccccccccccccccccEEEEEEcccHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEccccccccccccccEEEEEEcccccccccHHHcccccccccEEHHHHHcccccccccccccEEEEEcccccHHHHHHHHHHHcccccccccccEEEccccccccccccccccEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHcccHHHHHHHcccHHHHcccHHHHHHHHcHHHHHHcccHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccc
ccccEEEEEEEccHcccccHHHHHHHHHHHHHHHHccccccccccccccEEEEEEEEccccccccEEEEccccccHHHHHHHHHccccccccHcHHHHHHHHHHHHHHcccccccccccccccccEEEEEEEcccccccccccccccccccccccccccccccccccHHHHHHHHHcccEEEEEEcccHHHHHHHHHHHcccccccccccccccccccEEEEEcccHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEccccccccccccccccccccccccccccccccccccccccccccccccHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHcHHHHccHccccccccccccEEEEcccHcccccccccccccccEccccccccccccccccccccEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEcccccccccccEEEEEEEccccccccHHHHccccccHEEEEEEcHHHccccccccccEEEEEEccccccHHHHHHHcccEEEEEccccEEEEEcccccccEEEEEccccEEEEccccccHHHHHHcHHccccccHHHHHHHcccccHHHcccccccccHHccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccHHHHHHHcccccccccccccccccc
MSEKQLIVAVEgtaamgpywQSIVSDYLEKIIRCFCVnelagqtsasnVELSLVTFNTHGsycaclvqrsgwtkDVDIFLHWLstipfagggfndAAIAEGLSEALMMFsvapngsqnqqnvdgqRHCILVaasnphplptpvyrpqmqnldqnenNEAQAESRLSDAETVAKSFVQCSVslsvicpkqlpkLTAIYNAakrnpraadppvdnsknphFLVLISENFMEARAAlsrpgvanlapnqnpvkmdiapvtsvtgpaptsipsvnginrppisvgnvptatvkvepstvtsmvngptfphipsvprpasqgvpslqtsspsstsqemitsgdsvpevkplvsgmsqplrpmapaaaNVNILNNLSQARQVMNNAaltggtsiglqsmgqtpmaMHMSNMIssgmassvptsqpvfssaqsgitsiggsgtltgtsqvpqnsglnsftsapsnlsgnsnpsisqpmgtlqggasmgqsvgmsqgnhsggqmvQNGISMNqnmmsglgpsgvssgtgtmiptpgmsqqaqsgmqplsvnnnTAVNMQLSQQTSSALHSSQSKYVKVWegslsgqrqgqpvFITKlegyrsasasetlaanwpptMQIVRLISQdhmnnkqyvgkaDFLVFRAMNQHGFLGQLQEKKLCAVIQLPSQTLLLSVSDKACRLIgmlfpgdmvvfkpqisSQQQQQLQQQQQQQQHQQMQSQLQHQQLSQLQQQQQQLPQLQQQIPQLqqqqqipqlqqqsmpqlqqqqqlpqlqqqqqlpqmqqqqqlpqlqqqqqlsqpqqmvgsgmgqgyvqgpgrtqlvsqgqvssqgapnipgggfms
MSEKQLIVAvegtaamgpyWQSIVSDYLEKIIRCFCVNELAGQTSASNVELSLVTFNTHGSYCACLVQRSGWTKDVDIFLHWLSTIPFAGGGFNDAAIAEGLSEALMMFSVAPNGSQNQQNVDGQRHCILVAASNPHPLPTPVYRPQMQNLDQNENNEAQAESRLSDAETVAKSFVQCSVslsvicpkqlPKLTAIYNAAKRnpraadppvdnskNPHFLVLISENFMEARAALSRPGVANLAPNQNPVKMDIAPVTSVTGPAPTsipsvnginrppiSVGNVPTATVKVEPSTVTSMVNGPTFPHIPSVPRPASQGVPSLQTSSPSSTSQEMITSGDSVPEVKPLVSGMSQPLRPMAPAAANVNILNNLSQARQVMNNAALTGGTSIGLQSMGQTPMAMHMSNMISSGMASSVPTSQPVFSSAQSGITSIGGSGTLTGTSQVPQNSGLNSFTSAPSNLSGNSNPSISQPMGTLQGGASMGQSVGMSQGNHSGGQMVQNGISMNQNMMSGLGPSGVSSGTGTMIPTPGMSQQAQSGMQPLSVNNNTAVNMQLSQQTSSALHSSQSKYVKVWEgslsgqrqgqPVFITKLEGYRSASASetlaanwppTMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKKLCAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQISSQQQQQLQQQQQQQQHQQMQSQLQHQQLSQLQQQQQQLPQLQQQIPQLQQQQQIPQLQQQSMPQLQQQQQLPQLQQQQQLPQMQQQQQLPQLQQQQQLSQPQQMVGSGMGQGYVQGPGRTQLVSqgqvssqgapnipgggfms
MSEKQLIVAVEGTAAMGPYWQSIVSDYLEKIIRCFCVNELAGQTSASNVELSLVTFNTHGSYCACLVQRSGWTKDVDIFLHWLSTIPFAGGGFNDAAIAEGLSEALMMFSVAPNGSQNQQNVDGQRHCILVAASNPHPLPTPVYRPQMQNLDQNENNEAQAESRLSDAETVAKSFVQCSVSLSVICPKQLPKLTAIYNAAKRNPRAADPPVDNSKNPHFLVLISENFMEARAALSRPGVANLAPNQNPVKMDIAPVTSVTGPAPTSIPSVNGINRPPISVGNVPTATVKVEPSTVTSMVNGPTFPHIPSVPRPASQGVpslqtsspsstsqEMITSGDSVPEVKPLVSGMSQPLRPMAPAAANVNILNNLSQARQVMNNAALTGGTSIGLQSMGQTPMAMHMSNMISSGMASSVPTSQPVFSSAQsgitsiggsgtltgtsQVPQNSGLNSFTSAPSNLSGNSNPSISQPMGTLQGGASMGQSVGMSQGNHSGGQMVQNGISMNQNMMSGLGPSGVSSGTGTMIPTPGMSQQAQSGMQPLSVNNNTAVNMQLSQQTSSALHSSQSKYVKVWEGSLSGQRQGQPVFITKLEGYRSASASETLAANWPPTMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKKLCAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKpqissqqqqqlqqqqqqqqhqqmqsqlqhqqlsqlqqqqqqlpqlqqqipqlqqqqqipqlqqqsmpqlqqqqqlpqlqqqqqlpqmqqqqqlpqlqqqqqlsqpqqMVGSGMGQGYVQGPGRTQLvsqgqvssqgAPNIPGGGFMS
*****LIVAVEGTAAMGPYWQSIVSDYLEKIIRCFCVNELAGQTSASNVELSLVTFNTHGSYCACLVQRSGWTKDVDIFLHWLSTIPFAGGGFNDAAIAEGLSEALMMFSV**************RHCILVA**************************************VAKSFVQCSVSLSVICPKQLPKLTAIYNA******************HFLVLISENFMEAR**************************************************************************************************************************************IL********************************************************************************************************************************************************************************************************VKVWE**********PVFITKLEGYRSASASETLAANWPPTMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKKLCAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFK***************************************************************************************************************************************************
*SEKQLIVAVEGTAAMGPYWQSIVSDYLEKIIRCFCVNELAGQTSASNVELSLVTFNTHGSYCACLVQRSGWTKDVDIFLHWLSTIPFAGGGFNDAAIAEGLSEALMMFS*****************CILVAASNPHPLPTPVYRPQMQNLD****NEAQAESRLSDAETVAKSFVQCSVSLSVICPKQLPKLTAIYN**************NSKNPHFLVLIS*************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************QIVRLIS**********GKADFLVFRAM*********************************************************************************************************************************************************************************************P******
MSEKQLIVAVEGTAAMGPYWQSIVSDYLEKIIRCFCVNELAGQTSASNVELSLVTFNTHGSYCACLVQRSGWTKDVDIFLHWLSTIPFAGGGFNDAAIAEGLSEALMMFSVAPNGSQNQQNVDGQRHCILVAASNPHPLPTPVYRPQMQNLDQ****************TVAKSFVQCSVSLSVICPKQLPKLTAIYNAAKRNPRAADPPVDNSKNPHFLVLISENFMEARAALSRPGVANLAPNQNPVKMDIAPVTSVTGPAPTSIPSVNGINRPPISVGNVPTATVKVEPSTVTSMVNGPTFPHIPSVP***************************SVPEVKPLVSGMSQPLRPMAPAAANVNILNNLSQARQVMNNAALTGGTSIGLQSMGQTPMAMHMSNMISSG*****************GITSIGGSGTLTGTSQVPQNSGLNSFTSAPSNLSGNSNPSISQPMGTLQGGASMGQSVGMSQGNHSGGQMVQNGISMNQNMMSGLGPSGVSSGTGTMIPTP**********QPLSVNNNTAVNMQ****************VKVWEGSLSGQRQGQPVFITKLEGYRSASASETLAANWPPTMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKKLCAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKP**************************************************************************************************************GMGQGYVQGPGRTQ**********GAPNIPGGGFMS
**EKQLIVAVEGTAAMGPYWQSIVSDYLEKIIRCFCVNELAGQTSASNVELSLVTFNTHGSYCACLVQRSGWTKDVDIFLHWLSTIPFAGGGFNDAAIAEGLSEALMMFSVAPNGSQNQQNVDGQRHCILVAASNPHPLPTPVYRPQMQNLDQ*******AESRLSDAETVAKSFVQCSVSLSVICPKQLPKLTAIYNAAKRNPRAADPPVDNSKNPHFLVLISENFMEARAALSR*******************************************VGNVPTATVKVEPSTVTSMVNGP****************************************VKP*VSGMSQPLRPMAPAAANVNILNNLSQARQVMNNAALTGGTSIGLQSMGQTPMAMHMS************TSQPV************GSGTLTGTSQV**********************SISQPMGT*****S******************************************TMIPTPGMSQ********************************QSKYVKVWEGSLSGQRQGQPVFITKLEGYRSASASETLAANWPPTMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKKLCAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQISSQQQQQLQ***************************************************************************************************************************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSEKQLIVAVEGTAAMGPYWQSIVSDYLEKIIRCFCVNELAGQTSASNVELSLVTFNTHGSYCACLVQRSGWTKDVDIFLHWLSTIPFAGGGFNDAAIAEGLSEALMMFSVAPNGSQNQQNVDGQRHCILVAASNPHPLPTPVYRPQMQNxxxxxxxxxxxxxxxxxxxxxAKSFVQCSVSLSVICPKQLPKLTAIYNAAKRNPRAADPPVDNSKNPHFLVLISENFMEARAALSRPGVANLAPNQNPVKMDIAPVTSVTGPAPTSIPSVNGINRPPISVGNVPTATVKVEPSTVTSMVNGPTFPHIPSVPRPASQGVPSLQTSSPSSTSQEMITSGDSVPEVKPLVSGMSQPLRPMAPAAANVNILNNLSQARQVMNNAALTGGTSIGLQSMGQTPMAMHMSNMISSGMASSVPTSQPVFSSAQSGITSIGGSGTLTGTSQVPQNSGLNSFTSAPSNLSGNSNPSISQPMGTLQGGASMGQSVGMSQGNHSGGQMVQNGISMNQNMMSGLGPSGVSSGTGTMIPTPGMSQQAQSGMQPLSVNNNTAVNMQLSQQTSSALHSSQSKYVKVWEGSLSGQRQGQPVFITKLEGYRSASASETLAANWPPTMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKKLCAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQISSQQQQQLQQQQQQQQHQQMQSQLxxxxxxxxxxxxxxxxxxxxxxxxxxxxQQIPQLQQQSMPQLQQQQQLPQLQQQQQLPQMQQQQQLPQLQQQQQLSQPQQMVGSGMGQGYVQGPGRTQLVSQGQVSSQGAPNIPGGGFMS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query833 2.2.26 [Sep-21-2011]
Q7XYY2836 Mediator of RNA polymeras yes no 0.799 0.796 0.669 0.0
Q6GP15801 Mediator of RNA polymeras N/A no 0.254 0.264 0.285 3e-18
A4IHD9805 Mediator of RNA polymeras yes no 0.254 0.263 0.289 6e-18
A2VE44746 Mediator of RNA polymeras yes no 0.234 0.261 0.285 1e-14
Q8VCB2745 Mediator of RNA polymeras yes no 0.235 0.263 0.278 2e-14
Q71SY5747 Mediator of RNA polymeras yes no 0.234 0.261 0.281 6e-14
Q9VDR1863 Mediator of RNA polymeras yes no 0.248 0.239 0.228 9e-07
>sp|Q7XYY2|MED25_ARATH Mediator of RNA polymerase II transcription subunit 25 OS=Arabidopsis thaliana GN=MED25 PE=1 SV=1 Back     alignment and function desciption
 Score =  870 bits (2247), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 464/693 (66%), Positives = 550/693 (79%), Gaps = 27/693 (3%)

Query: 4   KQLIVAVEGTAAMGPYWQSIVSDYLEKIIRCFCVNELAGQTS-ASNVELSLVTFNTHGSY 62
           KQLIV  EGTAA+GPYWQ+IVSDYLEKIIR FC +EL G+ +  S VELSLV FN+HGSY
Sbjct: 6   KQLIVVAEGTAALGPYWQTIVSDYLEKIIRSFCGSELNGERNPVSTVELSLVIFNSHGSY 65

Query: 63  CACLVQRSGWTKDVDIFLHWLSTIPFAGGGFNDAAIAEGLSEALMMFSVAPNGSQNQQNV 122
           CACLVQRSGWT+DVDIFLHWLS+I F GGGFN+ A AEGL+EALMMFS  P   Q Q + 
Sbjct: 66  CACLVQRSGWTRDVDIFLHWLSSIQFGGGGFNEVATAEGLAEALMMFS--PPSGQAQPSN 123

Query: 123 DGQRHCILVAASNPHPLPTPVYRPQMQNLDQNENNEAQAESRLSDAETVAKSFVQCSVSL 182
           D +RHCIL+ ASNPH LPTPVYRP++QN+++NEN +AQAESRLSDAETVA  F +CSVSL
Sbjct: 124 DLKRHCILITASNPHILPTPVYRPRLQNVERNENGDAQAESRLSDAETVASYFAKCSVSL 183

Query: 183 SVICPKQLPKLTAIYNAAKRNPRAADPPVDNSKNPHFLVLISENFMEARAALSRPGVANL 242
           SV+CPKQLP + A+YNA K N ++AD  +D +KN  +LVLISENF+EA AALS     NL
Sbjct: 184 SVVCPKQLPTIRALYNAGKPNQQSADLSIDTAKNTFYLVLISENFVEACAALSH-SATNL 242

Query: 243 APNQNPVKMD---IAPVTSVTGPAPTSIPSVNGI--NRPPISVGNVPTATVKVEPSTVTS 297
              Q+PVK+D   +AP   VTG  P  + S NG   NR P+SVG VPTATVKVEPSTVTS
Sbjct: 243 PQTQSPVKVDRATVAPSIPVTGQPPAPVSSANGPIQNRQPVSVGPVPTATVKVEPSTVTS 302

Query: 298 MVNGPTFPHIPSVPRPASQGVPSLQTSSPSSTSQEMITSGDSVPEVKPLV-SGMSQPLRP 356
           M   P+FPHIP+V RPA+Q +PS+QTSS S  SQ+M+++ ++ P++KP+V SGM+ PLR 
Sbjct: 303 MAPVPSFPHIPAVARPATQAIPSIQTSSASPVSQDMVSNAENAPDIKPVVVSGMTPPLRT 362

Query: 357 MAPAAANVNILNNLSQARQVMNNAALTGGTSIGLQSMGQTPMAMHMSNMISSGMASSVPT 416
             P  ANVN+LNNLSQ RQVM++AA     +    S+GQ+ +AMHMSNMIS+GMA+S+P 
Sbjct: 363 GPPGGANVNLLNNLSQVRQVMSSAA----LAGAASSVGQSAVAMHMSNMISTGMATSLPP 418

Query: 417 SQPVFSSAQSGITSIGGSGTLTGTSQVPQNSGLNSFTSAPSNLSGNSNPSISQPMGTLQG 476
           SQ VFS+ Q GITS+ GSG L G++Q  Q+ G N+  S  +  +  SN  +SQPM     
Sbjct: 419 SQTVFSTGQQGITSMAGSGALMGSAQTGQSPGPNNAFSPQTTSNVASNLGVSQPMQ---- 474

Query: 477 GASMGQSVGMSQGNHSGGQMVQNGISMNQNMMSGLGPSGVSSGTGTMIPTPGMSQQAQSG 536
                   GM+QG+HSG  M+Q GISMNQNMMSGLG   VSSGTG M+PTPG+ QQAQSG
Sbjct: 475 --------GMNQGSHSGA-MMQGGISMNQNMMSGLGQGNVSSGTGGMMPTPGVGQQAQSG 525

Query: 537 MQPLSVNNNTAVNMQLSQQTSSALHSSQSKYVKVWEGSLSGQRQGQPVFITKLEGYRSAS 596
           +Q L  +N++A NMQLSQ +S A+ +SQSKYVKVWEG+LSGQRQGQPV IT+LEGYRSAS
Sbjct: 526 IQQLGGSNSSAPNMQLSQPSSGAMQTSQSKYVKVWEGNLSGQRQGQPVLITRLEGYRSAS 585

Query: 597 ASETLAANWPPTMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKKLCAVIQ 656
           AS++LAANWPPTMQIVRLISQDHMNNKQYVGKADFLVFRAM+QHGFLGQLQ+KKLCAVIQ
Sbjct: 586 ASDSLAANWPPTMQIVRLISQDHMNNKQYVGKADFLVFRAMSQHGFLGQLQDKKLCAVIQ 645

Query: 657 LPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQI 689
           LPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQI
Sbjct: 646 LPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQI 678




Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. Positive regulator of shade avoidance and of jasmonate signaling. Acts in repression of PhyB-mediated light signaling and regulates the expression of FLOWERING LOCUS T (FT) and of CONSTANS (CO).
Arabidopsis thaliana (taxid: 3702)
>sp|Q6GP15|MED25_XENLA Mediator of RNA polymerase II transcription subunit 25 OS=Xenopus laevis GN=med25 PE=2 SV=1 Back     alignment and function description
>sp|A4IHD9|MED25_XENTR Mediator of RNA polymerase II transcription subunit 25 OS=Xenopus tropicalis GN=med25 PE=2 SV=1 Back     alignment and function description
>sp|A2VE44|MED25_BOVIN Mediator of RNA polymerase II transcription subunit 25 OS=Bos taurus GN=MED25 PE=2 SV=1 Back     alignment and function description
>sp|Q8VCB2|MED25_MOUSE Mediator of RNA polymerase II transcription subunit 25 OS=Mus musculus GN=Med25 PE=1 SV=1 Back     alignment and function description
>sp|Q71SY5|MED25_HUMAN Mediator of RNA polymerase II transcription subunit 25 OS=Homo sapiens GN=MED25 PE=1 SV=2 Back     alignment and function description
>sp|Q9VDR1|MED25_DROME Mediator of RNA polymerase II transcription subunit 25 OS=Drosophila melanogaster GN=MED25 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query833
225423909827 PREDICTED: uncharacterized protein LOC10 0.828 0.834 0.815 0.0
297737854815 unnamed protein product [Vitis vinifera] 0.815 0.833 0.803 0.0
224111730796 predicted protein [Populus trichocarpa] 0.818 0.856 0.798 0.0
449434652858 PREDICTED: mediator of RNA polymerase II 0.811 0.787 0.725 0.0
356502460879 PREDICTED: uncharacterized protein LOC10 0.813 0.771 0.727 0.0
312283021852 unnamed protein product [Thellungiella h 0.797 0.779 0.678 0.0
30689268836 phytochrome and flowering time regulator 0.799 0.796 0.669 0.0
297845606832 hypothetical protein ARALYDRAFT_472815 [ 0.799 0.800 0.673 0.0
255576521561 conserved hypothetical protein [Ricinus 0.633 0.941 0.779 0.0
449519677595 PREDICTED: mediator of RNA polymerase II 0.707 0.989 0.689 0.0
>gi|225423909|ref|XP_002278845.1| PREDICTED: uncharacterized protein LOC100259509 [Vitis vinifera] Back     alignment and taxonomy information
 Score = 1098 bits (2839), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 565/693 (81%), Positives = 622/693 (89%), Gaps = 3/693 (0%)

Query: 1   MSEKQLIVAVEGTAAMGPYWQSIVSDYLEKIIRCFCVNELAGQT-SASNVELSLVTFNTH 59
           M+EKQL+VAVEGTAAMGPYWQ++VSDYL+KIIR FC NELAGQ  S+SN ELSLV FN H
Sbjct: 1   MAEKQLVVAVEGTAAMGPYWQAVVSDYLDKIIRYFCGNELAGQKPSSSNFELSLVMFNAH 60

Query: 60  GSYCACLVQRSGWTKDVDIFLHWLSTIPFAGGGFNDAAIAEGLSEALMMFSVAPNGSQNQ 119
           GSYC+CLVQRSGWT+DVD+FL WLS +PFAGGGFNDAAIAEGL+EALMMFSVA NGSQ Q
Sbjct: 61  GSYCSCLVQRSGWTRDVDLFLQWLSALPFAGGGFNDAAIAEGLAEALMMFSVAANGSQTQ 120

Query: 120 QNVDGQRHCILVAASNPHPLPTPVYRPQMQNLDQNENNEAQAESRLSDAETVAKSFVQCS 179
           QNVDGQRHCILVAA+NP+PLPTPVY+PQMQN++QNE+ E+Q ESRLSDAE VAKSF QCS
Sbjct: 121 QNVDGQRHCILVAANNPYPLPTPVYQPQMQNMEQNESIESQTESRLSDAEAVAKSFAQCS 180

Query: 180 VSLSVICPKQLPKLTAIYNAAKRNPRAADPPVDNSKNPHFLVLISENFMEARAALSRPGV 239
           VSLSVICPKQLPKL +IYNA KRNPR ADPPVDN KNPHFLVLIS++FMEARAALSRPG+
Sbjct: 181 VSLSVICPKQLPKLKSIYNAGKRNPRVADPPVDNVKNPHFLVLISDSFMEARAALSRPGL 240

Query: 240 ANLAPNQNPVKMDIAPVTSVTGPAPTSIPSVNGI-NRPPISVGNVPTATVKVEPSTVTSM 298
           +N+  NQ+PVKMDIA V  V+   P SIPSVNGI NRP I+VG VPTATVKVEPSTVTS+
Sbjct: 241 SNMTANQSPVKMDIASVPQVSAAPPASIPSVNGIMNRPTIAVGAVPTATVKVEPSTVTSI 300

Query: 299 VNGPTFPHIPSVPRPASQGVPSLQTSSPSSTSQEMITSGDSVPEVKPLVSGMSQPLRPMA 358
            +GP FPHIPSVPR ASQGVPSLQTSSPSSTSQEMI++GD+V ++KP+VSG+SQ LRP+ 
Sbjct: 301 TSGPGFPHIPSVPRAASQGVPSLQTSSPSSTSQEMISNGDNVQDLKPIVSGISQTLRPVV 360

Query: 359 PAAANVNILNNLSQARQVMNNAALTGGTSIGLQSMGQTPMAMHMSNMISSGMASSVPTSQ 418
           PAAANV+ILNNLSQARQVM++AAL+GGTSIGLQSMG T MAMHMSNMISSGMASSVP +Q
Sbjct: 361 PAAANVSILNNLSQARQVMHSAALSGGTSIGLQSMGGTSMAMHMSNMISSGMASSVPATQ 420

Query: 419 PVFSSAQSGITSIGGSGTLTGTSQVPQNSGLNSFTSAPSNLSGNSNPSISQPMGTLQGGA 478
            VFSS QS ++SI GSGTL GT+QV QNS L SFTSA SN+S NSN  ISQP+  LQGG 
Sbjct: 421 TVFSSGQSAVSSITGSGTLAGTAQVAQNSALGSFTSATSNMSVNSNLGISQPLSNLQGGV 480

Query: 479 SMGQSV-GMSQGNHSGGQMVQNGISMNQNMMSGLGPSGVSSGTGTMIPTPGMSQQAQSGM 537
           SMGQ+V GMSQGN  GGQMVQ+GI MNQNMMSGLGPSG+SSGTGTMIPTPGMSQQ Q GM
Sbjct: 481 SMGQTVPGMSQGNLPGGQMVQSGIGMNQNMMSGLGPSGISSGTGTMIPTPGMSQQVQPGM 540

Query: 538 QPLSVNNNTAVNMQLSQQTSSALHSSQSKYVKVWEGSLSGQRQGQPVFITKLEGYRSASA 597
             L VNNN A NM L QQTS A+ ++QSKYVKVWEG+LSGQRQGQPVFIT+LEGYRSASA
Sbjct: 541 PSLGVNNNAAANMPLPQQTSGAMQTAQSKYVKVWEGNLSGQRQGQPVFITRLEGYRSASA 600

Query: 598 SETLAANWPPTMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKKLCAVIQL 657
           SE+LAANWP TMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKKLCAVIQL
Sbjct: 601 SESLAANWPATMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKKLCAVIQL 660

Query: 658 PSQTLLLSVSDKACRLIGMLFPGDMVVFKPQIS 690
           PSQTLLLSVSDKACRLIGMLFPGDMVVFKPQI+
Sbjct: 661 PSQTLLLSVSDKACRLIGMLFPGDMVVFKPQIT 693




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|297737854|emb|CBI27055.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224111730|ref|XP_002315956.1| predicted protein [Populus trichocarpa] gi|222864996|gb|EEF02127.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449434652|ref|XP_004135110.1| PREDICTED: mediator of RNA polymerase II transcription subunit 25-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356502460|ref|XP_003520037.1| PREDICTED: uncharacterized protein LOC100801664 [Glycine max] Back     alignment and taxonomy information
>gi|312283021|dbj|BAJ34376.1| unnamed protein product [Thellungiella halophila] Back     alignment and taxonomy information
>gi|30689268|ref|NP_173925.3| phytochrome and flowering time regulatory protein 1 [Arabidopsis thaliana] gi|75145501|sp|Q7XYY2.1|MED25_ARATH RecName: Full=Mediator of RNA polymerase II transcription subunit 25; Short=AtMED25; AltName: Full=Phytochrome and flowering time 1 protein; AltName: Full=Phytochrome and flowering time regulatory protein 1 gi|32478899|gb|AAO39425.1| phytochrome and flowering time 1 protein [Arabidopsis thaliana] gi|332192518|gb|AEE30639.1| phytochrome and flowering time regulatory protein 1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297845606|ref|XP_002890684.1| hypothetical protein ARALYDRAFT_472815 [Arabidopsis lyrata subsp. lyrata] gi|297336526|gb|EFH66943.1| hypothetical protein ARALYDRAFT_472815 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|255576521|ref|XP_002529152.1| conserved hypothetical protein [Ricinus communis] gi|223531431|gb|EEF33265.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|449519677|ref|XP_004166861.1| PREDICTED: mediator of RNA polymerase II transcription subunit 25-like, partial [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query833
TAIR|locus:2031200836 PFT1 "PHYTOCHROME AND FLOWERIN 0.794 0.791 0.622 1.6e-219
UNIPROTKB|F1N3D4743 MED25 "Mediator of RNA polymer 0.154 0.173 0.328 2.3e-12
UNIPROTKB|F1RHT9746 MED25 "Uncharacterized protein 0.154 0.172 0.328 6.4e-12
MGI|MGI:1922863745 Med25 "mediator of RNA polymer 0.154 0.173 0.328 7.3e-12
UNIPROTKB|A2VE44746 MED25 "Mediator of RNA polymer 0.154 0.172 0.328 7.3e-12
UNIPROTKB|Q71SY5747 MED25 "Mediator of RNA polymer 0.154 0.172 0.328 3.1e-10
ZFIN|ZDB-GENE-040426-2850701 med25 "mediator of RNA polymer 0.289 0.343 0.266 6.3e-10
DICTYBASE|DDB_G0286967 1553 med25 "putative mediator compl 0.145 0.077 0.276 8.6e-08
WB|WBGene00019435 2232 K06A9.1 [Caenorhabditis elegan 0.385 0.143 0.219 1.2e-05
FB|FBgn0038760863 MED25 "Mediator complex subuni 0.214 0.207 0.225 2.6e-05
TAIR|locus:2031200 PFT1 "PHYTOCHROME AND FLOWERING TIME 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2080 (737.3 bits), Expect = 1.6e-219, Sum P(2) = 1.6e-219
 Identities = 430/691 (62%), Positives = 513/691 (74%)

Query:     4 KQLIVAVEGTAAMGPYWQSIVSDYLEKIIRCFCVNELAGQTS-ASNVELSLVTFNTHGSY 62
             KQLIV  EGTAA+GPYWQ+IVSDYLEKIIR FC +EL G+ +  S VELSLV FN+HGSY
Sbjct:     6 KQLIVVAEGTAALGPYWQTIVSDYLEKIIRSFCGSELNGERNPVSTVELSLVIFNSHGSY 65

Query:    63 CACLVQRSGWTKDVDIFLHWLSTIPFAGGGFNDAAIAEGLSEALMMFSVAPNGSQNQQNV 122
             CACLVQRSGWT+DVDIFLHWLS+I F GGGFN+ A AEGL+EALMMFS  P+G Q Q + 
Sbjct:    66 CACLVQRSGWTRDVDIFLHWLSSIQFGGGGFNEVATAEGLAEALMMFS-PPSG-QAQPSN 123

Query:   123 DGQRHCILVAASNPHPLPTPVYRPQMQNLDQNENNEAQAESRLSDAETVAKSFVQCSVSL 182
             D +RHCIL+ ASNPH LPTPVYRP++QN+++NEN +AQAESRLSDAETVA  F +CSVSL
Sbjct:   124 DLKRHCILITASNPHILPTPVYRPRLQNVERNENGDAQAESRLSDAETVASYFAKCSVSL 183

Query:   183 SVICPKQLPKLTAIYNAAKRNPRAADPPVDNSKNPHFLVLISENFMEARAALSRPGVANL 242
             SV+CPKQLP + A+YNA K N ++AD  +D +KN  +LVLISENF+EA AALS     NL
Sbjct:   184 SVVCPKQLPTIRALYNAGKPNQQSADLSIDTAKNTFYLVLISENFVEACAALSH-SATNL 242

Query:   243 APNQNPVKMD---IAPVTSVTGPAPTSIPSVNGI--NRPPISVGNVPTATVKVEPSTVTS 297
                Q+PVK+D   +AP   VTG  P  + S NG   NR P+SVG VPTATVKVEPSTVTS
Sbjct:   243 PQTQSPVKVDRATVAPSIPVTGQPPAPVSSANGPIQNRQPVSVGPVPTATVKVEPSTVTS 302

Query:   298 MVNGPTFPHIPSVPRPASQGVXXXXXXXXXXXXXEMITSGDSVPEVKPLVSGMSQPLRPM 357
             M   P+FPHIP+V RPA+Q +             +M+++ ++ P++KP+V     P    
Sbjct:   303 MAPVPSFPHIPAVARPATQAIPSIQTSSASPVSQDMVSNAENAPDIKPVVVSGMTPPLRT 362

Query:   358 APAAANVNILNNLSQARQVMN--NAALTGGTSIGLQSMGQTPMAMHMSNMISSGMASSVP 415
              P     N+ N L+   QV    ++A   G +    S+GQ+ +AMHMSNMIS+GMA+S+P
Sbjct:   363 GPPGG-ANV-NLLNNLSQVRQVMSSAALAGAA---SSVGQSAVAMHMSNMISTGMATSLP 417

Query:   416 TSQPVFSSAQXXXXXXXXXXXXXXXXQVPQNSGLNSFTSAPSNLSGNSNPSISQPMGTLQ 475
              SQ VFS+ Q                Q  Q+ G N+  S  +  +  SN  +SQPM    
Sbjct:   418 PSQTVFSTGQQGITSMAGSGALMGSAQTGQSPGPNNAFSPQTTSNVASNLGVSQPMQ--- 474

Query:   476 GGASMGQSVGMSQGNHSGGQMVQNGISMNQNMMSGLGPSGVSSGTGTMIPTPGMSQQAQS 535
                      GM+QG+HSG  M+Q GISMNQNMMSGLG   VSSGTG M+PTPG+ QQAQS
Sbjct:   475 ---------GMNQGSHSGA-MMQGGISMNQNMMSGLGQGNVSSGTGGMMPTPGVGQQAQS 524

Query:   536 GMQPLSVNNNTAVNMQLSQQTSSALHSSQSKYVKVWEGSLSGQRQGQPVFITKLEGYRSA 595
             G+Q L  +N++A NMQLSQ +S A+ +SQSKYVKVWEG+LSGQRQGQPV IT+LEGYRSA
Sbjct:   525 GIQQLGGSNSSAPNMQLSQPSSGAMQTSQSKYVKVWEGNLSGQRQGQPVLITRLEGYRSA 584

Query:   596 SASETLAANWPPTMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKKLCAVI 655
             SAS++LAANWPPTMQIVRLISQDHMNNKQYVGKADFLVFRAM+QHGFLGQLQ+KKLCAVI
Sbjct:   585 SASDSLAANWPPTMQIVRLISQDHMNNKQYVGKADFLVFRAMSQHGFLGQLQDKKLCAVI 644

Query:   656 QLPSQTLLLSVSDKACRLIGMLFPGDMVVFK 686
             QLPSQTLLLSVSDKACRLIGMLFPGDMVVFK
Sbjct:   645 QLPSQTLLLSVSDKACRLIGMLFPGDMVVFK 675


GO:0005634 "nucleus" evidence=ISM;IDA
GO:0003713 "transcription coactivator activity" evidence=NAS
GO:0010114 "response to red light" evidence=IMP
GO:0010218 "response to far red light" evidence=IMP
GO:0045893 "positive regulation of transcription, DNA-dependent" evidence=IMP
GO:0016592 "mediator complex" evidence=IDA
GO:0009909 "regulation of flower development" evidence=IMP
GO:0009585 "red, far-red light phototransduction" evidence=IMP
GO:0009867 "jasmonic acid mediated signaling pathway" evidence=IMP
GO:0031349 "positive regulation of defense response" evidence=IMP
GO:0050832 "defense response to fungus" evidence=IMP
GO:0009911 "positive regulation of flower development" evidence=IMP
GO:0003677 "DNA binding" evidence=IDA
GO:0005515 "protein binding" evidence=IPI
UNIPROTKB|F1N3D4 MED25 "Mediator of RNA polymerase II transcription subunit 25" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1RHT9 MED25 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1922863 Med25 "mediator of RNA polymerase II transcription, subunit 25 homolog (yeast)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|A2VE44 MED25 "Mediator of RNA polymerase II transcription subunit 25" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q71SY5 MED25 "Mediator of RNA polymerase II transcription subunit 25" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-2850 med25 "mediator of RNA polymerase II transcription, subunit 25 homolog (yeast)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0286967 med25 "putative mediator complex subunit 25" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
WB|WBGene00019435 K06A9.1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
FB|FBgn0038760 MED25 "Mediator complex subunit 25" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q7XYY2MED25_ARATHNo assigned EC number0.66950.79950.7966yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
fgenesh4_pg.C_LG_X001175
hypothetical protein (796 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query833
pfam11265226 pfam11265, Med25_VWA, Mediator complex subunit 25 4e-67
pfam13779 820 pfam13779, DUF4175, Domain of unknown function (DU 1e-15
pfam13779 820 pfam13779, DUF4175, Domain of unknown function (DU 9e-15
pfam13779 820 pfam13779, DUF4175, Domain of unknown function (DU 2e-14
pfam09770 804 pfam09770, PAT1, Topoisomerase II-associated prote 2e-14
pfam09770 804 pfam09770, PAT1, Topoisomerase II-associated prote 3e-14
pfam09770 804 pfam09770, PAT1, Topoisomerase II-associated prote 5e-14
pfam09770 804 pfam09770, PAT1, Topoisomerase II-associated prote 2e-13
pfam09770 804 pfam09770, PAT1, Topoisomerase II-associated prote 3e-13
pfam13779820 pfam13779, DUF4175, Domain of unknown function (DU 2e-12
pfam13779 820 pfam13779, DUF4175, Domain of unknown function (DU 6e-11
pfam09770 804 pfam09770, PAT1, Topoisomerase II-associated prote 8e-11
pfam09770 804 pfam09770, PAT1, Topoisomerase II-associated prote 9e-11
pfam13779820 pfam13779, DUF4175, Domain of unknown function (DU 1e-10
pfam09770 804 pfam09770, PAT1, Topoisomerase II-associated prote 5e-10
pfam09606 768 pfam09606, Med15, ARC105 or Med15 subunit of Media 2e-09
pfam09606 768 pfam09606, Med15, ARC105 or Med15 subunit of Media 2e-09
pfam09606 768 pfam09606, Med15, ARC105 or Med15 subunit of Media 3e-09
pfam09770 804 pfam09770, PAT1, Topoisomerase II-associated prote 4e-09
PRK09510 387 PRK09510, tolA, cell envelope integrity inner memb 6e-09
pfam09606 768 pfam09606, Med15, ARC105 or Med15 subunit of Media 9e-09
pfam09606 768 pfam09606, Med15, ARC105 or Med15 subunit of Media 1e-08
COG3064 387 COG3064, TolA, Membrane protein involved in colici 1e-08
PRK00286438 PRK00286, xseA, exodeoxyribonuclease VII large sub 1e-08
pfam11498476 pfam11498, Activator_LAG-3, Transcriptional activa 1e-08
pfam09606 768 pfam09606, Med15, ARC105 or Med15 subunit of Media 2e-08
PRK00286438 PRK00286, xseA, exodeoxyribonuclease VII large sub 3e-08
PRK09510 387 PRK09510, tolA, cell envelope integrity inner memb 5e-08
PRK10263 1355 PRK10263, PRK10263, DNA translocase FtsK; Provisio 8e-08
pfam09606 768 pfam09606, Med15, ARC105 or Med15 subunit of Media 1e-07
PRK00286438 PRK00286, xseA, exodeoxyribonuclease VII large sub 2e-07
PRK00286438 PRK00286, xseA, exodeoxyribonuclease VII large sub 2e-07
PRK12757256 PRK12757, PRK12757, cell division protein FtsN; Pr 2e-07
pfam09606 768 pfam09606, Med15, ARC105 or Med15 subunit of Media 3e-07
pfam09770 804 pfam09770, PAT1, Topoisomerase II-associated prote 6e-07
pfam04702147 pfam04702, Vicilin_N, Vicilin N terminal region 6e-07
PRK10263 1355 PRK10263, PRK10263, DNA translocase FtsK; Provisio 8e-07
smart00818165 smart00818, Amelogenin, Amelogenins, cell adhesion 1e-06
COG1570440 COG1570, XseA, Exonuclease VII, large subunit [DNA 2e-06
COG3264 835 COG3264, COG3264, Small-conductance mechanosensiti 2e-06
TIGR00618 1042 TIGR00618, sbcc, exonuclease SbcC 4e-06
pfam11498476 pfam11498, Activator_LAG-3, Transcriptional activa 5e-06
COG3264 835 COG3264, COG3264, Small-conductance mechanosensiti 5e-06
pfam12128 1198 pfam12128, DUF3584, Protein of unknown function (D 5e-06
PRK04863 1486 PRK04863, mukB, cell division protein MukB; Provis 5e-06
PRK04863 1486 PRK04863, mukB, cell division protein MukB; Provis 5e-06
TIGR00237432 TIGR00237, xseA, exodeoxyribonuclease VII, large s 5e-06
COG3064 387 COG3064, TolA, Membrane protein involved in colici 7e-06
PRK04863 1486 PRK04863, mukB, cell division protein MukB; Provis 7e-06
PRK06800228 PRK06800, fliH, flagellar assembly protein H; Vali 7e-06
pfam11932250 pfam11932, DUF3450, Protein of unknown function (D 8e-06
PRK10927319 PRK10927, PRK10927, essential cell division protei 9e-06
smart00818165 smart00818, Amelogenin, Amelogenins, cell adhesion 1e-05
PRK04863 1486 PRK04863, mukB, cell division protein MukB; Provis 1e-05
pfam02050122 pfam02050, FliJ, Flagellar FliJ protein 1e-05
PRK03427333 PRK03427, PRK03427, cell division protein ZipA; Pr 1e-05
PRK10246 1047 PRK10246, PRK10246, exonuclease subunit SbcC; Prov 1e-05
pfam11498476 pfam11498, Activator_LAG-3, Transcriptional activa 2e-05
COG1570440 COG1570, XseA, Exonuclease VII, large subunit [DNA 2e-05
PRK04863 1486 PRK04863, mukB, cell division protein MukB; Provis 2e-05
PRK10246 1047 PRK10246, PRK10246, exonuclease subunit SbcC; Prov 2e-05
TIGR04211198 TIGR04211, SH3_and_anchor, SH3 domain protein 2e-05
TIGR02794 346 TIGR02794, tolA_full, TolA protein 2e-05
TIGR01628562 TIGR01628, PABP-1234, polyadenylate binding protei 3e-05
pfam03280189 pfam03280, Lipase_chap, Proteobacterial lipase cha 3e-05
PRK01294336 PRK01294, PRK01294, lipase chaperone; Provisional 3e-05
PRK12757256 PRK12757, PRK12757, cell division protein FtsN; Pr 4e-05
COG3264 835 COG3264, COG3264, Small-conductance mechanosensiti 4e-05
PRK10927319 PRK10927, PRK10927, essential cell division protei 4e-05
PRK10927319 PRK10927, PRK10927, essential cell division protei 4e-05
TIGR00618 1042 TIGR00618, sbcc, exonuclease SbcC 5e-05
pfam03153 332 pfam03153, TFIIA, Transcription factor IIA, alpha/ 5e-05
COG4372 499 COG4372, COG4372, Uncharacterized protein conserve 5e-05
PRK10246 1047 PRK10246, PRK10246, exonuclease subunit SbcC; Prov 6e-05
TIGR02473141 TIGR02473, flagell_FliJ, flagellar export protein 6e-05
PRK09510 387 PRK09510, tolA, cell envelope integrity inner memb 7e-05
pfam13388 422 pfam13388, DUF4106, Protein of unknown function (D 7e-05
pfam11068131 pfam11068, DUF2869, Protein of unknown function (D 8e-05
PRK09510 387 PRK09510, tolA, cell envelope integrity inner memb 9e-05
PRK10920 390 PRK10920, PRK10920, putative uroporphyrinogen III 9e-05
PRK10263 1355 PRK10263, PRK10263, DNA translocase FtsK; Provisio 1e-04
PRK12757256 PRK12757, PRK12757, cell division protein FtsN; Pr 1e-04
pfam04702147 pfam04702, Vicilin_N, Vicilin N terminal region 1e-04
pfam04702147 pfam04702, Vicilin_N, Vicilin N terminal region 1e-04
TIGR00618 1042 TIGR00618, sbcc, exonuclease SbcC 1e-04
TIGR00237432 TIGR00237, xseA, exodeoxyribonuclease VII, large s 1e-04
pfam02050122 pfam02050, FliJ, Flagellar FliJ protein 1e-04
pfam03280189 pfam03280, Lipase_chap, Proteobacterial lipase cha 1e-04
pfam03280189 pfam03280, Lipase_chap, Proteobacterial lipase cha 1e-04
TIGR02473141 TIGR02473, flagell_FliJ, flagellar export protein 1e-04
pfam11068131 pfam11068, DUF2869, Protein of unknown function (D 1e-04
COG2959 391 COG2959, HemX, Uncharacterized enzyme of heme bios 1e-04
pfam12474142 pfam12474, PKK, Polo kinase kinase 1e-04
COG1322 448 COG1322, COG1322, Predicted nuclease of restrictio 1e-04
PRK09510 387 PRK09510, tolA, cell envelope integrity inner memb 2e-04
PRK10263 1355 PRK10263, PRK10263, DNA translocase FtsK; Provisio 2e-04
TIGR00237432 TIGR00237, xseA, exodeoxyribonuclease VII, large s 2e-04
TIGR02794 346 TIGR02794, tolA_full, TolA protein 2e-04
PRK11448 1123 PRK11448, hsdR, type I restriction enzyme EcoKI su 2e-04
PRK11281 1113 PRK11281, PRK11281, hypothetical protein; Provisio 2e-04
pfam13904261 pfam13904, DUF4207, Domain of unknown function (DU 2e-04
COG3166206 COG3166, PilN, Tfp pilus assembly protein PilN [Ce 2e-04
COG3166206 COG3166, PilN, Tfp pilus assembly protein PilN [Ce 2e-04
pfam13868 349 pfam13868, Trichoplein, Tumour suppressor, Mitosta 2e-04
TIGR00618 1042 TIGR00618, sbcc, exonuclease SbcC 3e-04
pfam11932250 pfam11932, DUF3450, Protein of unknown function (D 3e-04
PRK03427 333 PRK03427, PRK03427, cell division protein ZipA; Pr 3e-04
TIGR04211198 TIGR04211, SH3_and_anchor, SH3 domain protein 3e-04
pfam12795239 pfam12795, MscS_porin, Mechanosensitive ion channe 3e-04
COG3115 324 COG3115, ZipA, Cell division protein [Cell divisio 3e-04
PRK11637 428 PRK11637, PRK11637, AmiB activator; Provisional 3e-04
TIGR00618 1042 TIGR00618, sbcc, exonuclease SbcC 4e-04
PRK03427 333 PRK03427, PRK03427, cell division protein ZipA; Pr 4e-04
TIGR01628562 TIGR01628, PABP-1234, polyadenylate binding protei 4e-04
COG2959 391 COG2959, HemX, Uncharacterized enzyme of heme bios 4e-04
pfam13868349 pfam13868, Trichoplein, Tumour suppressor, Mitosta 4e-04
pfam12795239 pfam12795, MscS_porin, Mechanosensitive ion channe 4e-04
pfam07223 357 pfam07223, DUF1421, Protein of unknown function (D 4e-04
PRK10246 1047 PRK10246, PRK10246, exonuclease subunit SbcC; Prov 5e-04
pfam11068131 pfam11068, DUF2869, Protein of unknown function (D 5e-04
PRK10920 390 PRK10920, PRK10920, putative uroporphyrinogen III 5e-04
PRK10920 390 PRK10920, PRK10920, putative uroporphyrinogen III 5e-04
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 5e-04
pfam11068131 pfam11068, DUF2869, Protein of unknown function (D 6e-04
pfam13868 349 pfam13868, Trichoplein, Tumour suppressor, Mitosta 6e-04
PRK03427 333 PRK03427, PRK03427, cell division protein ZipA; Pr 7e-04
pfam03153 332 pfam03153, TFIIA, Transcription factor IIA, alpha/ 7e-04
pfam03153332 pfam03153, TFIIA, Transcription factor IIA, alpha/ 7e-04
PRK10920 390 PRK10920, PRK10920, putative uroporphyrinogen III 7e-04
PRK11281 1113 PRK11281, PRK11281, hypothetical protein; Provisio 7e-04
pfam13868 349 pfam13868, Trichoplein, Tumour suppressor, Mitosta 7e-04
COG0419 908 COG0419, SbcC, ATPase involved in DNA repair [DNA 7e-04
COG0419 908 COG0419, SbcC, ATPase involved in DNA repair [DNA 7e-04
TIGR02302 851 TIGR02302, aProt_lowcomp, TIGR02302 family protein 7e-04
pfam04702147 pfam04702, Vicilin_N, Vicilin N terminal region 8e-04
TIGR02794 346 TIGR02794, tolA_full, TolA protein 8e-04
pfam13388422 pfam13388, DUF4106, Protein of unknown function (D 8e-04
pfam12128 1198 pfam12128, DUF3584, Protein of unknown function (D 9e-04
pfam13388422 pfam13388, DUF4106, Protein of unknown function (D 9e-04
PRK11637 428 PRK11637, PRK11637, AmiB activator; Provisional 9e-04
pfam12037276 pfam12037, DUF3523, Domain of unknown function (DU 9e-04
smart00818165 smart00818, Amelogenin, Amelogenins, cell adhesion 0.001
TIGR00618 1042 TIGR00618, sbcc, exonuclease SbcC 0.001
TIGR00237432 TIGR00237, xseA, exodeoxyribonuclease VII, large s 0.001
pfam11932250 pfam11932, DUF3450, Protein of unknown function (D 0.001
PRK10246 1047 PRK10246, PRK10246, exonuclease subunit SbcC; Prov 0.001
TIGR01628562 TIGR01628, PABP-1234, polyadenylate binding protei 0.001
pfam13388422 pfam13388, DUF4106, Protein of unknown function (D 0.001
PRK10920 390 PRK10920, PRK10920, putative uroporphyrinogen III 0.001
PRK11281 1113 PRK11281, PRK11281, hypothetical protein; Provisio 0.001
pfam13868349 pfam13868, Trichoplein, Tumour suppressor, Mitosta 0.001
pfam12037276 pfam12037, DUF3523, Domain of unknown function (DU 0.001
pfam11180192 pfam11180, DUF2968, Protein of unknown function (D 0.001
pfam03938157 pfam03938, OmpH, Outer membrane protein (OmpH-like 0.001
pfam03938157 pfam03938, OmpH, Outer membrane protein (OmpH-like 0.001
PRK01741332 PRK01741, PRK01741, cell division protein ZipA; Pr 0.001
COG0845 372 COG0845, AcrA, Membrane-fusion protein [Cell envel 0.001
TIGR01843 423 TIGR01843, type_I_hlyD, type I secretion membrane 0.001
COG5380283 COG5380, LimK, Lipase chaperone [Posttranslational 0.001
COG3064 387 COG3064, TolA, Membrane protein involved in colici 0.002
TIGR00618 1042 TIGR00618, sbcc, exonuclease SbcC 0.002
pfam02050122 pfam02050, FliJ, Flagellar FliJ protein 0.002
TIGR04211198 TIGR04211, SH3_and_anchor, SH3 domain protein 0.002
PRK01294336 PRK01294, PRK01294, lipase chaperone; Provisional 0.002
PRK01294336 PRK01294, PRK01294, lipase chaperone; Provisional 0.002
pfam13388 422 pfam13388, DUF4106, Protein of unknown function (D 0.002
pfam13388 422 pfam13388, DUF4106, Protein of unknown function (D 0.002
pfam13388 422 pfam13388, DUF4106, Protein of unknown function (D 0.002
PRK11448 1123 PRK11448, hsdR, type I restriction enzyme EcoKI su 0.002
PRK11281 1113 PRK11281, PRK11281, hypothetical protein; Provisio 0.002
pfam13868 349 pfam13868, Trichoplein, Tumour suppressor, Mitosta 0.002
pfam07223 357 pfam07223, DUF1421, Protein of unknown function (D 0.002
TIGR02302851 TIGR02302, aProt_lowcomp, TIGR02302 family protein 0.002
PRK12704 520 PRK12704, PRK12704, phosphodiesterase; Provisional 0.002
pfam07321152 pfam07321, YscO, Type III secretion protein YscO 0.002
PRK11147635 PRK11147, PRK11147, ABC transporter ATPase compone 0.002
pfam04375 372 pfam04375, HemX, HemX 0.002
COG1570440 COG1570, XseA, Exonuclease VII, large subunit [DNA 0.003
TIGR00618 1042 TIGR00618, sbcc, exonuclease SbcC 0.003
pfam12128 1198 pfam12128, DUF3584, Protein of unknown function (D 0.003
PRK10246 1047 PRK10246, PRK10246, exonuclease subunit SbcC; Prov 0.003
pfam03153332 pfam03153, TFIIA, Transcription factor IIA, alpha/ 0.003
PRK11281 1113 PRK11281, PRK11281, hypothetical protein; Provisio 0.003
COG3166206 COG3166, PilN, Tfp pilus assembly protein PilN [Ce 0.003
pfam13868349 pfam13868, Trichoplein, Tumour suppressor, Mitosta 0.003
TIGR02302 851 TIGR02302, aProt_lowcomp, TIGR02302 family protein 0.003
pfam07321152 pfam07321, YscO, Type III secretion protein YscO 0.003
pfam07321152 pfam07321, YscO, Type III secretion protein YscO 0.003
COG4942 420 COG4942, COG4942, Membrane-bound metallopeptidase 0.003
pfam1220392 pfam12203, HDAC4_Gln, Glutamine rich N terminal do 0.003
COG4487 438 COG4487, COG4487, Uncharacterized protein conserve 0.003
PRK00286438 PRK00286, xseA, exodeoxyribonuclease VII large sub 0.004
smart00818165 smart00818, Amelogenin, Amelogenins, cell adhesion 0.004
pfam13388 422 pfam13388, DUF4106, Protein of unknown function (D 0.004
pfam13868349 pfam13868, Trichoplein, Tumour suppressor, Mitosta 0.004
COG3115 324 COG3115, ZipA, Cell division protein [Cell divisio 0.004
PRK01741332 PRK01741, PRK01741, cell division protein ZipA; Pr 0.004
COG5380283 COG5380, LimK, Lipase chaperone [Posttranslational 0.004
>gnl|CDD|221051 pfam11265, Med25_VWA, Mediator complex subunit 25 von Willebrand factor type A Back     alignment and domain information
 Score =  222 bits (567), Expect = 4e-67
 Identities = 77/230 (33%), Positives = 109/230 (47%), Gaps = 21/230 (9%)

Query: 3   EKQLIVAVEGTAAMGPYWQSIVSDYLEKIIRCFCVNELAGQ---TSASNVELSLVTFNTH 59
              ++  +EGTA +GPY++++ ++Y+  II  F     A           + SLV FNT 
Sbjct: 13  VADVVFVIEGTANLGPYFETLKTNYILPIIEYFNGGPPAETDFGGEYGGTQYSLVVFNTV 72

Query: 60  GSYCACLVQRSGWTKDVDIFLHWLSTIPFAGGGFNDAA-IAEGLSEALMMFSVAPNGSQN 118
            S     VQ  G T+DVD FLHWL +I F GGG    + IAEGL+EAL +F       Q 
Sbjct: 73  ASAPESYVQCHGPTRDVDEFLHWLDSIQFMGGGGESCSLIAEGLAEALQLFDDFSEMRQQ 132

Query: 119 QQNVDGQRHCILVAASNPHPLPTPVYRPQMQNLDQNENNEAQAESRLSDAETVAKSFVQC 178
               D  RHCIL+  S P+ LPT                 A  E + SD         + 
Sbjct: 133 IGQTDLHRHCILICNSPPYLLPT--------------VESASYEGKTSDQLAAI--IYER 176

Query: 179 SVSLSVICPKQLPKLTAIYNAAKRN-PRAADPPVDNSKNPHFLVLISENF 227
            + LS+I P++LP L  ++  AK +        +D +KNP  +VL+   F
Sbjct: 177 GIHLSIIAPRKLPALRLLFEKAKPDQQLPMKSSIDYAKNPFHMVLLRGIF 226


The overall function of the full-length Med25 is efficiently to coordinate the transcriptional activation of RAR/RXR (retinoic acid receptor/retinoic X receptor) in higher eukaryotic cells. Human Med25 consists of several domains with different binding properties, the N-terminal, VWA domain which is this one, an SD2 domain from residues 229-381, a PTOV(B) or ACID domain from 395-545, an SD2 domain from residues 564-645 and a C-terminal NR box-containing domain (646-650) from 646-747. This VWA or von Willebrand factor type A domain when bound to RAR and the histone acetyltransferase CBP is responsible for recruiting Med1 to the rest of the Mediator complex. Length = 226

>gnl|CDD|222374 pfam13779, DUF4175, Domain of unknown function (DUF4175) Back     alignment and domain information
>gnl|CDD|222374 pfam13779, DUF4175, Domain of unknown function (DUF4175) Back     alignment and domain information
>gnl|CDD|222374 pfam13779, DUF4175, Domain of unknown function (DUF4175) Back     alignment and domain information
>gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 Back     alignment and domain information
>gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 Back     alignment and domain information
>gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 Back     alignment and domain information
>gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 Back     alignment and domain information
>gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 Back     alignment and domain information
>gnl|CDD|222374 pfam13779, DUF4175, Domain of unknown function (DUF4175) Back     alignment and domain information
>gnl|CDD|222374 pfam13779, DUF4175, Domain of unknown function (DUF4175) Back     alignment and domain information
>gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 Back     alignment and domain information
>gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 Back     alignment and domain information
>gnl|CDD|222374 pfam13779, DUF4175, Domain of unknown function (DUF4175) Back     alignment and domain information
>gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 Back     alignment and domain information
>gnl|CDD|220309 pfam09606, Med15, ARC105 or Med15 subunit of Mediator complex non-fungal Back     alignment and domain information
>gnl|CDD|220309 pfam09606, Med15, ARC105 or Med15 subunit of Mediator complex non-fungal Back     alignment and domain information
>gnl|CDD|220309 pfam09606, Med15, ARC105 or Med15 subunit of Mediator complex non-fungal Back     alignment and domain information
>gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 Back     alignment and domain information
>gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional Back     alignment and domain information
>gnl|CDD|220309 pfam09606, Med15, ARC105 or Med15 subunit of Mediator complex non-fungal Back     alignment and domain information
>gnl|CDD|220309 pfam09606, Med15, ARC105 or Med15 subunit of Mediator complex non-fungal Back     alignment and domain information
>gnl|CDD|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|234714 PRK00286, xseA, exodeoxyribonuclease VII large subunit; Reviewed Back     alignment and domain information
>gnl|CDD|151935 pfam11498, Activator_LAG-3, Transcriptional activator LAG-3 Back     alignment and domain information
>gnl|CDD|220309 pfam09606, Med15, ARC105 or Med15 subunit of Mediator complex non-fungal Back     alignment and domain information
>gnl|CDD|234714 PRK00286, xseA, exodeoxyribonuclease VII large subunit; Reviewed Back     alignment and domain information
>gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional Back     alignment and domain information
>gnl|CDD|236669 PRK10263, PRK10263, DNA translocase FtsK; Provisional Back     alignment and domain information
>gnl|CDD|220309 pfam09606, Med15, ARC105 or Med15 subunit of Mediator complex non-fungal Back     alignment and domain information
>gnl|CDD|234714 PRK00286, xseA, exodeoxyribonuclease VII large subunit; Reviewed Back     alignment and domain information
>gnl|CDD|234714 PRK00286, xseA, exodeoxyribonuclease VII large subunit; Reviewed Back     alignment and domain information
>gnl|CDD|237191 PRK12757, PRK12757, cell division protein FtsN; Provisional Back     alignment and domain information
>gnl|CDD|220309 pfam09606, Med15, ARC105 or Med15 subunit of Mediator complex non-fungal Back     alignment and domain information
>gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 Back     alignment and domain information
>gnl|CDD|218218 pfam04702, Vicilin_N, Vicilin N terminal region Back     alignment and domain information
>gnl|CDD|236669 PRK10263, PRK10263, DNA translocase FtsK; Provisional Back     alignment and domain information
>gnl|CDD|197891 smart00818, Amelogenin, Amelogenins, cell adhesion proteins, play a role in the biomineralisation of teeth Back     alignment and domain information
>gnl|CDD|224486 COG1570, XseA, Exonuclease VII, large subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|225803 COG3264, COG3264, Small-conductance mechanosensitive channel [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|129705 TIGR00618, sbcc, exonuclease SbcC Back     alignment and domain information
>gnl|CDD|151935 pfam11498, Activator_LAG-3, Transcriptional activator LAG-3 Back     alignment and domain information
>gnl|CDD|225803 COG3264, COG3264, Small-conductance mechanosensitive channel [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|221432 pfam12128, DUF3584, Protein of unknown function (DUF3584) Back     alignment and domain information
>gnl|CDD|235316 PRK04863, mukB, cell division protein MukB; Provisional Back     alignment and domain information
>gnl|CDD|235316 PRK04863, mukB, cell division protein MukB; Provisional Back     alignment and domain information
>gnl|CDD|161783 TIGR00237, xseA, exodeoxyribonuclease VII, large subunit Back     alignment and domain information
>gnl|CDD|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|235316 PRK04863, mukB, cell division protein MukB; Provisional Back     alignment and domain information
>gnl|CDD|180700 PRK06800, fliH, flagellar assembly protein H; Validated Back     alignment and domain information
>gnl|CDD|204784 pfam11932, DUF3450, Protein of unknown function (DUF3450) Back     alignment and domain information
>gnl|CDD|236797 PRK10927, PRK10927, essential cell division protein FtsN; Provisional Back     alignment and domain information
>gnl|CDD|197891 smart00818, Amelogenin, Amelogenins, cell adhesion proteins, play a role in the biomineralisation of teeth Back     alignment and domain information
>gnl|CDD|235316 PRK04863, mukB, cell division protein MukB; Provisional Back     alignment and domain information
>gnl|CDD|202101 pfam02050, FliJ, Flagellar FliJ protein Back     alignment and domain information
>gnl|CDD|235124 PRK03427, PRK03427, cell division protein ZipA; Provisional Back     alignment and domain information
>gnl|CDD|182330 PRK10246, PRK10246, exonuclease subunit SbcC; Provisional Back     alignment and domain information
>gnl|CDD|151935 pfam11498, Activator_LAG-3, Transcriptional activator LAG-3 Back     alignment and domain information
>gnl|CDD|224486 COG1570, XseA, Exonuclease VII, large subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|235316 PRK04863, mukB, cell division protein MukB; Provisional Back     alignment and domain information
>gnl|CDD|182330 PRK10246, PRK10246, exonuclease subunit SbcC; Provisional Back     alignment and domain information
>gnl|CDD|234501 TIGR04211, SH3_and_anchor, SH3 domain protein Back     alignment and domain information
>gnl|CDD|234017 TIGR02794, tolA_full, TolA protein Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|217472 pfam03280, Lipase_chap, Proteobacterial lipase chaperone protein Back     alignment and domain information
>gnl|CDD|234937 PRK01294, PRK01294, lipase chaperone; Provisional Back     alignment and domain information
>gnl|CDD|237191 PRK12757, PRK12757, cell division protein FtsN; Provisional Back     alignment and domain information
>gnl|CDD|225803 COG3264, COG3264, Small-conductance mechanosensitive channel [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|236797 PRK10927, PRK10927, essential cell division protein FtsN; Provisional Back     alignment and domain information
>gnl|CDD|236797 PRK10927, PRK10927, essential cell division protein FtsN; Provisional Back     alignment and domain information
>gnl|CDD|129705 TIGR00618, sbcc, exonuclease SbcC Back     alignment and domain information
>gnl|CDD|217392 pfam03153, TFIIA, Transcription factor IIA, alpha/beta subunit Back     alignment and domain information
>gnl|CDD|226809 COG4372, COG4372, Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] Back     alignment and domain information
>gnl|CDD|182330 PRK10246, PRK10246, exonuclease subunit SbcC; Provisional Back     alignment and domain information
>gnl|CDD|131526 TIGR02473, flagell_FliJ, flagellar export protein FliJ Back     alignment and domain information
>gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional Back     alignment and domain information
>gnl|CDD|222095 pfam13388, DUF4106, Protein of unknown function (DUF4106) Back     alignment and domain information
>gnl|CDD|220964 pfam11068, DUF2869, Protein of unknown function (DUF2869) Back     alignment and domain information
>gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional Back     alignment and domain information
>gnl|CDD|236795 PRK10920, PRK10920, putative uroporphyrinogen III C-methyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|236669 PRK10263, PRK10263, DNA translocase FtsK; Provisional Back     alignment and domain information
>gnl|CDD|237191 PRK12757, PRK12757, cell division protein FtsN; Provisional Back     alignment and domain information
>gnl|CDD|218218 pfam04702, Vicilin_N, Vicilin N terminal region Back     alignment and domain information
>gnl|CDD|218218 pfam04702, Vicilin_N, Vicilin N terminal region Back     alignment and domain information
>gnl|CDD|129705 TIGR00618, sbcc, exonuclease SbcC Back     alignment and domain information
>gnl|CDD|161783 TIGR00237, xseA, exodeoxyribonuclease VII, large subunit Back     alignment and domain information
>gnl|CDD|202101 pfam02050, FliJ, Flagellar FliJ protein Back     alignment and domain information
>gnl|CDD|217472 pfam03280, Lipase_chap, Proteobacterial lipase chaperone protein Back     alignment and domain information
>gnl|CDD|217472 pfam03280, Lipase_chap, Proteobacterial lipase chaperone protein Back     alignment and domain information
>gnl|CDD|131526 TIGR02473, flagell_FliJ, flagellar export protein FliJ Back     alignment and domain information
>gnl|CDD|220964 pfam11068, DUF2869, Protein of unknown function (DUF2869) Back     alignment and domain information
>gnl|CDD|225507 COG2959, HemX, Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|204935 pfam12474, PKK, Polo kinase kinase Back     alignment and domain information
>gnl|CDD|224241 COG1322, COG1322, Predicted nuclease of restriction endonuclease-like fold, RmuC family [General function prediction only] Back     alignment and domain information
>gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional Back     alignment and domain information
>gnl|CDD|236669 PRK10263, PRK10263, DNA translocase FtsK; Provisional Back     alignment and domain information
>gnl|CDD|161783 TIGR00237, xseA, exodeoxyribonuclease VII, large subunit Back     alignment and domain information
>gnl|CDD|234017 TIGR02794, tolA_full, TolA protein Back     alignment and domain information
>gnl|CDD|236912 PRK11448, hsdR, type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>gnl|CDD|236892 PRK11281, PRK11281, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|222447 pfam13904, DUF4207, Domain of unknown function (DUF4207) Back     alignment and domain information
>gnl|CDD|225707 COG3166, PilN, Tfp pilus assembly protein PilN [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|225707 COG3166, PilN, Tfp pilus assembly protein PilN [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin Back     alignment and domain information
>gnl|CDD|129705 TIGR00618, sbcc, exonuclease SbcC Back     alignment and domain information
>gnl|CDD|204784 pfam11932, DUF3450, Protein of unknown function (DUF3450) Back     alignment and domain information
>gnl|CDD|235124 PRK03427, PRK03427, cell division protein ZipA; Provisional Back     alignment and domain information
>gnl|CDD|234501 TIGR04211, SH3_and_anchor, SH3 domain protein Back     alignment and domain information
>gnl|CDD|221776 pfam12795, MscS_porin, Mechanosensitive ion channel porin domain Back     alignment and domain information
>gnl|CDD|225657 COG3115, ZipA, Cell division protein [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|236942 PRK11637, PRK11637, AmiB activator; Provisional Back     alignment and domain information
>gnl|CDD|129705 TIGR00618, sbcc, exonuclease SbcC Back     alignment and domain information
>gnl|CDD|235124 PRK03427, PRK03427, cell division protein ZipA; Provisional Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|225507 COG2959, HemX, Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin Back     alignment and domain information
>gnl|CDD|221776 pfam12795, MscS_porin, Mechanosensitive ion channel porin domain Back     alignment and domain information
>gnl|CDD|219339 pfam07223, DUF1421, Protein of unknown function (DUF1421) Back     alignment and domain information
>gnl|CDD|182330 PRK10246, PRK10246, exonuclease subunit SbcC; Provisional Back     alignment and domain information
>gnl|CDD|220964 pfam11068, DUF2869, Protein of unknown function (DUF2869) Back     alignment and domain information
>gnl|CDD|236795 PRK10920, PRK10920, putative uroporphyrinogen III C-methyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|236795 PRK10920, PRK10920, putative uroporphyrinogen III C-methyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|220964 pfam11068, DUF2869, Protein of unknown function (DUF2869) Back     alignment and domain information
>gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin Back     alignment and domain information
>gnl|CDD|235124 PRK03427, PRK03427, cell division protein ZipA; Provisional Back     alignment and domain information
>gnl|CDD|217392 pfam03153, TFIIA, Transcription factor IIA, alpha/beta subunit Back     alignment and domain information
>gnl|CDD|217392 pfam03153, TFIIA, Transcription factor IIA, alpha/beta subunit Back     alignment and domain information
>gnl|CDD|236795 PRK10920, PRK10920, putative uroporphyrinogen III C-methyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|236892 PRK11281, PRK11281, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|233816 TIGR02302, aProt_lowcomp, TIGR02302 family protein Back     alignment and domain information
>gnl|CDD|218218 pfam04702, Vicilin_N, Vicilin N terminal region Back     alignment and domain information
>gnl|CDD|234017 TIGR02794, tolA_full, TolA protein Back     alignment and domain information
>gnl|CDD|222095 pfam13388, DUF4106, Protein of unknown function (DUF4106) Back     alignment and domain information
>gnl|CDD|221432 pfam12128, DUF3584, Protein of unknown function (DUF3584) Back     alignment and domain information
>gnl|CDD|222095 pfam13388, DUF4106, Protein of unknown function (DUF4106) Back     alignment and domain information
>gnl|CDD|236942 PRK11637, PRK11637, AmiB activator; Provisional Back     alignment and domain information
>gnl|CDD|221389 pfam12037, DUF3523, Domain of unknown function (DUF3523) Back     alignment and domain information
>gnl|CDD|197891 smart00818, Amelogenin, Amelogenins, cell adhesion proteins, play a role in the biomineralisation of teeth Back     alignment and domain information
>gnl|CDD|129705 TIGR00618, sbcc, exonuclease SbcC Back     alignment and domain information
>gnl|CDD|161783 TIGR00237, xseA, exodeoxyribonuclease VII, large subunit Back     alignment and domain information
>gnl|CDD|204784 pfam11932, DUF3450, Protein of unknown function (DUF3450) Back     alignment and domain information
>gnl|CDD|182330 PRK10246, PRK10246, exonuclease subunit SbcC; Provisional Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|222095 pfam13388, DUF4106, Protein of unknown function (DUF4106) Back     alignment and domain information
>gnl|CDD|236795 PRK10920, PRK10920, putative uroporphyrinogen III C-methyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|236892 PRK11281, PRK11281, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin Back     alignment and domain information
>gnl|CDD|221389 pfam12037, DUF3523, Domain of unknown function (DUF3523) Back     alignment and domain information
>gnl|CDD|221016 pfam11180, DUF2968, Protein of unknown function (DUF2968) Back     alignment and domain information
>gnl|CDD|217803 pfam03938, OmpH, Outer membrane protein (OmpH-like) Back     alignment and domain information
>gnl|CDD|217803 pfam03938, OmpH, Outer membrane protein (OmpH-like) Back     alignment and domain information
>gnl|CDD|234977 PRK01741, PRK01741, cell division protein ZipA; Provisional Back     alignment and domain information
>gnl|CDD|223914 COG0845, AcrA, Membrane-fusion protein [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|130902 TIGR01843, type_I_hlyD, type I secretion membrane fusion protein, HlyD family Back     alignment and domain information
>gnl|CDD|227671 COG5380, LimK, Lipase chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|129705 TIGR00618, sbcc, exonuclease SbcC Back     alignment and domain information
>gnl|CDD|202101 pfam02050, FliJ, Flagellar FliJ protein Back     alignment and domain information
>gnl|CDD|234501 TIGR04211, SH3_and_anchor, SH3 domain protein Back     alignment and domain information
>gnl|CDD|234937 PRK01294, PRK01294, lipase chaperone; Provisional Back     alignment and domain information
>gnl|CDD|234937 PRK01294, PRK01294, lipase chaperone; Provisional Back     alignment and domain information
>gnl|CDD|222095 pfam13388, DUF4106, Protein of unknown function (DUF4106) Back     alignment and domain information
>gnl|CDD|222095 pfam13388, DUF4106, Protein of unknown function (DUF4106) Back     alignment and domain information
>gnl|CDD|222095 pfam13388, DUF4106, Protein of unknown function (DUF4106) Back     alignment and domain information
>gnl|CDD|236912 PRK11448, hsdR, type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>gnl|CDD|236892 PRK11281, PRK11281, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin Back     alignment and domain information
>gnl|CDD|219339 pfam07223, DUF1421, Protein of unknown function (DUF1421) Back     alignment and domain information
>gnl|CDD|233816 TIGR02302, aProt_lowcomp, TIGR02302 family protein Back     alignment and domain information
>gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional Back     alignment and domain information
>gnl|CDD|148750 pfam07321, YscO, Type III secretion protein YscO Back     alignment and domain information
>gnl|CDD|236861 PRK11147, PRK11147, ABC transporter ATPase component; Reviewed Back     alignment and domain information
>gnl|CDD|113156 pfam04375, HemX, HemX Back     alignment and domain information
>gnl|CDD|224486 COG1570, XseA, Exonuclease VII, large subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|129705 TIGR00618, sbcc, exonuclease SbcC Back     alignment and domain information
>gnl|CDD|221432 pfam12128, DUF3584, Protein of unknown function (DUF3584) Back     alignment and domain information
>gnl|CDD|182330 PRK10246, PRK10246, exonuclease subunit SbcC; Provisional Back     alignment and domain information
>gnl|CDD|217392 pfam03153, TFIIA, Transcription factor IIA, alpha/beta subunit Back     alignment and domain information
>gnl|CDD|236892 PRK11281, PRK11281, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|225707 COG3166, PilN, Tfp pilus assembly protein PilN [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin Back     alignment and domain information
>gnl|CDD|233816 TIGR02302, aProt_lowcomp, TIGR02302 family protein Back     alignment and domain information
>gnl|CDD|148750 pfam07321, YscO, Type III secretion protein YscO Back     alignment and domain information
>gnl|CDD|148750 pfam07321, YscO, Type III secretion protein YscO Back     alignment and domain information
>gnl|CDD|227278 COG4942, COG4942, Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|204848 pfam12203, HDAC4_Gln, Glutamine rich N terminal domain of histone deacetylase 4 Back     alignment and domain information
>gnl|CDD|226889 COG4487, COG4487, Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>gnl|CDD|234714 PRK00286, xseA, exodeoxyribonuclease VII large subunit; Reviewed Back     alignment and domain information
>gnl|CDD|197891 smart00818, Amelogenin, Amelogenins, cell adhesion proteins, play a role in the biomineralisation of teeth Back     alignment and domain information
>gnl|CDD|222095 pfam13388, DUF4106, Protein of unknown function (DUF4106) Back     alignment and domain information
>gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin Back     alignment and domain information
>gnl|CDD|225657 COG3115, ZipA, Cell division protein [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|234977 PRK01741, PRK01741, cell division protein ZipA; Provisional Back     alignment and domain information
>gnl|CDD|227671 COG5380, LimK, Lipase chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 833
PF11265226 Med25_VWA: Mediator complex subunit 25 von Willebr 100.0
cd01480186 vWA_collagen_alpha_1-VI-type VWA_collagen alpha(VI 99.12
cd01472164 vWA_collagen von Willebrand factor (vWF) type A do 99.02
PF13519172 VWA_2: von Willebrand factor type A domain; PDB: 3 99.01
cd01450161 vWFA_subfamily_ECM Von Willebrand factor type A (v 99.0
cd01481165 vWA_collagen_alpha3-VI-like VWA_collagen alpha 3(V 98.99
cd01482164 vWA_collagen_alphaI-XII-like Collagen: The extrace 98.97
cd01469177 vWA_integrins_alpha_subunit Integrins are a class 98.94
cd01473192 vWA_CTRP CTRP for CS protein-TRAP-related protein: 98.9
cd01474185 vWA_ATR ATR (Anthrax Toxin Receptor): Anthrax toxi 98.85
cd01453183 vWA_transcription_factor_IIH_type Transcription fa 98.83
cd01475224 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, 98.79
cd01476163 VWA_integrin_invertebrates VWA_integrin (invertebr 98.79
cd01477193 vWA_F09G8-8_type VWA F09G8.8 type: Von Willebrand 98.68
PF00092178 VWA: von Willebrand factor type A domain; InterPro 98.66
cd01471186 vWA_micronemal_protein Micronemal proteins: The To 98.66
cd00198161 vWFA Von Willebrand factor type A (vWA) domain was 98.57
smart00187423 INB Integrin beta subunits (N-terminal portion of 98.47
cd01467180 vWA_BatA_type VWA BatA type: Von Willebrand factor 98.45
cd01452187 VWA_26S_proteasome_subunit 26S proteasome plays a 98.41
PF13768155 VWA_3: von Willebrand factor type A domain 98.36
smart00327177 VWA von Willebrand factor (vWF) type A domain. VWA 98.35
cd01463190 vWA_VGCC_like VWA Voltage gated Calcium channel li 98.34
COG1240261 ChlD Mg-chelatase subunit ChlD [Coenzyme metabolis 98.34
cd01456206 vWA_ywmD_type VWA ywmD type:Von Willebrand factor 98.33
cd01470198 vWA_complement_factors Complement factors B and C2 98.32
PTZ00441576 sporozoite surface protein 2 (SSP2); Provisional 98.29
PRK13685326 hypothetical protein; Provisional 98.27
cd01465170 vWA_subgroup VWA subgroup: Von Willebrand factor t 98.25
cd01454174 vWA_norD_type norD type: Denitrifying bacteria con 98.17
cd01451178 vWA_Magnesium_chelatase Magnesium chelatase: Mg-ch 98.16
TIGR03436296 acidobact_VWFA VWFA-related Acidobacterial domain. 98.15
cd01461171 vWA_interalpha_trypsin_inhibitor vWA_interalpha tr 98.14
cd01466155 vWA_C3HC4_type VWA C3HC4-type: Von Willebrand fact 98.13
cd01464176 vWA_subfamily VWA subfamily: Von Willebrand factor 98.13
cd01458218 vWA_ku Ku70/Ku80 N-terminal domain. The Ku78 heter 98.03
PRK13406584 bchD magnesium chelatase subunit D; Provisional 98.0
TIGR02031589 BchD-ChlD magnesium chelatase ATPase subunit D. Th 97.96
cd01462152 VWA_YIEM_type VWA YIEM type: Von Willebrand factor 97.82
TIGR02442633 Cob-chelat-sub cobaltochelatase subunit. A number 97.78
PF00362426 Integrin_beta: Integrin, beta chain; InterPro: IPR 97.77
TIGR00868863 hCaCC calcium-activated chloride channel protein 1 97.58
cd01460266 vWA_midasin VWA_Midasin: Midasin is a member of th 97.57
TIGR03788596 marine_srt_targ marine proteobacterial sortase tar 97.53
PF03731224 Ku_N: Ku70/Ku80 N-terminal alpha/beta domain; Inte 97.44
PF04056193 Ssl1: Ssl1-like; InterPro: IPR007198 Ssl1-like pro 97.28
cd01455191 vWA_F11C1-5a_type Von Willebrand factor type A (vW 97.22
cd01457199 vWA_ORF176_type VWA ORF176 type: Von Willebrand fa 97.18
COG4245207 TerY Uncharacterized protein encoded in toxicity p 97.03
PF04811243 Sec23_trunk: Sec23/Sec24 trunk domain; InterPro: I 96.95
KOG35982220 consensus Thyroid hormone receptor-associated prot 96.81
cd01468239 trunk_domain trunk domain. COPII-coated vesicles c 96.14
KOG35982220 consensus Thyroid hormone receptor-associated prot 95.93
TIGR00578584 ku70 ATP-dependent DNA helicase ii, 70 kDa subunit 95.91
cd01479244 Sec24-like Sec24-like: Protein and membrane traffi 95.74
PF11498468 Activator_LAG-3: Transcriptional activator LAG-3; 94.54
KOG2807378 consensus RNA polymerase II transcription initiati 94.08
PF05762222 VWA_CoxE: VWA domain containing CoxE-like protein; 93.92
PF06707205 DUF1194: Protein of unknown function (DUF1194); In 93.75
PRK10997487 yieM hypothetical protein; Provisional 93.16
COG5148243 RPN10 26S proteasome regulatory complex, subunit R 92.3
cd01478267 Sec23-like Sec23-like: Protein and membrane traffi 91.85
PF10138200 vWA-TerF-like: vWA found in TerF C terminus ; Inte 91.5
KOG1226783 consensus Integrin beta subunit (N-terminal portio 91.32
PF11235168 Med25_SD1: Mediator complex subunit 25 synapsin 1; 91.2
KOG19841007 consensus Vesicle coat complex COPII, subunit SFB3 90.83
PTZ003951560 Sec24-related protein; Provisional 89.2
PLN00162761 transport protein sec23; Provisional 86.65
KOG2884259 consensus 26S proteasome regulatory complex, subun 86.61
KOG23531104 consensus L-type voltage-dependent Ca2+ channel, a 86.06
COG5151421 SSL1 RNA polymerase II transcription initiation/nu 86.05
TIGR00627279 tfb4 transcription factor tfb4. This family is bas 86.02
PF09967126 DUF2201: VWA-like domain (DUF2201); InterPro: IPR0 85.61
COG2425437 Uncharacterized protein containing a von Willebran 81.08
PF03850276 Tfb4: Transcription factor Tfb4; InterPro: IPR0046 80.11
>PF11265 Med25_VWA: Mediator complex subunit 25 von Willebrand factor type A; InterPro: IPR021419 The overall function of the full-length Med25 is efficiently to coordinate the transcriptional activation of RAR/RXR (retinoic acid receptor/retinoic X receptor) in higher eukaryotic cells Back     alignment and domain information
Probab=100.00  E-value=3.8e-65  Score=524.57  Aligned_cols=209  Identities=43%  Similarity=0.703  Sum_probs=192.7

Q ss_pred             CccEEEEEeCCccchHhHHHHHHHHHHHHHHHhhcccCccCccC---CccEEEEEEeecCCCccccceeeccCCCCHHHH
Q 003297            3 EKQLIVAVEGTAAMGPYWQSIVSDYLEKIIRCFCVNELAGQTSA---SNVELSLVTFNTHGSYCACLVQRSGWTKDVDIF   79 (833)
Q Consensus         3 ~~dvVFVID~Tasmg~y~~~lkt~YI~p~le~f~~~~l~~~~~g---~~~~~gLV~Y~d~~~~~~~lv~~~gfT~d~~~f   79 (833)
                      ++|||||||+||+||+||++||+|||+|++|||+++++.|++++   .+++||||+||+||||++++|++++||+|+++|
T Consensus        13 ~~~vVfvvEgTAalgpy~~~Lkt~Yl~P~le~f~~g~~~e~~~~~~~~~t~y~LVvf~t~d~~~~~~v~~~g~T~~~~~f   92 (226)
T PF11265_consen   13 QAQVVFVVEGTAALGPYWNTLKTNYLDPILEYFNGGPIAERDFGGDYSNTEYGLVVFNTADCYPEPIVQRSGPTSSPQKF   92 (226)
T ss_pred             cceEEEEEecchhhhhhHHHHHHHHHHHHHHHhcCCCcccccccccCCCceEEEEEEeccCCCcccceeccCCcCCHHHH
Confidence            58999999999999999999999999999999999999999973   479999999999999999999999999999999


Q ss_pred             HHHHccCccCCCCCch-hHHHHHHHHHHhccccCCCCCCCCCCcCCCcEEEEeecCCCCCCCCCcccCCccccccccchh
Q 003297           80 LHWLSTIPFAGGGFND-AAIAEGLSEALMMFSVAPNGSQNQQNVDGQRHCILVAASNPHPLPTPVYRPQMQNLDQNENNE  158 (833)
Q Consensus        80 l~~Ld~I~f~GGG~~~-~AvaEGLa~AL~~f~~~~~~~~~~~~~~~qk~cILIa~SpP~~lp~pvy~p~~~~~~~~e~~~  158 (833)
                      ++|||+|+|.|||+++ ++|+|||++||+|||+.+..++...+.+.+||||||||||||++|+..            .+.
T Consensus        93 l~~L~~I~f~GGG~e~~a~iaEGLa~AL~~fd~~~~~r~~~~~~~~~khcILI~nSpP~~~p~~~------------~~~  160 (226)
T PF11265_consen   93 LQWLDAIQFSGGGFESCAAIAEGLAEALQCFDDFKQMRQQQQQTDVQKHCILICNSPPYRLPVNE------------CPQ  160 (226)
T ss_pred             HHHHHccCcCCCCcccchhHHHHHHHHHHHhcchhhhccccCcccccceEEEEeCCCCccccccC------------CCc
Confidence            9999999999999875 559999999999999888776666777799999999999999999732            222


Q ss_pred             hhhcccCCCHHHHHHHHhhcCcEEEEeccCcchhHHHHHHHhcCCCCC-CCCCCCCCCCCCeEEEeeccc
Q 003297          159 AQAESRLSDAETVAKSFVQCSVSLSVICPKQLPKLTAIYNAAKRNPRA-ADPPVDNSKNPHFLVLISENF  227 (833)
Q Consensus       159 ~~~~~~l~d~e~la~~~~e~~I~LSvIsPrklp~l~~lf~ka~~~~~~-~~~~~~~ak~p~hlVLlsg~~  227 (833)
                      +    +..++|++|.++.||+|+||||||||+|+|++||||+++|.++ +++++||||||||||||||+|
T Consensus       161 ~----~~~~~d~la~~~~~~~I~LSiisPrklP~l~~Lfeka~~~~~~~~~~~~~~ak~p~hlVLl~g~~  226 (226)
T PF11265_consen  161 Y----SGKTCDQLAVLISERNISLSIISPRKLPSLRSLFEKAKGNPRAAADPSKDYAKDPRHLVLLRGYF  226 (226)
T ss_pred             c----cCCCHHHHHHHHHhcCceEEEEcCccCHHHHHHHHhcCCCcccccccccccccCCCeEEEeecCC
Confidence            2    2348899999999999999999999999999999999999998 699999999999999999986



Human Med25 consists of several domains with different binding properties, the N-terminal, VWA domain which is this one, an SD2 domain from residues 229-381, a PTOV(B) or ACID domain from 395-545, an SD2 domain from residues 564-645 and a C-terminal NR box-containing domain (646-650) from 646-747. This VWA or von Willebrand factor type A domain when bound to RAR and the histone acetyltransferase CBP is responsible for recruiting Med1 to the rest of the Mediator complex [].

>cd01480 vWA_collagen_alpha_1-VI-type VWA_collagen alpha(VI) type: The extracellular matrix represents a complex alloy of variable members of diverse protein families defining structural integrity and various physiological functions Back     alignment and domain information
>cd01472 vWA_collagen von Willebrand factor (vWF) type A domain; equivalent to the I-domain of integrins Back     alignment and domain information
>PF13519 VWA_2: von Willebrand factor type A domain; PDB: 3IBS_B 3RAG_B 2X5N_A Back     alignment and domain information
>cd01450 vWFA_subfamily_ECM Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>cd01481 vWA_collagen_alpha3-VI-like VWA_collagen alpha 3(VI) like: The extracellular matrix represents a complex alloy of variable members of diverse protein families defining structural integrity and various physiological functions Back     alignment and domain information
>cd01482 vWA_collagen_alphaI-XII-like Collagen: The extracellular matrix represents a complex alloy of variable members of diverse protein families defining structural integrity and various physiological functions Back     alignment and domain information
>cd01469 vWA_integrins_alpha_subunit Integrins are a class of adhesion receptors that link the extracellular matrix to the cytoskeleton and cooperate with growth factor receptors to promote celll survival, cell cycle progression and cell migration Back     alignment and domain information
>cd01473 vWA_CTRP CTRP for CS protein-TRAP-related protein: Adhesion of Plasmodium to host cells is an important phenomenon in parasite invasion and in malaria associated pathology Back     alignment and domain information
>cd01474 vWA_ATR ATR (Anthrax Toxin Receptor): Anthrax toxin is a key virulence factor for Bacillus anthracis, the causative agent of anthrax Back     alignment and domain information
>cd01453 vWA_transcription_factor_IIH_type Transcription factors IIH type: TFIIH is a multiprotein complex that is one of the five general transcription factors that binds RNA polymerase II holoenzyme Back     alignment and domain information
>cd01475 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity Back     alignment and domain information
>cd01476 VWA_integrin_invertebrates VWA_integrin (invertebrates): Integrins are a family of cell surface receptors that have diverse functions in cell-cell and cell-extracellular matrix interactions Back     alignment and domain information
>cd01477 vWA_F09G8-8_type VWA F09G8 Back     alignment and domain information
>PF00092 VWA: von Willebrand factor type A domain; InterPro: IPR002035 The von Willebrand factor is a large multimeric glycoprotein found in blood plasma Back     alignment and domain information
>cd01471 vWA_micronemal_protein Micronemal proteins: The Toxoplasma lytic cycle begins when the parasite actively invades a target cell Back     alignment and domain information
>cd00198 vWFA Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>smart00187 INB Integrin beta subunits (N-terminal portion of extracellular region) Back     alignment and domain information
>cd01467 vWA_BatA_type VWA BatA type: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>cd01452 VWA_26S_proteasome_subunit 26S proteasome plays a major role in eukaryotic protein breakdown, especially for ubiquitin-tagged proteins Back     alignment and domain information
>PF13768 VWA_3: von Willebrand factor type A domain Back     alignment and domain information
>smart00327 VWA von Willebrand factor (vWF) type A domain Back     alignment and domain information
>cd01463 vWA_VGCC_like VWA Voltage gated Calcium channel like: Voltage-gated calcium channels are a complex of five proteins: alpha 1, beta 1, gamma, alpha 2 and delta Back     alignment and domain information
>COG1240 ChlD Mg-chelatase subunit ChlD [Coenzyme metabolism] Back     alignment and domain information
>cd01456 vWA_ywmD_type VWA ywmD type:Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>cd01470 vWA_complement_factors Complement factors B and C2 are two critical proteases for complement activation Back     alignment and domain information
>PTZ00441 sporozoite surface protein 2 (SSP2); Provisional Back     alignment and domain information
>PRK13685 hypothetical protein; Provisional Back     alignment and domain information
>cd01465 vWA_subgroup VWA subgroup: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>cd01454 vWA_norD_type norD type: Denitrifying bacteria contain both membrane bound and periplasmic nitrate reductases Back     alignment and domain information
>cd01451 vWA_Magnesium_chelatase Magnesium chelatase: Mg-chelatase catalyses the insertion of Mg into protoporphyrin IX (Proto) Back     alignment and domain information
>TIGR03436 acidobact_VWFA VWFA-related Acidobacterial domain Back     alignment and domain information
>cd01461 vWA_interalpha_trypsin_inhibitor vWA_interalpha trypsin inhibitor (ITI): ITI is a glycoprotein composed of three polypeptides- two heavy chains and one light chain (bikunin) Back     alignment and domain information
>cd01466 vWA_C3HC4_type VWA C3HC4-type: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>cd01464 vWA_subfamily VWA subfamily: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>cd01458 vWA_ku Ku70/Ku80 N-terminal domain Back     alignment and domain information
>PRK13406 bchD magnesium chelatase subunit D; Provisional Back     alignment and domain information
>TIGR02031 BchD-ChlD magnesium chelatase ATPase subunit D Back     alignment and domain information
>cd01462 VWA_YIEM_type VWA YIEM type: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>TIGR02442 Cob-chelat-sub cobaltochelatase subunit Back     alignment and domain information
>PF00362 Integrin_beta: Integrin, beta chain; InterPro: IPR002369 Integrins are the major metazoan receptors for cell adhesion to extracellular matrix proteins and, in vertebrates, also play important roles in certain cell-cell adhesions, make transmembrane connections to the cytoskeleton and activate many intracellular signalling pathways [, ] Back     alignment and domain information
>TIGR00868 hCaCC calcium-activated chloride channel protein 1 Back     alignment and domain information
>cd01460 vWA_midasin VWA_Midasin: Midasin is a member of the AAA ATPase family Back     alignment and domain information
>TIGR03788 marine_srt_targ marine proteobacterial sortase target protein Back     alignment and domain information
>PF03731 Ku_N: Ku70/Ku80 N-terminal alpha/beta domain; InterPro: IPR005161 The Ku heterodimer (composed of Ku70 P12956 from SWISSPROT and Ku80 P13010 from SWISSPROT) contributes to genomic integrity through its ability to bind DNA double-strand breaks and facilitate repair by the non-homologous end-joining pathway Back     alignment and domain information
>PF04056 Ssl1: Ssl1-like; InterPro: IPR007198 Ssl1-like proteins are 40 kDa subunits of the transcription factor II H complex Back     alignment and domain information
>cd01455 vWA_F11C1-5a_type Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>cd01457 vWA_ORF176_type VWA ORF176 type: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>COG4245 TerY Uncharacterized protein encoded in toxicity protection region of plasmid R478, contains von Willebrand factor (vWF) domain [General function prediction only] Back     alignment and domain information
>PF04811 Sec23_trunk: Sec23/Sec24 trunk domain; InterPro: IPR006896 COPII (coat protein complex II)-coated vesicles carry proteins from the endoplasmic reticulum (ER) to the Golgi complex [] Back     alignment and domain information
>KOG3598 consensus Thyroid hormone receptor-associated protein complex, subunit TRAP230 [Transcription] Back     alignment and domain information
>cd01468 trunk_domain trunk domain Back     alignment and domain information
>KOG3598 consensus Thyroid hormone receptor-associated protein complex, subunit TRAP230 [Transcription] Back     alignment and domain information
>TIGR00578 ku70 ATP-dependent DNA helicase ii, 70 kDa subunit (ku70) Back     alignment and domain information
>cd01479 Sec24-like Sec24-like: Protein and membrane traffic in eukaryotes is mediated by at least in part by the budding and fusion of intracellular transport vesicles that selectively carry cargo proteins and lipids from donor to acceptor organelles Back     alignment and domain information
>PF11498 Activator_LAG-3: Transcriptional activator LAG-3; InterPro: IPR021587 The C Back     alignment and domain information
>KOG2807 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription; Replication, recombination and repair] Back     alignment and domain information
>PF05762 VWA_CoxE: VWA domain containing CoxE-like protein; InterPro: IPR008912 This group of proteins contains a VWA type domain and the function of this family is unknown Back     alignment and domain information
>PF06707 DUF1194: Protein of unknown function (DUF1194); InterPro: IPR010607 This family consists of several hypothetical Rhizobiales specific proteins of around 270 residues in length Back     alignment and domain information
>PRK10997 yieM hypothetical protein; Provisional Back     alignment and domain information
>COG5148 RPN10 26S proteasome regulatory complex, subunit RPN10/PSMD4 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01478 Sec23-like Sec23-like: Protein and membrane traffic in eukaryotes is mediated by at least in part by the budding and fusion of intracellular transport vesicles that selectively carry cargo proteins and lipids from donor to acceptor organelles Back     alignment and domain information
>PF10138 vWA-TerF-like: vWA found in TerF C terminus ; InterPro: IPR019303 This entry represents the N-terminal domain of a family of proteins that confer resistance to the metalloid element tellurium and its salts Back     alignment and domain information
>KOG1226 consensus Integrin beta subunit (N-terminal portion of extracellular region) [Signal transduction mechanisms; Extracellular structures] Back     alignment and domain information
>PF11235 Med25_SD1: Mediator complex subunit 25 synapsin 1; InterPro: IPR021397 The overall function of the full-length Med25 is efficiently to coordinate the transcriptional activation of RAR/RXR (retinoic acid receptor/retinoic X receptor) in higher eukaryotic cells Back     alignment and domain information
>KOG1984 consensus Vesicle coat complex COPII, subunit SFB3 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PTZ00395 Sec24-related protein; Provisional Back     alignment and domain information
>PLN00162 transport protein sec23; Provisional Back     alignment and domain information
>KOG2884 consensus 26S proteasome regulatory complex, subunit RPN10/PSMD4 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2353 consensus L-type voltage-dependent Ca2+ channel, alpha2/delta subunit [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>COG5151 SSL1 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00627 tfb4 transcription factor tfb4 Back     alignment and domain information
>PF09967 DUF2201: VWA-like domain (DUF2201); InterPro: IPR018698 This family of various hypothetical bacterial proteins has no known function Back     alignment and domain information
>COG2425 Uncharacterized protein containing a von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>PF03850 Tfb4: Transcription factor Tfb4; InterPro: IPR004600 Members of this family are part of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query833
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 2e-10
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 4e-10
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 1e-09
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 2e-09
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 4e-08
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 1e-07
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 4e-07
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 5e-07
3lj5_A725 Portal protein, protein GP1; DNA ejection, molecul 1e-09
3lj5_A725 Portal protein, protein GP1; DNA ejection, molecul 3e-09
3lj5_A725 Portal protein, protein GP1; DNA ejection, molecul 4e-09
3lj5_A725 Portal protein, protein GP1; DNA ejection, molecul 7e-09
3lj5_A725 Portal protein, protein GP1; DNA ejection, molecul 1e-07
3lj5_A725 Portal protein, protein GP1; DNA ejection, molecul 9e-06
3lj5_A725 Portal protein, protein GP1; DNA ejection, molecul 1e-05
3lj5_A725 Portal protein, protein GP1; DNA ejection, molecul 7e-04
1yvl_A 683 Signal transducer and activator of transcription 1 1e-07
1yvl_A 683 Signal transducer and activator of transcription 1 8e-06
1yvl_A 683 Signal transducer and activator of transcription 1 1e-05
1yvl_A 683 Signal transducer and activator of transcription 1 2e-05
1yvl_A 683 Signal transducer and activator of transcription 1 3e-05
1yvl_A 683 Signal transducer and activator of transcription 1 4e-05
1yvl_A 683 Signal transducer and activator of transcription 1 3e-04
1yvl_A 683 Signal transducer and activator of transcription 1 5e-04
1yvl_A 683 Signal transducer and activator of transcription 1 6e-04
1f5n_A592 Interferon-induced guanylate-binding protein 1; GB 2e-07
1f5n_A592 Interferon-induced guanylate-binding protein 1; GB 2e-07
1f5n_A592 Interferon-induced guanylate-binding protein 1; GB 3e-07
1f5n_A592 Interferon-induced guanylate-binding protein 1; GB 4e-06
1f5n_A592 Interferon-induced guanylate-binding protein 1; GB 2e-05
1f5n_A592 Interferon-induced guanylate-binding protein 1; GB 7e-05
3ghg_C 411 Fibrinogen gamma chain; triple-stranded coiled coi 2e-07
3ghg_C 411 Fibrinogen gamma chain; triple-stranded coiled coi 3e-05
3ghg_C 411 Fibrinogen gamma chain; triple-stranded coiled coi 6e-05
1m1j_B 464 Fibrinogen beta chain; coiled coils, disulfide rin 5e-07
1m1j_B 464 Fibrinogen beta chain; coiled coils, disulfide rin 3e-06
1m1j_B 464 Fibrinogen beta chain; coiled coils, disulfide rin 3e-05
1bg1_A 596 Protein (transcription factor STAT3B); protein-DNA 2e-06
1bg1_A 596 Protein (transcription factor STAT3B); protein-DNA 4e-06
1bg1_A 596 Protein (transcription factor STAT3B); protein-DNA 8e-06
1bg1_A 596 Protein (transcription factor STAT3B); protein-DNA 2e-05
1bg1_A 596 Protein (transcription factor STAT3B); protein-DNA 2e-05
1bg1_A 596 Protein (transcription factor STAT3B); protein-DNA 3e-05
1bg1_A 596 Protein (transcription factor STAT3B); protein-DNA 3e-05
1uur_A 473 Stata protein, STAT protein; transcription activat 3e-06
1uur_A 473 Stata protein, STAT protein; transcription activat 5e-06
1uur_A 473 Stata protein, STAT protein; transcription activat 2e-05
1uur_A 473 Stata protein, STAT protein; transcription activat 7e-04
2es4_D332 Lipase chaperone; protein-protein complex, steric 5e-06
2es4_D332 Lipase chaperone; protein-protein complex, steric 1e-04
1bf5_A 575 Signal transducer and activator of transcription 1 1e-05
1bf5_A 575 Signal transducer and activator of transcription 1 1e-05
1bf5_A 575 Signal transducer and activator of transcription 1 1e-05
1bf5_A 575 Signal transducer and activator of transcription 1 4e-05
1bf5_A 575 Signal transducer and activator of transcription 1 5e-05
1bf5_A 575 Signal transducer and activator of transcription 1 7e-05
3ibp_A 302 Chromosome partition protein MUKB; structural main 1e-05
3ibp_A 302 Chromosome partition protein MUKB; structural main 3e-05
3ibp_A 302 Chromosome partition protein MUKB; structural main 3e-04
2v71_A189 Nuclear distribution protein NUDE-like 1; developm 1e-05
1lwu_C 323 Fibrinogen gamma chain; heterotrimer, protein-pept 2e-05
1lwu_C 323 Fibrinogen gamma chain; heterotrimer, protein-pept 5e-05
1y1u_A 585 Signal transducer and activator of transcription; 4e-05
1y1u_A 585 Signal transducer and activator of transcription; 8e-05
1y1u_A 585 Signal transducer and activator of transcription; 1e-04
1y1u_A 585 Signal transducer and activator of transcription; 2e-04
1y1u_A 585 Signal transducer and activator of transcription; 2e-04
1y1u_A 585 Signal transducer and activator of transcription; 5e-04
1m1j_C 409 Fibrinogen gamma chain; coiled coils, disulfide ri 1e-04
3c8j_A203 Natural killer cell receptor LY49C; MHC, virus, im 1e-04
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 2e-04
3ghg_A562 Fibrinogen alpha chain; triple-stranded coiled coi 3e-04
3ajw_A150 Flagellar FLIJ protein; flagellum, type III secret 3e-04
3o0z_A168 RHO-associated protein kinase 1; coiled-coil, tran 3e-04
1vt0_M602 Portal protein, protein GP1; portal protein, DNA e 5e-04
2h8n_A112 HD4, histone deacetylase 4; alpha helix, polar zip 6e-04
1jad_A251 PLC-beta, phospholipase C beta; alpha helical coil 7e-04
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
 Score = 63.7 bits (154), Expect = 2e-10
 Identities = 20/133 (15%), Positives = 36/133 (27%)

Query: 689 ISSQQQQQLQQQQQQQQHQQMQSQLQHQQLSQLQQQQQQLPQLQQQIPQLQQQQQIPQLQ 748
           +S  +++   Q Q Q        Q   Q +         +   Q  +P       + Q Q
Sbjct: 1   MSHHKKRVYPQAQLQYGQNATPLQQPAQFMPPQDPAAAGMSYGQMGMPPQGAVPSMGQQQ 60

Query: 749 QQSMPQLQQQQQLPQLQQQQQLPQMQQQQQLPQLQQQQQLSQPQQMVGSGMGQGYVQGPG 808
             +  Q Q  QQ+ Q         +     +      Q     Q        Q  +  P 
Sbjct: 61  FLTPAQEQLHQQIDQATTSMNDMHLHNVPLVDPNAYMQPQVPVQMGTPLQQQQQPMAAPA 120

Query: 809 RTQLVSQGQVSSQ 821
             Q  +    + +
Sbjct: 121 YGQPSAAMGQNMR 133


>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>3lj5_A Portal protein, protein GP1; DNA ejection, molecular motor, DNA packaging podoviridae, virus assembly, tail tube, trunk domain; 7.50A {Enterobacteria phage P22} Length = 725 Back     alignment and structure
>3lj5_A Portal protein, protein GP1; DNA ejection, molecular motor, DNA packaging podoviridae, virus assembly, tail tube, trunk domain; 7.50A {Enterobacteria phage P22} Length = 725 Back     alignment and structure
>3lj5_A Portal protein, protein GP1; DNA ejection, molecular motor, DNA packaging podoviridae, virus assembly, tail tube, trunk domain; 7.50A {Enterobacteria phage P22} Length = 725 Back     alignment and structure
>3lj5_A Portal protein, protein GP1; DNA ejection, molecular motor, DNA packaging podoviridae, virus assembly, tail tube, trunk domain; 7.50A {Enterobacteria phage P22} Length = 725 Back     alignment and structure
>3lj5_A Portal protein, protein GP1; DNA ejection, molecular motor, DNA packaging podoviridae, virus assembly, tail tube, trunk domain; 7.50A {Enterobacteria phage P22} Length = 725 Back     alignment and structure
>3lj5_A Portal protein, protein GP1; DNA ejection, molecular motor, DNA packaging podoviridae, virus assembly, tail tube, trunk domain; 7.50A {Enterobacteria phage P22} Length = 725 Back     alignment and structure
>3lj5_A Portal protein, protein GP1; DNA ejection, molecular motor, DNA packaging podoviridae, virus assembly, tail tube, trunk domain; 7.50A {Enterobacteria phage P22} Length = 725 Back     alignment and structure
>3lj5_A Portal protein, protein GP1; DNA ejection, molecular motor, DNA packaging podoviridae, virus assembly, tail tube, trunk domain; 7.50A {Enterobacteria phage P22} Length = 725 Back     alignment and structure
>1yvl_A Signal transducer and activator of transcription 1-alpha/beta; signaling protein; HET: PTR; 3.00A {Homo sapiens} Length = 683 Back     alignment and structure
>1yvl_A Signal transducer and activator of transcription 1-alpha/beta; signaling protein; HET: PTR; 3.00A {Homo sapiens} Length = 683 Back     alignment and structure
>1yvl_A Signal transducer and activator of transcription 1-alpha/beta; signaling protein; HET: PTR; 3.00A {Homo sapiens} Length = 683 Back     alignment and structure
>1yvl_A Signal transducer and activator of transcription 1-alpha/beta; signaling protein; HET: PTR; 3.00A {Homo sapiens} Length = 683 Back     alignment and structure
>1yvl_A Signal transducer and activator of transcription 1-alpha/beta; signaling protein; HET: PTR; 3.00A {Homo sapiens} Length = 683 Back     alignment and structure
>1yvl_A Signal transducer and activator of transcription 1-alpha/beta; signaling protein; HET: PTR; 3.00A {Homo sapiens} Length = 683 Back     alignment and structure
>1yvl_A Signal transducer and activator of transcription 1-alpha/beta; signaling protein; HET: PTR; 3.00A {Homo sapiens} Length = 683 Back     alignment and structure
>1yvl_A Signal transducer and activator of transcription 1-alpha/beta; signaling protein; HET: PTR; 3.00A {Homo sapiens} Length = 683 Back     alignment and structure
>1yvl_A Signal transducer and activator of transcription 1-alpha/beta; signaling protein; HET: PTR; 3.00A {Homo sapiens} Length = 683 Back     alignment and structure
>1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Length = 592 Back     alignment and structure
>1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Length = 592 Back     alignment and structure
>1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Length = 592 Back     alignment and structure
>1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Length = 592 Back     alignment and structure
>1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Length = 592 Back     alignment and structure
>1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Length = 592 Back     alignment and structure
>3ghg_C Fibrinogen gamma chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 1deq_C Length = 411 Back     alignment and structure
>3ghg_C Fibrinogen gamma chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 1deq_C Length = 411 Back     alignment and structure
>3ghg_C Fibrinogen gamma chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 1deq_C Length = 411 Back     alignment and structure
>1m1j_B Fibrinogen beta chain; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: d.171.1.1 h.1.8.1 PDB: 1ei3_B* Length = 464 Back     alignment and structure
>1m1j_B Fibrinogen beta chain; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: d.171.1.1 h.1.8.1 PDB: 1ei3_B* Length = 464 Back     alignment and structure
>1m1j_B Fibrinogen beta chain; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: d.171.1.1 h.1.8.1 PDB: 1ei3_B* Length = 464 Back     alignment and structure
>1bg1_A Protein (transcription factor STAT3B); protein-DNA complex, cytokine activation, complex (transcription factor/DNA), transcription/DNA complex; HET: DNA PTR; 2.25A {Mus musculus} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 PDB: 3cwg_A Length = 596 Back     alignment and structure
>1bg1_A Protein (transcription factor STAT3B); protein-DNA complex, cytokine activation, complex (transcription factor/DNA), transcription/DNA complex; HET: DNA PTR; 2.25A {Mus musculus} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 PDB: 3cwg_A Length = 596 Back     alignment and structure
>1bg1_A Protein (transcription factor STAT3B); protein-DNA complex, cytokine activation, complex (transcription factor/DNA), transcription/DNA complex; HET: DNA PTR; 2.25A {Mus musculus} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 PDB: 3cwg_A Length = 596 Back     alignment and structure
>1bg1_A Protein (transcription factor STAT3B); protein-DNA complex, cytokine activation, complex (transcription factor/DNA), transcription/DNA complex; HET: DNA PTR; 2.25A {Mus musculus} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 PDB: 3cwg_A Length = 596 Back     alignment and structure
>1bg1_A Protein (transcription factor STAT3B); protein-DNA complex, cytokine activation, complex (transcription factor/DNA), transcription/DNA complex; HET: DNA PTR; 2.25A {Mus musculus} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 PDB: 3cwg_A Length = 596 Back     alignment and structure
>1bg1_A Protein (transcription factor STAT3B); protein-DNA complex, cytokine activation, complex (transcription factor/DNA), transcription/DNA complex; HET: DNA PTR; 2.25A {Mus musculus} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 PDB: 3cwg_A Length = 596 Back     alignment and structure
>1bg1_A Protein (transcription factor STAT3B); protein-DNA complex, cytokine activation, complex (transcription factor/DNA), transcription/DNA complex; HET: DNA PTR; 2.25A {Mus musculus} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 PDB: 3cwg_A Length = 596 Back     alignment and structure
>1uur_A Stata protein, STAT protein; transcription activator, SH2, signal transduction, transducer, transcription factor; HET: PTR; 2.7A {Dictyostelium discoideum} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 PDB: 1uus_A* Length = 473 Back     alignment and structure
>1uur_A Stata protein, STAT protein; transcription activator, SH2, signal transduction, transducer, transcription factor; HET: PTR; 2.7A {Dictyostelium discoideum} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 PDB: 1uus_A* Length = 473 Back     alignment and structure
>1uur_A Stata protein, STAT protein; transcription activator, SH2, signal transduction, transducer, transcription factor; HET: PTR; 2.7A {Dictyostelium discoideum} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 PDB: 1uus_A* Length = 473 Back     alignment and structure
>1uur_A Stata protein, STAT protein; transcription activator, SH2, signal transduction, transducer, transcription factor; HET: PTR; 2.7A {Dictyostelium discoideum} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 PDB: 1uus_A* Length = 473 Back     alignment and structure
>2es4_D Lipase chaperone; protein-protein complex, steric chaperone, triacylglycerol hydrolase, all alpha helix protein, A/B hydrolase fold; 1.85A {Burkholderia glumae} SCOP: a.137.15.1 Length = 332 Back     alignment and structure
>2es4_D Lipase chaperone; protein-protein complex, steric chaperone, triacylglycerol hydrolase, all alpha helix protein, A/B hydrolase fold; 1.85A {Burkholderia glumae} SCOP: a.137.15.1 Length = 332 Back     alignment and structure
>1bf5_A Signal transducer and activator of transcription 1-alpha/beta; complex (SH2 domain/DNA), SH2 domain, transcription factor; HET: DNA PTR; 2.90A {Homo sapiens} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 Length = 575 Back     alignment and structure
>1bf5_A Signal transducer and activator of transcription 1-alpha/beta; complex (SH2 domain/DNA), SH2 domain, transcription factor; HET: DNA PTR; 2.90A {Homo sapiens} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 Length = 575 Back     alignment and structure
>1bf5_A Signal transducer and activator of transcription 1-alpha/beta; complex (SH2 domain/DNA), SH2 domain, transcription factor; HET: DNA PTR; 2.90A {Homo sapiens} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 Length = 575 Back     alignment and structure
>1bf5_A Signal transducer and activator of transcription 1-alpha/beta; complex (SH2 domain/DNA), SH2 domain, transcription factor; HET: DNA PTR; 2.90A {Homo sapiens} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 Length = 575 Back     alignment and structure
>1bf5_A Signal transducer and activator of transcription 1-alpha/beta; complex (SH2 domain/DNA), SH2 domain, transcription factor; HET: DNA PTR; 2.90A {Homo sapiens} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 Length = 575 Back     alignment and structure
>1bf5_A Signal transducer and activator of transcription 1-alpha/beta; complex (SH2 domain/DNA), SH2 domain, transcription factor; HET: DNA PTR; 2.90A {Homo sapiens} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 Length = 575 Back     alignment and structure
>3ibp_A Chromosome partition protein MUKB; structural maintenance of chromosomes, SMC, condensin, chromosome segregation, hinge, dimerization domain; 3.10A {Escherichia coli} Length = 302 Back     alignment and structure
>3ibp_A Chromosome partition protein MUKB; structural maintenance of chromosomes, SMC, condensin, chromosome segregation, hinge, dimerization domain; 3.10A {Escherichia coli} Length = 302 Back     alignment and structure
>3ibp_A Chromosome partition protein MUKB; structural maintenance of chromosomes, SMC, condensin, chromosome segregation, hinge, dimerization domain; 3.10A {Escherichia coli} Length = 302 Back     alignment and structure
>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Length = 189 Back     alignment and structure
>1lwu_C Fibrinogen gamma chain; heterotrimer, protein-peptide complex, blood clotting; HET: NDG MAN NAG BMA GAL; 2.80A {Petromyzon marinus} SCOP: d.171.1.1 h.1.8.1 PDB: 1n73_C* Length = 323 Back     alignment and structure
>1lwu_C Fibrinogen gamma chain; heterotrimer, protein-peptide complex, blood clotting; HET: NDG MAN NAG BMA GAL; 2.80A {Petromyzon marinus} SCOP: d.171.1.1 h.1.8.1 PDB: 1n73_C* Length = 323 Back     alignment and structure
>1y1u_A Signal transducer and activator of transcription; STAT, DNA-binding, SH2 domain, transcription REGU signaling protein; 3.21A {Mus musculus} Length = 585 Back     alignment and structure
>1y1u_A Signal transducer and activator of transcription; STAT, DNA-binding, SH2 domain, transcription REGU signaling protein; 3.21A {Mus musculus} Length = 585 Back     alignment and structure
>1y1u_A Signal transducer and activator of transcription; STAT, DNA-binding, SH2 domain, transcription REGU signaling protein; 3.21A {Mus musculus} Length = 585 Back     alignment and structure
>1y1u_A Signal transducer and activator of transcription; STAT, DNA-binding, SH2 domain, transcription REGU signaling protein; 3.21A {Mus musculus} Length = 585 Back     alignment and structure
>1y1u_A Signal transducer and activator of transcription; STAT, DNA-binding, SH2 domain, transcription REGU signaling protein; 3.21A {Mus musculus} Length = 585 Back     alignment and structure
>1y1u_A Signal transducer and activator of transcription; STAT, DNA-binding, SH2 domain, transcription REGU signaling protein; 3.21A {Mus musculus} Length = 585 Back     alignment and structure
>1m1j_C Fibrinogen gamma chain; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: d.171.1.1 h.1.8.1 PDB: 1ei3_C Length = 409 Back     alignment and structure
>3c8j_A Natural killer cell receptor LY49C; MHC, virus, immune system; 2.60A {Mus musculus} SCOP: d.169.1.1 PDB: 3c8k_D 1p4l_D 1ja3_A 1p1z_D Length = 203 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* Length = 562 Back     alignment and structure
>3ajw_A Flagellar FLIJ protein; flagellum, type III secretion, coiled-coil, protein transpor; 2.10A {Salmonella typhimurium} Length = 150 Back     alignment and structure
>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Length = 168 Back     alignment and structure
>1vt0_M Portal protein, protein GP1; portal protein, DNA ejection, molecular motor, DNA packaging podoviridae; 3.25A {Enterobacteria phage P22} PDB: 3lj4_A Length = 602 Back     alignment and structure
>2h8n_A HD4, histone deacetylase 4; alpha helix, polar zipper, transcription; 2.60A {Homo sapiens} PDB: 2o94_A Length = 112 Back     alignment and structure
>1jad_A PLC-beta, phospholipase C beta; alpha helical coiled coil, hydrolase; 2.40A {Meleagris gallopavo} SCOP: h.4.10.1 Length = 251 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query833
2iue_A212 Pactolus I-domain; membrane protein, CD, ITC, limb 99.61
3vi3_B454 Integrin beta-1; beta propeller fold, rossman fold 99.39
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 99.38
3t3p_B472 Integrin beta-3; integrin, cell adhesion, blood cl 99.37
3v4v_B503 Integrin beta-7; cell adhesion, madcam-1, membrane 99.35
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 99.32
1ijb_A202 VON willebrand factor; dinucleotide-binding fold, 98.98
2xgg_A178 Microneme protein 2; A/I domain, cell adhesion, hy 98.97
1v7p_C200 Integrin alpha-2; snake venom, C-type lectin, anta 98.93
1atz_A189 VON willebrand factor; collagen-binding, hemostasi 98.93
3n2n_F185 Anthrax toxin receptor 1; rossmann fold; 1.80A {Ho 98.86
3ibs_A218 Conserved hypothetical protein BATB; structural ge 98.84
2b2x_A223 Integrin alpha-1; computational design, antibody-a 98.82
1mf7_A194 Integrin alpha M; cell adhesion; 1.25A {Homo sapie 98.8
1pt6_A213 Integrin alpha-1; cell adhesion; 1.87A {Homo sapie 98.79
1n3y_A198 Integrin alpha-X; alpha/beta rossmann fold, cell a 98.78
1shu_X182 Anthrax toxin receptor 2; alpha/beta rossmann fold 98.77
4hqo_A266 Sporozoite surface protein 2; malaria, gliding mot 98.74
1q0p_A223 Complement factor B; VON willebrand factor, MAC-1, 98.7
4b4t_W268 RPN10, 26S proteasome regulatory subunit RPN10; hy 98.69
4hqf_A281 Thrombospondin-related anonymous protein, trap; ma 98.65
3zqk_A199 VON willebrand factor; blood clotting, adamts-13, 98.63
2x5n_A192 SPRPN10, 26S proteasome regulatory subunit RPN10; 98.57
1rrk_A497 Complement factor B; BB, hydrolase; 2.00A {Homo sa 98.52
2odp_A509 Complement C2; C3/C5 convertase, complement serin 98.51
3hrz_D741 Complement factor B; serine protease, glycosilated 98.45
1mjn_A179 Integrin alpha-L; rossmann fold, immune system; 1. 98.38
4fx5_A464 VON willebrand factor type A; structural genomics, 98.26
3k6s_A 1095 Integrin alpha-X; cell receptor, adhesion molecule 98.2
2x31_A189 Magnesium-chelatase 60 kDa subunit; ligase, bacter 98.1
1jey_B565 KU80; double-strand DNA break repair, non-homologo 98.0
1jey_A609 KU70; double-strand DNA break repair, non-homologo 97.85
3rag_A242 Uncharacterized protein; structural genomics, PSI- 97.78
2ww8_A893 RRGA, cell WALL surface anchor family protein; IGG 97.2
1yvr_A538 RO autoantigen, 60-kDa SS-A/RO ribonucleoprotein, 95.65
1m2v_B926 SEC24, protein transport protein SEC24, SEC24P, SE 94.49
3eh1_A751 Protein transport protein SEC24B; copii coat prote 94.46
1pcx_A810 Protein transport protein SEC24; 2.50A {Saccharomy 94.43
3iot_A449 Maltose-binding protein, huntingtin fusion protei; 94.39
2nut_A769 Protein transport protein SEC23A; human copii SEC2 93.16
3iot_A449 Maltose-binding protein, huntingtin fusion protei; 92.37
3efo_B770 SEC24 related gene family, member D; copii, coat p 91.76
1m2o_A768 SEC23, protein transport protein SEC23, SEC23P; zi 91.13
3eh2_A766 Protein transport protein SEC24C; copii-coat prote 90.43
2nvo_A535 RO sixty-related protein, RSR; alpha helical repea 90.11
>2iue_A Pactolus I-domain; membrane protein, CD, ITC, limbs, midas, admidas, membrane, integrin, titration, rossman fold, cell adhesion, transmembrane; NMR {Mus musculus} Back     alignment and structure
Probab=99.61  E-value=4.3e-15  Score=152.58  Aligned_cols=170  Identities=9%  Similarity=0.070  Sum_probs=123.1

Q ss_pred             ccEEEEEeCCccchHhHHHHHHHHHHHHHHHhhcccCccCccCCccEEEEEEeecCCCccccceeeccCCCCHHHHHHHH
Q 003297            4 KQLIVAVEGTAAMGPYWQSIVSDYLEKIIRCFCVNELAGQTSASNVELSLVTFNTHGSYCACLVQRSGWTKDVDIFLHWL   83 (833)
Q Consensus         4 ~dvVFVID~Tasmg~y~~~lkt~YI~p~le~f~~~~l~~~~~g~~~~~gLV~Y~d~~~~~~~lv~~~gfT~d~~~fl~~L   83 (833)
                      .|||||+|.|+||++|++.+|+.. ..+++.+..       +..++|||++.|+|+    .| ...+.||+|.++|.+++
T Consensus         4 vDl~fl~D~S~SM~~di~~lk~~~-~~l~~~l~~-------~~~~~r~Gfg~f~Dk----~~-~~~l~lT~d~~~F~~~v   70 (212)
T 2iue_A            4 VDLYFLMGLSGSAQGHLSNVQTLG-SDLLKALNE-------ISRSGRIGFGSIVNM----TF-QHILKLTADSSQFQREL   70 (212)
T ss_dssp             EEEEEEEECCGGGTTTHHHHHHHH-HHHHHHHHH-------HCSCEEEEEEEESSS----CE-EEEEEEESCHHHHHHHH
T ss_pred             eEEEEEEeCCCcchhHHHHHHHHH-HHHHHHHHh-------hCcCceEEEEEEEcC----cc-eecCCcCCCHHHHHHHH
Confidence            799999999999999999999664 666666652       112589999999999    23 56788999999999999


Q ss_pred             ccCccCCCCCchhHHHHHHHHHHhcc---ccCCCCCCCCCCcCCCcEEEEeecCCCCCCCCC----cccCCcc--ccccc
Q 003297           84 STIPFAGGGFNDAAIAEGLSEALMMF---SVAPNGSQNQQNVDGQRHCILVAASNPHPLPTP----VYRPQMQ--NLDQN  154 (833)
Q Consensus        84 d~I~f~GGG~~~~AvaEGLa~AL~~f---~~~~~~~~~~~~~~~qk~cILIa~SpP~~lp~p----vy~p~~~--~~~~~  154 (833)
                      +++..+||+|.+|+..|||..|+.|.   .|+         . ..|.+||++|++||.....    .+.|.--  .++.|
T Consensus        71 ~~~~vsg~~D~PE~g~dal~qa~~c~~~i~Wr---------~-a~rllvl~TDa~~H~~gDg~l~gi~~pnd~~chl~~g  140 (212)
T 2iue_A           71 RKQLVSGKLATPKGQLDAVVQVAICLGEIGWR---------N-GTRFLVLVTDNDFHLAKDKTLGTRQNTSDGRCHLDDG  140 (212)
T ss_dssp             HTCCCCCCSSSSBCHHHHHHHHHHCHHHHTCC---------S-SEEEEEEECSSCBCCTTGGGGGTCCSCCCSSCCBSSS
T ss_pred             hhccccCCCCCCchHHHHHHHHHHhhhhcccC---------C-ccEEEEEECcCCccccCCccccccccCCccccccCCC
Confidence            99999999999999999999999874   362         2 4699999999999997542    1111000  00111


Q ss_pred             cchhhhhcccCCCHHHHHHHHhhcCcEEEE-eccCcchhHHHHH
Q 003297          155 ENNEAQAESRLSDAETVAKSFVQCSVSLSV-ICPKQLPKLTAIY  197 (833)
Q Consensus       155 e~~~~~~~~~l~d~e~la~~~~e~~I~LSv-IsPrklp~l~~lf  197 (833)
                      + +........-+++++.+.+.+++|.+.. |+-.....+++|-
T Consensus       141 ~-y~~s~~~Dyps~~q~~~~l~~~~i~~ifavt~~~~~~Y~~l~  183 (212)
T 2iue_A          141 M-YRSRGEPDYQSVVQLASKLAENNIQPIFVVPSRMVKTYEKLT  183 (212)
T ss_dssp             B-BGGGGSSCCCCHHHHHHHHHHHTCEEEEEEEHHHHHHHHHHH
T ss_pred             e-eccCcccCCCCHHHHHHHHHhcCCcEEEEEccchhHHHHHHH
Confidence            0 0111111235789999999999999766 5544444444443



>3vi3_B Integrin beta-1; beta propeller fold, rossman fold, beta sandwich, fibronecti receptor, cell adhesion-immune system complex; HET: NAG BMA MAN; 2.90A {Homo sapiens} PDB: 3vi4_B* Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Back     alignment and structure
>3t3p_B Integrin beta-3; integrin, cell adhesion, blood clotting, fibrinogen, platele; HET: NAG BMA MAN; 2.20A {Homo sapiens} PDB: 3t3m_B* 3nig_B* 3nif_B* 3nid_B* 2vdr_B* 2vc2_B* 2vdk_B* 2vdm_B* 2vdn_B* 2vdl_B* 2vdp_B* 2vdq_B* 2vdo_B* 3fcu_B* 1txv_B* 1ty3_B* 1ty5_B* 1ty6_B* 1ty7_B* 1tye_B* Back     alignment and structure
>3v4v_B Integrin beta-7; cell adhesion, madcam-1, membrane; HET: NAG BMA MAN 0DU; 3.10A {Homo sapiens} PDB: 3v4p_B* Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Back     alignment and structure
>1ijb_A VON willebrand factor; dinucleotide-binding fold, blood clotting; 1.80A {Homo sapiens} SCOP: c.62.1.1 PDB: 1ijk_A 1auq_A 1u0n_A 3hxo_A 1uex_C 3hxq_A 1sq0_A 1m10_A 1fns_A 1oak_A 1u0o_C Back     alignment and structure
>2xgg_A Microneme protein 2; A/I domain, cell adhesion, hydrolase; 2.05A {Toxoplasma gondii} Back     alignment and structure
>1v7p_C Integrin alpha-2; snake venom, C-type lectin, antagonist, cell adhes glycoprotein, toxin-cell adhesion complex; HET: NAG; 1.90A {Homo sapiens} SCOP: c.62.1.1 PDB: 1aox_A 1dzi_A Back     alignment and structure
>1atz_A VON willebrand factor; collagen-binding, hemostasis, dinucleotide binding fold; 1.80A {Homo sapiens} SCOP: c.62.1.1 PDB: 4dmu_B 2adf_A 1fe8_A 1ao3_A Back     alignment and structure
>3n2n_F Anthrax toxin receptor 1; rossmann fold; 1.80A {Homo sapiens} SCOP: c.62.1.1 Back     alignment and structure
>3ibs_A Conserved hypothetical protein BATB; structural genomics, protein structure, midwest center for S genomics, MCSG, PSI-2; HET: MSE; 2.10A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2b2x_A Integrin alpha-1; computational design, antibody-antigen complex, immune syste; 2.20A {Rattus norvegicus} SCOP: c.62.1.1 Back     alignment and structure
>1mf7_A Integrin alpha M; cell adhesion; 1.25A {Homo sapiens} SCOP: c.62.1.1 PDB: 1na5_A 1jlm_A 1ido_A 1m1u_A 3q3g_G 1n9z_A 1bhq_1 1bho_1 1idn_1 3qa3_G Back     alignment and structure
>1pt6_A Integrin alpha-1; cell adhesion; 1.87A {Homo sapiens} SCOP: c.62.1.1 PDB: 4a0q_A 1qcy_A 1qc5_A 1qc5_B 1ck4_A 1mhp_A Back     alignment and structure
>1n3y_A Integrin alpha-X; alpha/beta rossmann fold, cell adhesion; 1.65A {Homo sapiens} SCOP: c.62.1.1 Back     alignment and structure
>1shu_X Anthrax toxin receptor 2; alpha/beta rossmann fold, membrane protein; 1.50A {Homo sapiens} SCOP: c.62.1.1 PDB: 1tzn_a 1sht_X 1t6b_Y* Back     alignment and structure
>4hqo_A Sporozoite surface protein 2; malaria, gliding motility, VWA domain, TSR domain, extensibl ribbon, receptor on sporozoite, vaccine target; HET: FUC BGC; 2.19A {Plasmodium vivax} PDB: 4hql_A* 4hqn_A* Back     alignment and structure
>1q0p_A Complement factor B; VON willebrand factor, MAC-1, I domain, A domain, hydrolase; 1.80A {Homo sapiens} SCOP: c.62.1.1 Back     alignment and structure
>4b4t_W RPN10, 26S proteasome regulatory subunit RPN10; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4hqf_A Thrombospondin-related anonymous protein, trap; malaria, parasite motility, I domain, TSR domain, receptor O sporozoite, vaccine target; 2.20A {Plasmodium falciparum} PDB: 4hqk_A 2bbx_A Back     alignment and structure
>3zqk_A VON willebrand factor; blood clotting, adamts-13, force sensor, VON willebrand DISE domain, haemostasis; HET: NAG; 1.70A {Homo sapiens} PDB: 3ppv_A 3ppx_A 3ppw_A 3ppy_A 3gxb_A* Back     alignment and structure
>2x5n_A SPRPN10, 26S proteasome regulatory subunit RPN10; nuclear protein, nucleus, ubiquitin; 1.30A {Schizosaccharomyces pombe} Back     alignment and structure
>1rrk_A Complement factor B; BB, hydrolase; 2.00A {Homo sapiens} SCOP: b.47.1.2 c.62.1.1 PDB: 1rs0_A* 1rtk_A* 2win_I* 1dle_A Back     alignment and structure
>2odp_A Complement C2; C3/C5 convertase, complement serin protease, human complement system, glycoprotein, SP, VWFA,; HET: NAG; 1.90A {Homo sapiens} PDB: 2odq_A* 2i6q_A* 2i6s_A* Back     alignment and structure
>3hrz_D Complement factor B; serine protease, glycosilated, multi-domain, complement SYST convertase, complement alternate pathway; HET: NAG P6G; 2.20A {Homo sapiens} PDB: 2xwj_I* 3hs0_D* 2ok5_A* 2xwb_F* Back     alignment and structure
>1mjn_A Integrin alpha-L; rossmann fold, immune system; 1.30A {Homo sapiens} SCOP: c.62.1.1 PDB: 3hi6_A 1mq8_B* 3eoa_I 3eob_I 1rd4_A* 1lfa_A 1zon_A 1zoo_A 1zop_A 1dgq_A 1xdd_A* 1xdg_A* 1xuo_A* 3e2m_A* 3bqn_B* 1cqp_A* 3bqm_B* 2ica_A* 2o7n_A* 3m6f_A* ... Back     alignment and structure
>4fx5_A VON willebrand factor type A; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, blood clotting; HET: MSE; 1.73A {Catenulispora acidiphila} Back     alignment and structure
>3k6s_A Integrin alpha-X; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_A* 3k72_A* Back     alignment and structure
>2x31_A Magnesium-chelatase 60 kDa subunit; ligase, bacteriochlorophyll biosynthesis, photosynthesis; 7.50A {Rhodobacter capsulatus} Back     alignment and structure
>1jey_B KU80; double-strand DNA break repair, non-homologous END-joining, protein/nucleic acid complex, alpha/beta domain, beta barrel; HET: DNA; 2.50A {Homo sapiens} SCOP: b.131.1.2 c.62.1.4 PDB: 1jeq_B* Back     alignment and structure
>1jey_A KU70; double-strand DNA break repair, non-homologous END-joining, protein/nucleic acid complex, alpha/beta domain, beta barrel; HET: DNA; 2.50A {Homo sapiens} SCOP: b.131.1.1 c.62.1.3 PDB: 1jeq_A* 3rzx_B Back     alignment and structure
>3rag_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tructural genomics; 1.80A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>2ww8_A RRGA, cell WALL surface anchor family protein; IGG, pilus, CNA_B, adhesin, integrin, cell adhesion; HET: EPE; 1.90A {Streptococcus pneumoniae} Back     alignment and structure
>1yvr_A RO autoantigen, 60-kDa SS-A/RO ribonucleoprotein, 60 kDa; heat repeat, VON willebrand factor A, rossmann fold, midas motif', RNA binding protein; 1.95A {Xenopus laevis} SCOP: a.118.25.1 c.62.1.5 PDB: 1yvp_A 2i91_A Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Back     alignment and structure
>3eh1_A Protein transport protein SEC24B; copii coat protein, vesicle transport, transport signal sequence, cytoplasm, endoplasmic reticulum; 1.80A {Homo sapiens} PDB: 2nut_B 2nup_B 3egd_B 3egx_B Back     alignment and structure
>1pcx_A Protein transport protein SEC24; 2.50A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 PDB: 1pd0_A 1pd1_A Back     alignment and structure
>3iot_A Maltose-binding protein, huntingtin fusion protei; HTT-EX1, HD, sugar transport, transport, apoptos disease mutation, nucleus; 3.50A {Escherichia coli k-12} PDB: 3io6_A 3io4_A 3ior_A 3iou_A 3iov_A 3iow_A Back     alignment and structure
>2nut_A Protein transport protein SEC23A; human copii SEC23/24 complexed with SEC22, protein transport; 2.30A {Homo sapiens} PDB: 2nup_A 3egd_A 3eg9_A 3egx_A 3efo_A Back     alignment and structure
>3iot_A Maltose-binding protein, huntingtin fusion protei; HTT-EX1, HD, sugar transport, transport, apoptos disease mutation, nucleus; 3.50A {Escherichia coli k-12} PDB: 3io6_A 3io4_A 3ior_A 3iou_A 3iov_A 3iow_A Back     alignment and structure
>3efo_B SEC24 related gene family, member D; copii, coat protein, transport signal, disease mutation, endoplasmic reticulum, ER-golgi transport, golgi apparatus, membrane; 2.70A {Homo sapiens} PDB: 3eg9_B Back     alignment and structure
>1m2o_A SEC23, protein transport protein SEC23, SEC23P; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 PDB: 1m2v_A 2qtv_A* Back     alignment and structure
>3eh2_A Protein transport protein SEC24C; copii-coat protein, vesicle transport, cytoplasm, endoplasmic reticulum, ER-golgi transport, golgi apparatus; 2.35A {Homo sapiens} Back     alignment and structure
>2nvo_A RO sixty-related protein, RSR; alpha helical repeats, VON willebrand factor A domain, beta- RNA binding protein; 1.89A {Deinococcus radiodurans} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 833
d1f5na1300 a.114.1.1 (A:284-583) Interferon-induced guanylate 6e-09
d1f5na1300 a.114.1.1 (A:284-583) Interferon-induced guanylate 3e-07
d1f5na1300 a.114.1.1 (A:284-583) Interferon-induced guanylate 4e-07
d1f5na1300 a.114.1.1 (A:284-583) Interferon-induced guanylate 2e-04
d2es4d1280 a.137.15.1 (D:53-332) Lipase chaperone LifO (LipB) 5e-08
d2es4d1280 a.137.15.1 (D:53-332) Lipase chaperone LifO (LipB) 6e-08
d2es4d1280 a.137.15.1 (D:53-332) Lipase chaperone LifO (LipB) 6e-08
d2es4d1280 a.137.15.1 (D:53-332) Lipase chaperone LifO (LipB) 2e-07
d2es4d1280 a.137.15.1 (D:53-332) Lipase chaperone LifO (LipB) 8e-07
d2es4d1280 a.137.15.1 (D:53-332) Lipase chaperone LifO (LipB) 1e-06
d2es4d1280 a.137.15.1 (D:53-332) Lipase chaperone LifO (LipB) 1e-06
d2es4d1280 a.137.15.1 (D:53-332) Lipase chaperone LifO (LipB) 2e-06
d2es4d1280 a.137.15.1 (D:53-332) Lipase chaperone LifO (LipB) 1e-05
d2es4d1280 a.137.15.1 (D:53-332) Lipase chaperone LifO (LipB) 3e-05
d2es4d1280 a.137.15.1 (D:53-332) Lipase chaperone LifO (LipB) 4e-05
d2es4d1280 a.137.15.1 (D:53-332) Lipase chaperone LifO (LipB) 4e-04
d1s6da_103 a.52.1.3 (A:) Methionine-rich 2S protein (albumin 0.001
g1pnb.1106 a.52.1.3 (A:,B:) Napin BNIb {Rape (Brassica napus) 0.001
d2oeza1245 e.68.1.1 (A:1-245) Uncharacterized protein VP2528 0.001
d1psya_125 a.52.1.3 (A:) 2S albumin RicC3 {Castor bean (Ricin 0.003
>d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 300 Back     information, alignment and structure

class: All alpha proteins
fold: Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain
superfamily: Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain
family: Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain
domain: Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 55.9 bits (134), Expect = 6e-09
 Identities = 17/104 (16%), Positives = 44/104 (42%), Gaps = 3/104 (2%)

Query: 682 MVVFKPQISSQQQQQLQQQQQQQQHQQMQSQLQHQQLSQLQQQQQQLPQLQQQIPQLQQQ 741
           +   + +I  ++ +    Q   +   +MQ + +     + +  Q+ L QL +++   + Q
Sbjct: 199 LTEKEKEIEVERVKAESAQASAKMLHEMQRKNEQMMEQKERSYQEHLKQLTEKMENDRVQ 258

Query: 742 QQIPQLQQQSMPQLQQQQQLPQLQQQQQLPQMQQQQQLPQLQQQ 785
                 +Q+    L+ Q+Q   L++  Q      + ++  LQ +
Sbjct: 259 LLK---EQERTLALKLQEQEQLLKEGFQKESRIMKNEIQDLQTK 299


>d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 300 Back     information, alignment and structure
>d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 300 Back     information, alignment and structure
>d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 300 Back     information, alignment and structure
>d1s6da_ a.52.1.3 (A:) Methionine-rich 2S protein (albumin 8) {Common sunflower (Helianthus annuus) [TaxId: 4232]} Length = 103 Back     information, alignment and structure
>d1psya_ a.52.1.3 (A:) 2S albumin RicC3 {Castor bean (Ricinus communis) [TaxId: 3988]} Length = 125 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query833
d1tyeb2248 Integrin beta A domain {Human (Homo sapiens) [TaxI 99.73
d1pt6a_192 Integrin alpha1-beta1 {Human (Homo sapiens) [TaxId 99.01
d1v7pc_193 Integrin alpha2-beta1 {Human (Homo sapiens) [TaxId 98.96
d1atza_184 von Willebrand factor A3 domain, vWA3 {Human (Homo 98.96
d1n3ya_189 Integrin alpha-x beta2 {Human (Homo sapiens) [TaxI 98.95
d1shux_181 Capillary morphogenesis protein 2 domain {Human (H 98.94
d1ijba_202 von Willebrand factor A1 domain, vWA1 {Human (Homo 98.91
d1mf7a_194 Integrin alpha M (CR3, CD11b/CD18, Mac-1 alpha sub 98.83
d1q0pa_209 Complement factor B domain {Human (Homo sapiens) [ 98.72
d1mjna_179 Integrin CD11a/CD18 (Leukocyte function associated 98.63
d1jeyb2236 Ku80 subunit N-terminal domain {Human (Homo sapien 98.31
d1jeya2220 Ku70 subunit N-terminal domain {Human (Homo sapien 97.86
d2qtva3271 Sec23 {Baker's yeast (Saccharomyces cerevisiae) [T 96.6
d1pd0a3252 Sec24 {Baker's yeast (Saccharomyces cerevisiae) [T 96.29
d1yvra2174 60-kda SS-A/Ro ribonucleoprotein, RoRNP {African c 96.23
>d1tyeb2 c.62.1.1 (B:107-354) Integrin beta A domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: vWA-like
superfamily: vWA-like
family: Integrin A (or I) domain
domain: Integrin beta A domain
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.73  E-value=3.8e-17  Score=168.44  Aligned_cols=177  Identities=9%  Similarity=-0.004  Sum_probs=126.1

Q ss_pred             ccEEEEEeCCccchHhHHHHHHHHHHHHHHHhhcccCccCccCCccEEEEEEeecCCCccc-------------------
Q 003297            4 KQLIVAVEGTAAMGPYWQSIVSDYLEKIIRCFCVNELAGQTSASNVELSLVTFNTHGSYCA-------------------   64 (833)
Q Consensus         4 ~dvVFVID~Tasmg~y~~~lkt~YI~p~le~f~~~~l~~~~~g~~~~~gLV~Y~d~~~~~~-------------------   64 (833)
                      .|||||||+|+||++||+.+|+. +..+++.+..-       ...+|||+|.|+|+..-+.                   
T Consensus         6 vDl~Fv~D~TgSM~~~i~~vk~~-i~~i~~~l~~~-------~~~~r~g~~~f~D~~~~p~~~~~~~~~~~~p~~~~~~~   77 (248)
T d1tyeb2           6 VDIYYLMDLSYSMKDDLWSIQNL-GTKLATQMRKL-------TSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTT   77 (248)
T ss_dssp             EEEEEEEECSGGGGGGHHHHHHH-HHHHHHHHHHH-------CSCEEEEEEEECCCSSTTTSCCCSGGGGTCGGGGGTSC
T ss_pred             eeEEEEEECCcCHHHHHHHHHHH-HHHHHHHHHhh-------CcCceEEEEEEEecccCccccccchhhccCcccccccc
Confidence            69999999999999999999986 46777777641       1248999999999864321                   


Q ss_pred             ----cce-eeccCCCCHHHHHHHHccCccCCCCCchhHHHHHHHHHHhc---cccCCCCCCCCCCcCCCcEEEEeecCCC
Q 003297           65 ----CLV-QRSGWTKDVDIFLHWLSTIPFAGGGFNDAAIAEGLSEALMM---FSVAPNGSQNQQNVDGQRHCILVAASNP  136 (833)
Q Consensus        65 ----~lv-~~~gfT~d~~~fl~~Ld~I~f~GGG~~~~AvaEGLa~AL~~---f~~~~~~~~~~~~~~~qk~cILIa~SpP  136 (833)
                          |.. ..+.||+|.++|..+|+++...||||.+|++.+||..|+.|   +.|++         +..|.+|||+|+||
T Consensus        78 ~~~~f~~~~~~~~t~d~~~f~~~l~~~~~~GggD~pE~~~~Al~~a~~~~~~i~Wr~---------~a~r~viliTDA~~  148 (248)
T d1tyeb2          78 CLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRN---------DASHLLVFTTDAKT  148 (248)
T ss_dssp             CCCCCSEEEEEEEESCHHHHHHHHTTCCCCCCSSSSBCHHHHHHHHHHCHHHHTCCT---------TSEEEEEEEESSCB
T ss_pred             ccccccceecCCCCCCHHHHHHHHhheecccCCCCcchHHHHHHHHHHHhhhCCCCC---------CccEEEEEECCCCc
Confidence                111 23578999999999999999999999999999999998854   45533         45689999999999


Q ss_pred             CCCCCCc---------ccCCccccccccchhhhhcccCCCHHHHHHHHhhcCcEEEE-eccCcchhHHHHHHHh
Q 003297          137 HPLPTPV---------YRPQMQNLDQNENNEAQAESRLSDAETVAKSFVQCSVSLSV-ICPKQLPKLTAIYNAA  200 (833)
Q Consensus       137 ~~lp~pv---------y~p~~~~~~~~e~~~~~~~~~l~d~e~la~~~~e~~I~LSv-IsPrklp~l~~lf~ka  200 (833)
                      |.....-         ....+.  ..++-++ ......-.+++|++.+.+++|.+.+ +..+....+++|.+.-
T Consensus       149 H~~~d~~l~g~~~~~d~~~~~~--~~~~~~~-~~~~dyps~~ql~~~l~~~~i~~ifavt~~~~~~Y~~l~~~~  219 (248)
T d1tyeb2         149 HIALDGRLAGIVQPNDGQCHVG--SDNHYSA-STTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELI  219 (248)
T ss_dssp             CCTTGGGGGTCCSCCCCCCCBC--TTSBBGG-GGTSCCCCHHHHHHHHHHTTEEEEEEECGGGHHHHHHHHHTS
T ss_pred             ccccccccccccccCCCccccC--CCCcccc-cccccCCCHHHHHHHHHHhCcEEEEEECchhhHHHHHHHHhc
Confidence            9755310         000000  0011111 1111223579999999999999655 5555567777777754



>d1pt6a_ c.62.1.1 (A:) Integrin alpha1-beta1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v7pc_ c.62.1.1 (C:) Integrin alpha2-beta1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1atza_ c.62.1.1 (A:) von Willebrand factor A3 domain, vWA3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n3ya_ c.62.1.1 (A:) Integrin alpha-x beta2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1shux_ c.62.1.1 (X:) Capillary morphogenesis protein 2 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ijba_ c.62.1.1 (A:) von Willebrand factor A1 domain, vWA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mf7a_ c.62.1.1 (A:) Integrin alpha M (CR3, CD11b/CD18, Mac-1 alpha subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q0pa_ c.62.1.1 (A:) Complement factor B domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mjna_ c.62.1.1 (A:) Integrin CD11a/CD18 (Leukocyte function associated antigen-1, LFA-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jeyb2 c.62.1.4 (B:6-241) Ku80 subunit N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jeya2 c.62.1.3 (A:34-253) Ku70 subunit N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qtva3 c.62.1.2 (A:120-390) Sec23 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pd0a3 c.62.1.2 (A:301-552) Sec24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yvra2 c.62.1.5 (A:364-537) 60-kda SS-A/Ro ribonucleoprotein, RoRNP {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure