Citrus Sinensis ID: 003363

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820------
MERALLSNVIATSDWCANQLLPRISPSFLSRHRHTRFTVAKPAYFSYKRLSVFLAMDASKAAPAKQVSSVLDATAEEEYASLSKLLQDFTNISSIDKAWTFNSGNGNGTQAMFSISQPNLLANKRKKFMLSTVISKENENSVTFQWAPFPVEMTGASAVVPSPSGSKLLVVRNPENESPIQFELWSQSQLEKEFHVPQTVHGSVYADGWFEGISWNSDETLIAYVAEEPSPSKPTFSLGSTKGGSSDKDCNSWKGQGDWEEDWGETYAGKRQPSLFVININSGEVQAVKGIPKSLSVGQVVWAPLNEGLHQYLVFVGWSSETRKLGIKYCYNRPCALYAVRVSLYKSEASELELKESSSEDLPVVNLTESISSAFFPRFSPDGKFLVFLSAKSSVDSGAHSATDSLHRIDWPTNGNFSSLEKIVDVIPVVQCAEGDCFPGLYSSSILSNPWLSDGCTMLLSSIWGSSQVIISVNVSSGELLRITPAESNFSWSLLTLDGDNIIAVSSSPVDVPQVKYGYFVDKANKGTWSWLNVSSPISRCPEKVKSLLSSRQFSIMKIPVKGVSANLTKGAQKPFEAIFVSSSHKKDCSCDPLIVVLHGGPHSVSLSSYSKSLAFLSSVGYSLLIVNYRGSLGFGEEALQSLPGKVGSQDVNDVLTAIDHVIDMGLANPSKVTVVGGSHGGFLTTHLIGQAPDKFVAAAARNPLCNLALMVGTTDIPDWCYVESYGSKGKDSFTESPSVEDLTRFHSKSPISHISKVKTPTIFLLGAQDLRVPVSNGLQYARALREKGVETKVIVFPNDVHGIERPQSDFESFLNIGLWFKKYCK
cHHHHHHHccccccccccccccccccccccccccccEEEccccccccccEEEEEEcccccccccccccccccccHHHHHHHHHHHHHHHHcccccccccccccccccccEEEEEEEEcccccccccEEEEEEEEEcccccEEEEEEccccccccccEEEEEcccccEEEEEEcccccccEEEEEccccccEEEEEEccccccccccccccccEEEcccccEEEEEEEEcccccccccccccccccccccccccccccEEEEccccccccccccEEEEEEcccccEEEccccccccccccEEEccccccccEEEEEEEEccccccccEEEEcccccEEEEEEccccccccccccccccccccccEEEEccccccccccEEcccccEEEEEEccccccccccccccEEEEEEcccccccccccEEEEEEEccccccccccccccccccccccccccccEEEEEEEEccEEEEEEEEcccccEEEEccccccEEEEEEEEcccEEEEEEEccccccEEEEEEEEccccccEEEEEccccccccccccccccccccccEEEEccccccccccccccccEEEEEEEccccccccccccEEEEEcccccccccccccHHHHHHHHcccEEEEEccccccccHHHHHHHcccccccccHHHHHHHHHHHHHccccccccEEEEEccHHHHHHHHHHHcccccEEEEEcccccccHHHHHccccccccHHHHHccccccccccccccHHHHHHHHHcccccccccccccEEEEEcccccccccHHHHHHHHHHHHcccEEEEEEEccccccccccccHHHHHHHHHHHHHHHcc
cHHHHHHHHHHccccHHHHccccccccccccccccEEccccccccccccEEEEEEEcccccccHccccccccccHHHHHHHHHHHHHHHHccccccccEEEEccccccEEEEEEEEcccHHHccccEEEEEEEEEcccccEEEEccccccccccccccccEcccccEEEEEEcccccccEEEEEEccccEEEEEEccccccccEEEcccccEEEEcccccEEEEEEEEcccccccccccccccccccccccccEEEEEEEEccccccccccccEEEEEEcccccEEEEccccccccccccEEcccccccccEEEEEEEccccccccEEEEccccccEEEEEcccccccccccccccccccccccccccccccccccccccccccEEEEEEccccccccccccccEEEEEEccccccccccccEEEEEEccccccccccccccccccccccccccccEEEEEEEccccEEEEEEEcccccEEEEEcccccccEEEEEccccEEEEEEEcccccccEEEEEEcccccccEEEEEcccccccHHcHHHHHHccHHHcccccccccccccccccccccEEEEEEEEcccccccccccEEEEEcccccccccHHHHHHHHHHHHcccEEEEEccccccccHHHHHHHcccccccccHHHHHHHHHHHHHcccccHccEEEEEccHHHHHHHHHHccccccEEEEEEccccEcHHHHccccccccccHHHcccccccHHccccccHHHHHHHHHcccHHHHHcccccEEEEEccccccccHHHHHHHHHHHHHccccEEEEEEccccccccccccHHHHHHHHHHHHHHHcc
MERALLSNVIATSDwcanqllprispsflsrhrhtrftvakpayfsYKRLSVFLamdaskaapakqVSSVLDATAEEEYASLSKLLQDFTnissidkawtfnsgngngtqAMFSISQPNLLANKRKKFMLSTVISkenensvtfqwapfpvemtgasavvpspsgskllvvrnpenespiQFELWSqsqlekefhvpqtvhgsvyadgwfegiswnsDETLIAYVaeepspskptfslgstkggssdkdcnswkgqgdweedwgetyagkrqpslFVININsgevqavkgipkslsvGQVVWAPLNEGLHQYLVFVGWSsetrklgikycynrpcaLYAVRVSLYKSEAselelkesssedlpvvnltesissaffprfspdgkFLVFLSAKssvdsgahsatdslhridwptngnfsslekivdvipvvqcaegdcfpglysssilsnpwlsdgCTMLLSSIWGSSQVIISVNvssgellritpaesnfswslltldgdniiavssspvdvpqvkygyfvdkankgtwswlnvsspisrcpEKVKSLLSSRQfsimkipvkgvsanltkgaqkpfEAIFVssshkkdcscdplivvlhggphsvslsSYSKSLAFLSSVGYSLLIVNYrgslgfgeealqslpgkvgsqdVNDVLTAIDHVIdmglanpskvtvvggshggfltthligqaPDKFVAAAARNPLCNLALMvgttdipdwcyvesygskgkdsftespsvedltrfhskspishiskvktptifllgaqdlrvpvsnGLQYARALREKGVETKvivfpndvhgierpqsdfESFLNIGLWFKKYCK
MERALLSNVIATSDWCANQLLPRispsflsrhrhtrftvakpayfSYKRLSVFLAMDASKAAPAKQVSSVLDATAEEEYASLSKLLQDFTNISSIDKAWTFNSGNGNGTQAMFSISQPNLLANKRKKFMLSTVISKENENSVTFQWAPFPVEMTGASAVVPSPSGSKLLVVRNPENESPIQFELWSQSQLEKEFHVPQTVHGSVYADGWFEGISWNSDETLIAYVAEepspskptfslgstkggssdkdcnsWKGQGDWEEDWGETYAGKRQPSLFVININSGEVQAVKGIPKSLSVGQVVWAPLNEGLHQYLVFVGWSSETRKLGIKYCYNRPCALYAVRVSLYKSEASELElkesssedlpvvNLTESISSAFFPRFSPDGKFLVFLSAKSSVDSGAHsatdslhridwPTNGNFSSLEKIVDVIPVVQCAEGDCFPGLYSSSILSNPWLSDGCTMLLSSIWGSSQVIISVNVSSGELLRITPAESNFSWSLLTLDGDNIIAVssspvdvpqVKYGYFVDKANKGTWSWLnvsspisrcPEKVKSLLSSRQFSIMKIPVKGVSANLTKGAQKPFEAIFVSSSHKKDCSCDPLIVVLHGGPHSVSLSSYSKSLAFLSSVGYSLLIVNYRGSLGFGEEALQSLPGKVGSQDVNDVLTAIDHVIDMGLANPSKVTVVGGSHGGFLTTHLIGQAPDKFVAAAARNPLCNLALMVGTTDIPDWCYVESYGSKGKDSFTESPSVEDLTRfhskspishiskvKTPTIFLLGAQDLRVPVSNGLQYARAlrekgvetkVIVFPNdvhgierpqsdfesflnIGLWFKKYCK
MERALLSNVIATSDWCANQLLPRISPSFLSRHRHTRFTVAKPAYFSYKRLSVFLAMDASKAAPAKQVSSVLDATAEEEYASLSKLLQDFTNISSIDKAWTFNSGNGNGTQAMFSISQPNLLANKRKKFMLSTVISKENENSVTFQWAPFPVEMTGASAVVPSPSGSKLLVVRNPENESPIQFELWSQSQLEKEFHVPQTVHGSVYADGWFEGISWNSDETLIAYVAEEPSPSKPTFSLGSTKGGSSDKDCNSWKGQGDWEEDWGETYAGKRQPSLFVININSGEVQAVKGIPKSLSVGQVVWAPLNEGLHQYLVFVGWSSETRKLGIKYCYNRPCALYAVRVSLYkseaselelkessseDLPVVNLTESISSAFFPRFSPDGKFLVFLSAKSSVDSGAHSATDSLHRIDWPTNGNFSSLEKIVDVIPVVQCAEGDCFPGLYSSSILSNPWLSDGCTMLLSSIWGssqviisvnvssGELLRITPAESNFSWSLLTLDGDNIIAVSSSPVDVPQVKYGYFVDKANKGTWSWLNVSSPISRCPEKVKSLLSSRQFSIMKIPVKGVSANLTKGAQKPFEAIFVSSSHKKDCSCDPLIVVLHGGPHsvslssyskslaflssVGYSLLIVNYRGSLGFGEEALQSLPGKVGSQDVNDVLTAIDHVIDMGLANPSKVTVVGGSHGGFLTTHLIGQAPDKFVAAAARNPLCNLALMVGTTDIPDWCYVESYGSKGKDSFTESPSVEDLTRFHSKSPISHISKVKTPTIFLLGAQDLRVPVSNGLQYARALREKGVETKVIVFPNDVHGIERPQSDFESFLNIGLWFKKYCK
****LLSNVIATSDWCANQLLPRISPSFLSRHRHTRFTVAKPAYFSYKRLSVFLAMDA*******************EYASLSKLLQDFTNISSIDKAWTFNSGNGNGTQAMFSISQPNLLANKRKKFMLSTVISKENENSVTFQWAPFPVEMTG************************IQFELWSQSQLEKEFHVPQTVHGSVYADGWFEGISWNSDETLIAYVA*****************************QGDWEEDWGETYAGKRQPSLFVININSGEVQAVKGIPKSLSVGQVVWAPLNEGLHQYLVFVGWSSETRKLGIKYCYNRPCALYAVRVSLYK*****************VVNLTESISSAFFPRFSPDGKFLVFLSA*************SLHRIDWPTNGNFSSLEKIVDVIPVVQCAEGDCFPGLYSSSILSNPWLSDGCTMLLSSIWGSSQVIISVNVSSGELLRITPAESNFSWSLLTLDGDNIIAVSSSPVDVPQVKYGYFVDKANKGTWSWLNVSSPISRCPEKVKSLLSSRQFSIMKIPVKGVSANLTKGAQKPFEAIFVSSSHKKDCSCDPLIVVLHGGPHSVSLSSYSKSLAFLSSVGYSLLIVNYRGSLGFGEEALQSLPGKVGSQDVNDVLTAIDHVIDMGLANPSKVTVVGGSHGGFLTTHLIGQAPDKFVAAAARNPLCNLALMVGTTDIPDWCYVESYG**************************HISKVKTPTIFLLGAQDLRVPVSNGLQYARALREKGVETKVIVFPNDVHGIERPQSDFESFLNIGLWFKKYC*
****L*SNVIATSDWCANQLLPRISPSF******************************************************SKLLQDFTNISSIDKAWT**SGNGNGTQAMFSISQPNLLANKRKKFMLSTVISKENEN**************GASAVVPSPSGSKLLVVRNPENESPIQFELWSQSQLEKEFHVPQTVHGSVYADGWFEGISWNSDETLIAYVAEEPSPSKPTF***********KDCNSWKGQGDWEEDWGETYAGKRQPSLFVININSGEVQAVKGIPKSLSVGQVVWAPLNEGLHQYLVFVGWSSETRKLGIKYCYNRPCALYAVRVSLYKSEASELELKESSSEDLPVVNLTESISSAFFPRFSPDGKFLVFLSAKSSVDSGAHSATDSLHRIDWPTNGNFSSLEKIVDVIPVVQCAEGDCFPGLYSSSILSNPWLSDGCTMLLSSIWGSSQVIISVNVSSGELLRITPAESNFSWSLLTLDGDNIIAVSSSPVDVPQVKYGYFVDKANKGTWSWLNVSSPISRCPEKVKSLLSSRQFSIMKIPVKGVSANLTKGAQKPFEAIFVSSSHKKDCSCDPLIVVLHGGPHSVSLSSYSKSLAFLSSVGYSLLIVNYRGSLGFGEEALQSLPGKVGSQDVNDVLTAIDHVIDMGLANPSKVTVVGGSHGGFLTTHLIGQAPDKFVAAAARNPLCNLALMVGTTDIPDWCYVESYGSKGKDSFTESPSVEDLTRFHSKSPISHISKVKTPTIFLLGAQDLRVPVSNGLQYARALREKGVETKVIVFPNDVHGIERPQSDFESFLNIGLWFKKYCK
MERALLSNVIATSDWCANQLLPRISPSFLSRHRHTRFTVAKPAYFSYKRLSVFLAMDA***********VLDATAEEEYASLSKLLQDFTNISSIDKAWTFNSGNGNGTQAMFSISQPNLLANKRKKFMLSTVISKENENSVTFQWAPFPVEMTGASAVVPSPSGSKLLVVRNPENESPIQFELWSQSQLEKEFHVPQTVHGSVYADGWFEGISWNSDETLIAYVAEEP***************************GDWEEDWGETYAGKRQPSLFVININSGEVQAVKGIPKSLSVGQVVWAPLNEGLHQYLVFVGWSSETRKLGIKYCYNRPCALYAVRVSLYKSE*************LPVVNLTESISSAFFPRFSPDGKFLVFLSAK***********DSLHRIDWPTNGNFSSLEKIVDVIPVVQCAEGDCFPGLYSSSILSNPWLSDGCTMLLSSIWGSSQVIISVNVSSGELLRITPAESNFSWSLLTLDGDNIIAVSSSPVDVPQVKYGYFVDKANKGTWSWLNVSSPISRCPEKVKSLLSSRQFSIMKIPVKGVSANLTKGAQKPFEAIFVSSSHKKDCSCDPLIVVLHGGPHSVSLSSYSKSLAFLSSVGYSLLIVNYRGSLGFGEEALQSLPGKVGSQDVNDVLTAIDHVIDMGLANPSKVTVVGGSHGGFLTTHLIGQAPDKFVAAAARNPLCNLALMVGTTDIPDWCYVESYGSK*************LTRFHSKSPISHISKVKTPTIFLLGAQDLRVPVSNGLQYARALREKGVETKVIVFPNDVHGIERPQSDFESFLNIGLWFKKYCK
**RALLSNVIATSDWCANQLLPRISPSFLSRHRHTRFTVAKPAYFSYKRLSVFLAMDAS*************ATAEEEYASLSKLLQDFTNISSIDKAWTFNSGNGNGTQAMFSISQPNLLANKRKKFMLSTVISKENENSVTFQWAPFPVEMTGASAVVPSPSGSKLLVVRNPENESPIQFELWSQSQLEKEFHVPQTVHGSVYADGWFEGISWNSDETLIAYVAEEPSPSK*T**************CNSWKGQGDWEEDWGETYAGKRQPSLFVININSGEVQAVKGIPKSLSVGQVVWAPLNEGLHQYLVFVGWSSETRKLGIKYCYNRPCALYAVRVSLYKSEASELELKESSSEDLPVVNLTESISSAFFPRFSPDGKFLVFLSAKSSVDSGAHSATDSLHRIDWPTNGNFSSLEKIVDVIPVVQCAEGDCFPGLYSSSILSNPWLSDGCTMLLSSIWGSSQVIISVNVSSGELLRITPAESNFSWSLLTLDGDNIIAVSSSPVDVPQVKYGYFVDKANKGTWSWLNVSSPISRCPEKVKSLLSSRQFSIMKIPVKGVSANLTKGAQKPFEAIFVSSSHKKDCSCDPLIVVLHGGPHSVSLSSYSKSLAFLSSVGYSLLIVNYRGSLGFGEEALQSLPGKVGSQDVNDVLTAIDHVIDMGLANPSKVTVVGGSHGGFLTTHLIGQAPDKFVAAAARNPLCNLALMVGTTDIPDWCYVESYGSKGKDSFTESPSVEDLTRFHSKSPISHISKVKTPTIFLLGAQDLRVPVSNGLQYARALREKGVETKVIVFPNDVHGIERPQSDFESFLNIGLWFKKYCK
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MERALLSNVIATSDWCANQLLPRISPSFLSRHRHTRFTVAKPAYFSYKRLSVFLAMDASKAAPAKQVSSVLDATAEEEYASLSKLLQDFTNISSIDKAWTFNSGNGNGTQAMFSISQPNLLANKRKKFMLSTVISKENENSVTFQWAPFPVEMTGASAVVPSPSGSKLLVVRNPENESPIQFELWSQSQLEKEFHVPQTVHGSVYADGWFEGISWNSDETLIAYVAEEPSPSKPTFSLGSTKGGSSDKDCNSWKGQGDWEEDWGETYAGKRQPSLFVININSGEVQAVKGIPKSLSVGQVVWAPLNEGLHQYLVFVGWSSETRKLGIKYCYNRPCALYAVRVSLYKSEASELELKESSSEDLPVVNLTESISSAFFPRFSPDGKFLVFLSAKSSVDSGAHSATDSLHRIDWPTNGNFSSLEKIVDVIPVVQCAEGDCFPGLYSSSILSNPWLSDGCTMLLSSIWGSSQVIISVNVSSGELLRITPAESNFSWSLLTLDGDNIIAVSSSPVDVPQVKYGYFVDKANKGTWSWLNVSSPISRCPEKVKSLLSSRQFSIMKIPVKGVSANLTKGAQKPFEAIFVSSSHKKDCSCDPLIVVLHGGPHSVSLSSYSKSLAFLSSVGYSLLIVNYRGSLGFGEEALQSLPGKVGSQDVNDVLTAIDHVIDMGLANPSKVTVVGGSHGGFLTTHLIGQAPDKFVAAAARNPLCNLALMVGTTDIPDWCYVESYGSKGKDSFTESPSVEDLTRFHSKSPISHISKVKTPTIFLLGAQDLRVPVSNGLQYARALREKGVETKVIVFPNDVHGIERPQSDFESFLNIGLWFKKYCK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query826 2.2.26 [Sep-21-2011]
Q8R146732 Acylamino-acid-releasing yes no 0.802 0.905 0.333 5e-99
P13676732 Acylamino-acid-releasing yes no 0.802 0.905 0.326 3e-97
P19205732 Acylamino-acid-releasing yes no 0.796 0.898 0.321 2e-94
P13798732 Acylamino-acid-releasing yes no 0.802 0.905 0.314 1e-93
P80227730 Acylamino-acid-releasing yes no 0.796 0.901 0.324 6e-92
P39839657 Uncharacterized peptidase yes no 0.269 0.339 0.320 7e-31
P34422740 Dipeptidyl peptidase fami no no 0.268 0.3 0.293 4e-23
Q95WU5761 Dipeptidyl-peptidase 4 OS N/A no 0.284 0.308 0.237 6e-14
Q9YBQ2582 Acylamino-acid-releasing no no 0.239 0.340 0.264 2e-13
Q5BA58722 Probable dipeptidyl-pepti yes no 0.271 0.310 0.236 9e-13
>sp|Q8R146|APEH_MOUSE Acylamino-acid-releasing enzyme OS=Mus musculus GN=Apeh PE=2 SV=3 Back     alignment and function desciption
 Score =  362 bits (930), Expect = 5e-99,   Method: Compositional matrix adjust.
 Identities = 242/725 (33%), Positives = 369/725 (50%), Gaps = 62/725 (8%)

Query: 116 SQPNLLANKRKKFMLSTVISKENENSVTFQWAPFPVEMTGASAVVPSPSGSKLLVVRNP- 174
           +Q +L   +  +F    ++  + ++ V    A   VE  G      SPSG+   V+R   
Sbjct: 51  TQRDLDRMENIRFCRQYLVFHDGDSVVFAGPAGNSVETRGELLSRESPSGTMKAVLRKAG 110

Query: 175 ---ENESPIQFELWSQSQLEKEFHVPQ-TVHGSVYADGWFEGISWNSDETLIAYVAEEPS 230
                E     E+W +++  K F++     HG VY D  F  +SW+  ET + YVAE+  
Sbjct: 111 GAVSGEEKQFLEVWEKNRKLKSFNLSALEKHGPVYEDDCFGCLSWSHSETHLLYVAEKKR 170

Query: 231 PSKPTF--------SLGSTKGGSSDKDCNSWKG-QGDWEEDWGETYAGKRQPSLFVININ 281
           P   +F        S    +     K   + KG Q  + EDWGET   K  P L V++I 
Sbjct: 171 PKAESFFQTKALDVSASDEEMARPKKPDQAIKGDQFVFYEDWGETMVSKSIPVLCVLDIE 230

Query: 282 SGEVQAVKGIPKSLSVGQVVWAPLNEGLHQYLVFVGWSSETRKLGIKYCYNRPCALYAVR 341
           SG +  ++G+P+++S GQ  WAP + G+    VFVGW  E  +LGI+YC NR  ALY V 
Sbjct: 231 SGNISVLEGVPENVSPGQAFWAPGDTGV----VFVGWWHEPFRLGIRYCTNRRSALYYVD 286

Query: 342 VSLYKSEASELELKESSSEDLPVVNLTESISSAFFPRFSPDGKFLVFLSAKSSVDSGAHS 401
           +S  K E         S E L V +          PR SPD   +V+L   S      H 
Sbjct: 287 LSGGKCELL-------SDESLAVCS----------PRLSPDQCRVVYLQYPSL---APHH 326

Query: 402 ATDSLHRIDWPTNGNFSSLEKIVDVIPVVQCAEGDCFPGLYSSSILSNPWLSDGCTMLLS 461
               L   DW T    +SL  +VD++P      G+ F G+Y S +    W +D   ++  
Sbjct: 327 QCSQLFLYDWYTK--VTSL--VVDIVPR---QLGESFSGIYCSLLPLGCWSADSQRVVFD 379

Query: 462 SIWGSSQVIISVNVSSGELLRITPAESNFSWSLLTLDGDNIIAVSSSPVDVPQVKYGYFV 521
           S+  S Q + +V+  +G +  +T   S  SW LLT+D D ++A  S+P   P +K G+  
Sbjct: 380 SVQRSRQDLFAVDTQTGSVTSLTAGGSAGSWKLLTIDRDLMVAQFSTPNLPPSLKVGFLP 439

Query: 522 DKANKGTWSWLNV--SSPISRCPEKVKSLLSSRQFSIMKIPVKGVSANLTKGAQKPFEAI 579
               + + SW+++  + PI      ++         ++  P    +      A   FEAI
Sbjct: 440 PAGKEQSVSWVSLEEAEPIPDIHWGIR---------VLHPPPDQENVQY---ADLDFEAI 487

Query: 580 FVSSSHKKDCSCDPLIVVLHGGPHSVSLSSYSKSLAFLSSVGYSLLIVNYRGSLGFGEEA 639
            +  S+  D S  P++V+ HGGPHS  ++++    A L  +G+++L+VNYRGS GFG+++
Sbjct: 488 LLQPSNSPDKSQVPMVVMPHGGPHSSFVTAWMLFPAMLCKMGFAVLLVNYRGSTGFGQDS 547

Query: 640 LQSLPGKVGSQDVNDVLTAIDHVIDMGLANPSKVTVVGGSHGGFLTTHLIGQAPDKFVAA 699
           + SLPG VG QDV DV  A+  V+     +  +V ++GGSHGGFL+ HLIGQ P+ + A 
Sbjct: 548 ILSLPGNVGHQDVKDVQFAVQQVLQEEHFDARRVALMGGSHGGFLSCHLIGQYPETYSAC 607

Query: 700 AARNPLCNLALMVGTTDIPDWCYVESYGSKGKDSFTESPSVEDLTRFHSKSPISHISKVK 759
            ARNP+ N+  M+GTTDIPDWC VE+      D     P +  L     KSPI +I +VK
Sbjct: 608 IARNPVINIVSMMGTTDIPDWCMVETGFPYSNDYL---PDLNVLEEMLDKSPIKYIPQVK 664

Query: 760 TPTIFLLGAQDLRVPVSNGLQYARALREKGVETKVIVFPNDVHGIERPQSDFESFLNIGL 819
           TP + +LG +D RVP   GL+Y  AL+ + V  +++++P   H +   + + +SF+N  L
Sbjct: 665 TPVLLMLGQEDRRVPFKQGLEYYHALKARNVPVRLLLYPKSTHALSEVEVESDSFMNTVL 724

Query: 820 WFKKY 824
           W   +
Sbjct: 725 WLHTH 729
This enzyme catalyzes the hydrolysis of the N-terminal peptide bond of an N-acetylated peptide to generate an N-acetylated amino acid and a peptide with a free N-terminus. It preferentially cleaves off Ac-Ala, Ac-Met and Ac-Ser.
Mus musculus (taxid: 10090)
EC: 3EC: .EC: 4EC: .EC: 1EC: 9EC: .EC: 1
>sp|P13676|ACPH_RAT Acylamino-acid-releasing enzyme OS=Rattus norvegicus GN=Apeh PE=1 SV=1 Back     alignment and function description
>sp|P19205|ACPH_PIG Acylamino-acid-releasing enzyme OS=Sus scrofa GN=APEH PE=1 SV=2 Back     alignment and function description
>sp|P13798|ACPH_HUMAN Acylamino-acid-releasing enzyme OS=Homo sapiens GN=APEH PE=1 SV=4 Back     alignment and function description
>sp|P80227|ACPH_BOVIN Acylamino-acid-releasing enzyme OS=Bos taurus GN=APEH PE=1 SV=2 Back     alignment and function description
>sp|P39839|YUXL_BACSU Uncharacterized peptidase YuxL OS=Bacillus subtilis (strain 168) GN=yuxL PE=3 SV=3 Back     alignment and function description
>sp|P34422|DPF6_CAEEL Dipeptidyl peptidase family member 6 OS=Caenorhabditis elegans GN=dpf-6 PE=3 SV=2 Back     alignment and function description
>sp|Q95WU5|DPP_GIAIN Dipeptidyl-peptidase 4 OS=Giardia intestinalis GN=DPP PE=1 SV=1 Back     alignment and function description
>sp|Q9YBQ2|APEH_AERPE Acylamino-acid-releasing enzyme OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=APE_1547.1 PE=1 SV=1 Back     alignment and function description
>sp|Q5BA58|DPP5_EMENI Probable dipeptidyl-peptidase 5 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dpp5 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query826
359477374822 PREDICTED: acylamino-acid-releasing enzy 0.980 0.985 0.734 0.0
356536605766 PREDICTED: acylamino-acid-releasing enzy 0.910 0.981 0.734 0.0
255551973771 acylamino-acid-releasing enzyme, putativ 0.929 0.996 0.739 0.0
356534785758 PREDICTED: acylamino-acid-releasing enzy 0.914 0.996 0.696 0.0
357487227832 Acylamino-acid-releasing enzyme [Medicag 0.911 0.905 0.727 0.0
357487225768 Acylamino-acid-releasing enzyme [Medicag 0.911 0.980 0.727 0.0
357487229810 Acylamino-acid-releasing enzyme [Medicag 0.910 0.928 0.643 0.0
297804842763 hypothetical protein ARALYDRAFT_915409 [ 0.917 0.993 0.660 0.0
42566792764 acylaminoacyl-peptidase [Arabidopsis tha 0.918 0.993 0.655 0.0
115482018775 Os10g0415600 [Oryza sativa Japonica Grou 0.918 0.979 0.623 0.0
>gi|359477374|ref|XP_002284013.2| PREDICTED: acylamino-acid-releasing enzyme-like isoform 1 [Vitis vinifera] gi|297737147|emb|CBI26348.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score = 1206 bits (3119), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 601/818 (73%), Positives = 686/818 (83%), Gaps = 8/818 (0%)

Query: 12  TSDWCANQLLPRISPSFLSRHRHTRFTVAKPAYFSYKRLSVFLAMDASKAAPAKQVSSVL 71
           TS+W  + LL R  PSF +R    R T  +P   S + LS  L M +  ++  K+V   +
Sbjct: 10  TSEWRVSSLLARFPPSFSAR----RSTPLRPFSVSARSLSTSLVMASCGSSSMKEVPLGI 65

Query: 72  DATAEEEYASLSKLLQDFTNISSIDKAWTF-NSGNGNGTQAMFSISQPNLLANKRKKFML 130
           D   EE YAS SKLL++FT+I+SIDKAWTF     G G+QAMFSISQ NLLANKR+K +L
Sbjct: 66  DPAMEETYASQSKLLKEFTSIASIDKAWTFKRDSGGKGSQAMFSISQTNLLANKRRKQIL 125

Query: 131 STVISKENENSVTFQWAPFPVEMTGASAVVPSPSGSKLLVVRNPENESPIQFELWSQSQL 190
           S  ISKE+++SV FQWAPFP+EM G S +VPSPSGSKLLVVRNPENESP QFE+W  SQL
Sbjct: 126 SAHISKESDHSVNFQWAPFPIEMMGVSTMVPSPSGSKLLVVRNPENESPTQFEIWGPSQL 185

Query: 191 EKEFHVPQTVHGSVYADGWFEGISWNSDETLIAYVAEEPSPSKPTFS-LGSTKGGSSDKD 249
           EKEF+VPQ+VHGSVY DGWFEGISWNSDETLIAYVAEEPSPSKPTF   G  KG S+DK+
Sbjct: 186 EKEFNVPQSVHGSVYTDGWFEGISWNSDETLIAYVAEEPSPSKPTFGGSGYKKGDSADKE 245

Query: 250 CNSWKGQGDWEEDWGETYAGKRQPSLFVININSGEVQAVKGIPKSLSVGQVVWAPLNEGL 309
             SWKG G+WEE WGETYAGKRQP+LFVINI SGEV AV+GI KSLS+GQV+WAPL EG 
Sbjct: 246 SGSWKGLGEWEEHWGETYAGKRQPALFVINIESGEVHAVEGISKSLSIGQVIWAPLAEGF 305

Query: 310 HQYLVFVGWSSETRKLGIKYCYNRPCALYAVRVSLYKSEASELELKESSSEDLPVVNLTE 369
            QYLVFVGWSSETRKLGIKYCYNRPCALYAVR    +S+A+EL+ K + +ED  VVNLT+
Sbjct: 306 SQYLVFVGWSSETRKLGIKYCYNRPCALYAVRAPFCESKANELQSKSNVNEDSTVVNLTQ 365

Query: 370 SISSAFFPRFSPDGKFLVFLSAKSSVDSGAHSATDSLHRIDWPTNGNFSSLEKIVDVIPV 429
           SISSAFFPRFSPDGKFLVFLSAKSSVDSGAHSATDSLHRI WPT+G       IVDVIPV
Sbjct: 366 SISSAFFPRFSPDGKFLVFLSAKSSVDSGAHSATDSLHRIAWPTDGKPCPSANIVDVIPV 425

Query: 430 VQCAEGDCFPGLYSSSILSNPWLSDGCTMLLSSIWGSSQVIISVNVSSGELLRITPAESN 489
           + CAE   FPGLY SSILSNPWLSDGCTM+LSS W S+QVI+SV+V SG +  ++P +S 
Sbjct: 426 MMCAEDGYFPGLYCSSILSNPWLSDGCTMILSSAWHSTQVILSVDVLSGNVSHVSPNDSG 485

Query: 490 FSWSLLTLDGDNIIAVSSSPVDVPQVKYGYFVDKANKG-TWSWLNVSSPISRCPEKVKSL 548
           FSW++LTLDGDNI+AV SSP+D+P++KYG+  +K     +WSWL+VS+PI RC EK++SL
Sbjct: 486 FSWNVLTLDGDNIVAVCSSPIDIPEMKYGWLAEKTTASDSWSWLDVSNPIPRCSEKIRSL 545

Query: 549 LSSRQFSIMKIPVKGVSANLTKGAQKPFEAIFVSSSHKKDCSCDPLIVVLHGGPHSVSLS 608
           LSS QFSIMKIPVK VS  LTKG+ KPFEAIFVSS+ K D +CDPLIVVLHGGPHSVS S
Sbjct: 546 LSSLQFSIMKIPVKDVSDCLTKGSCKPFEAIFVSSNKKND-TCDPLIVVLHGGPHSVSSS 604

Query: 609 SYSKSLAFLSSVGYSLLIVNYRGSLGFGEEALQSLPGKVGSQDVNDVLTAIDHVIDMGLA 668
           S+SK+LAFLSS+GYSLLIVNYRGSLGFGEEALQSLPGK+GSQDVNDVLTAIDHVIDMGL 
Sbjct: 605 SFSKNLAFLSSLGYSLLIVNYRGSLGFGEEALQSLPGKIGSQDVNDVLTAIDHVIDMGLC 664

Query: 669 NPSKVTVVGGSHGGFLTTHLIGQAPDKFVAAAARNPLCNLALMVGTTDIPDWCYVESYGS 728
           +PSK+ VVGGSHGGFLT+HLIGQAPDKF  AA RNP+CNLALMVGTTDIPDWC+VE+YGS
Sbjct: 665 DPSKIAVVGGSHGGFLTSHLIGQAPDKFAVAAVRNPVCNLALMVGTTDIPDWCFVEAYGS 724

Query: 729 KGKDSFTESPSVEDLTRFHSKSPISHISKVKTPTIFLLGAQDLRVPVSNGLQYARALREK 788
           +GK+SFTE+PS E LT  HSKSP+SHI KVKTPT+FLLGAQDLRVPVSNGL YAR L+EK
Sbjct: 725 QGKNSFTEAPSAEQLTLLHSKSPVSHIHKVKTPTLFLLGAQDLRVPVSNGLHYARELKEK 784

Query: 789 GVETKVIVFPNDVHGIERPQSDFESFLNIGLWFKKYCK 826
           GVE KVI+FPNDVH IERPQSDFESFLNIG+WFKKYC+
Sbjct: 785 GVEVKVIIFPNDVHAIERPQSDFESFLNIGVWFKKYCE 822

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356536605|ref|XP_003536827.1| PREDICTED: acylamino-acid-releasing enzyme-like [Glycine max] Back     alignment and taxonomy information
>gi|255551973|ref|XP_002517031.1| acylamino-acid-releasing enzyme, putative [Ricinus communis] gi|223543666|gb|EEF45194.1| acylamino-acid-releasing enzyme, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356534785|ref|XP_003535932.1| PREDICTED: acylamino-acid-releasing enzyme-like [Glycine max] Back     alignment and taxonomy information
>gi|357487227|ref|XP_003613901.1| Acylamino-acid-releasing enzyme [Medicago truncatula] gi|355515236|gb|AES96859.1| Acylamino-acid-releasing enzyme [Medicago truncatula] Back     alignment and taxonomy information
>gi|357487225|ref|XP_003613900.1| Acylamino-acid-releasing enzyme [Medicago truncatula] gi|355515235|gb|AES96858.1| Acylamino-acid-releasing enzyme [Medicago truncatula] Back     alignment and taxonomy information
>gi|357487229|ref|XP_003613902.1| Acylamino-acid-releasing enzyme [Medicago truncatula] gi|355515237|gb|AES96860.1| Acylamino-acid-releasing enzyme [Medicago truncatula] Back     alignment and taxonomy information
>gi|297804842|ref|XP_002870305.1| hypothetical protein ARALYDRAFT_915409 [Arabidopsis lyrata subsp. lyrata] gi|297316141|gb|EFH46564.1| hypothetical protein ARALYDRAFT_915409 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|42566792|ref|NP_193193.2| acylaminoacyl-peptidase [Arabidopsis thaliana] gi|60729672|pir||JC8016 acylaminoacyl-peptidase (EC 3.4.19.1) - Arabidopsis thaliana gi|30466066|dbj|BAC76411.1| acylamino acid-releasing enzyme [Arabidopsis thaliana] gi|332658061|gb|AEE83461.1| acylaminoacyl-peptidase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|115482018|ref|NP_001064602.1| Os10g0415600 [Oryza sativa Japonica Group] gi|113639211|dbj|BAF26516.1| Os10g0415600 [Oryza sativa Japonica Group] gi|218184517|gb|EEC66944.1| hypothetical protein OsI_33573 [Oryza sativa Indica Group] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query826
TAIR|locus:2129920764 AARE "acylamino acid-releasing 0.918 0.993 0.632 2.9e-270
UNIPROTKB|E2R7E8734 APEH "Uncharacterized protein" 0.462 0.520 0.339 6.3e-89
MGI|MGI:88041732 Apeh "acylpeptide hydrolase" [ 0.462 0.521 0.341 8e-89
UNIPROTKB|P80227730 APEH "Acylamino-acid-releasing 0.509 0.576 0.331 1.3e-88
RGD|2125732 Apeh "N-acylaminoacyl-peptide 0.462 0.521 0.339 3.5e-88
UNIPROTKB|P13676732 Apeh "Acylamino-acid-releasing 0.462 0.521 0.339 3.5e-88
UNIPROTKB|I3LEU6725 I3LEU6 "Uncharacterized protei 0.509 0.580 0.323 1.7e-86
UNIPROTKB|P13798732 APEH "Acylamino-acid-releasing 0.467 0.527 0.330 4.4e-86
UNIPROTKB|F1SPS7732 APEH "Acylamino-acid-releasing 0.462 0.521 0.326 4.4e-86
UNIPROTKB|I3LFX8702 I3LFX8 "Uncharacterized protei 0.462 0.544 0.326 5.7e-86
TAIR|locus:2129920 AARE "acylamino acid-releasing enzyme" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2599 (920.0 bits), Expect = 2.9e-270, P = 2.9e-270
 Identities = 490/775 (63%), Positives = 594/775 (76%)

Query:    56 MDASKAAPAKQVSSVLDATAEEEYASLSKLLQDFTNISSIDKAWTFNSGNGNGTQAMFSI 115
             MD+S    AK++   LD T EEEYA+ SKLLQ+F NI SIDKAW FNS +G+  QAMF++
Sbjct:     1 MDSSGTDSAKELHVGLDPTTEEEYATQSKLLQEFINIPSIDKAWIFNSDSGS--QAMFAL 58

Query:   116 SQPNLLANKRKKFMLSTVISKENENSVTFQWAPFPVEMTGASAVVPSPSGSKLLVVRNPE 175
             SQ NLLANK+KKFMLS  IS E+  SV F WAPFP+EMTGASA VPSPSG KLLV+RNPE
Sbjct:    59 SQANLLANKKKKFMLSGHISNESNQSVNFHWAPFPIEMTGASAFVPSPSGLKLLVIRNPE 118

Query:   176 NESPIQFELWSQSQLEKEFHVPQTVHGSVYADGWFEGISWNSDETLIAYVAEEPSPSKPT 235
             NESP +FE+W+ SQLEKEFH+PQ VHGSVY DGWFEGISW+SDET +AYVAEEPS  KPT
Sbjct:   119 NESPTKFEIWNSSQLEKEFHIPQKVHGSVYVDGWFEGISWDSDETHVAYVAEEPSRPKPT 178

Query:   236 FS-LGSTKGGSS-DKDCNSWKGQGDWEEDWGETYAGKRQPSLFVININSGEVQAVKGIPK 293
             F  LG  K  +S DK   SWKG+GDWEE+WGE YAGKRQP+LFVIN++SGEV+ +KGIP+
Sbjct:   179 FDHLGYYKKENSLDKGIGSWKGEGDWEEEWGEAYAGKRQPALFVINVDSGEVEPIKGIPR 238

Query:   294 SLSVGQVVWAPLNEGLHQYLVFVGWSSETRKLGIKYCYNRPCALYAVRVSLYXXXXXXXX 353
             S+SVGQVVW+P + G  QYLVF GW  + RK GIKYCYNRPCA+YA++ +          
Sbjct:   239 SISVGQVVWSPNSNGSAQYLVFAGWLGDKRKFGIKYCYNRPCAIYAIKFT-------SDE 291

Query:   354 XXXXXXXDLPVVNLTESISSAFFPRFSPDGKFLVFLSAKSSVDSGAHSATDSLHRIDWPT 413
                    + P+ NLT+SISS F PRFS DGKFLVF+SAK++VDSGAH AT+SLHRIDWP+
Sbjct:   292 PKDDDANEFPIHNLTKSISSGFCPRFSKDGKFLVFVSAKTAVDSGAHWATESLHRIDWPS 351

Query:   414 NGNFSSLEKIVDVIPVVQCAEGDCFPGLYSSSILSNPWLSDGCTMLLSSIWGXXXXXXXX 473
             +G       IVDVI VV C +  CFPGLY + +LS+PWLSDG +++LS+ W         
Sbjct:   352 DGKLPESTNIVDVIQVVNCPKDGCFPGLYVTGLLSDPWLSDGHSLMLSTYWRSCRVILSV 411

Query:   474 XXXXGELLRITPAESNFSWSLLTLDGDNIIAVSSSPVDVPQVKYGYF-VDKANKGTWSWL 532
                 GE+ R +P++S++SW+ L LDGD+I+AVSSSPV VP++KYG   +D A K +W W 
Sbjct:   412 NLLSGEVSRASPSDSDYSWNALALDGDSIVAVSSSPVSVPEIKYGKKGLDSAGKPSWLWS 471

Query:   533 NVSSPISRCPEKVKSLLSSRQFSIMKIPVKGVSANLTKGAQKPFEAIFVSSSHKKDCS-C 591
             N+ SPI R  EKV + LSS QF I+K+P+  VS  L +GA+ P EAI+VSSS  K+   C
Sbjct:   472 NIQSPI-RYSEKVMAGLSSLQFKILKVPISDVSEGLAEGAKNPIEAIYVSSSKSKENGKC 530

Query:   592 DPLIVVLHGGPHXXXXXXXXXXXXXXXXVGYSLLIVNYRGSLGFGEEALQSLPGKVGSQD 651
             DPLI VLHGGPH                +GYS LI+NYRGSLG+GE+ALQSLPGKVGSQD
Sbjct:   531 DPLIAVLHGGPHSVSPCSFSRTMAYLSSIGYSQLIINYRGSLGYGEDALQSLPGKVGSQD 590

Query:   652 VNDVLTAIDHVIDMGLANPSKVTVVGGSHGGFLTTHLIGQAPDKFVAAAARNPLCNLALM 711
             V D L A+DH I+MG+A+PS++TV+GGSHGGFLTTHLIGQAPDKFVAAAARNP+CN+A M
Sbjct:   591 VKDCLLAVDHAIEMGIADPSRITVLGGSHGGFLTTHLIGQAPDKFVAAAARNPVCNMASM 650

Query:   712 VGTTDIPDWCYVESYGSKGKDSFTESPSVEDLTRFHSKSPISHISKVKTPTIFLLGAQDL 771
             VG TDIPDWC+ E+YG +    +TE+PS EDL+RFH  SPISHISKVKTPT+FLLG +DL
Sbjct:   651 VGITDIPDWCFFEAYGDQSH--YTEAPSAEDLSRFHQMSPISHISKVKTPTLFLLGTKDL 708

Query:   772 RVPVSNGLQYARALREKGVETKVIVFPNDVHGIERPQSDFESFLNIGLWFKKYCK 826
             RVP+SNG QY RAL+EKGVE KV+VFPND H ++RPQ+D+ESFLNI +WF KYCK
Sbjct:   709 RVPISNGFQYVRALKEKGVEVKVLVFPNDNHPLDRPQTDYESFLNIAVWFNKYCK 763
GO:0005737 "cytoplasm" evidence=ISM;IDA
GO:0006508 "proteolysis" evidence=IEA;IDA
GO:0008236 "serine-type peptidase activity" evidence=IEA
GO:0070009 "serine-type aminopeptidase activity" evidence=IDA
GO:0005773 "vacuole" evidence=IDA
GO:0009507 "chloroplast" evidence=IDA
GO:0005829 "cytosol" evidence=RCA
GO:0005634 "nucleus" evidence=IDA
GO:0046686 "response to cadmium ion" evidence=RCA
UNIPROTKB|E2R7E8 APEH "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:88041 Apeh "acylpeptide hydrolase" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|P80227 APEH "Acylamino-acid-releasing enzyme" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|2125 Apeh "N-acylaminoacyl-peptide hydrolase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P13676 Apeh "Acylamino-acid-releasing enzyme" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|I3LEU6 I3LEU6 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|P13798 APEH "Acylamino-acid-releasing enzyme" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1SPS7 APEH "Acylamino-acid-releasing enzyme" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|I3LFX8 I3LFX8 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8R146APEH_MOUSE3, ., 4, ., 1, 9, ., 10.33370.80260.9057yesno
P13798ACPH_HUMAN3, ., 4, ., 1, 9, ., 10.31440.80260.9057yesno
P13676ACPH_RAT3, ., 4, ., 1, 9, ., 10.32680.80260.9057yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00020112001
SubName- Full=Chromosome chr5 scaffold_2, whole genome shotgun sequence; (771 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query826
COG1506620 COG1506, DAP2, Dipeptidyl aminopeptidases/acylamin 1e-44
pfam00326212 pfam00326, Peptidase_S9, Prolyl oligopeptidase fam 8e-33
pfam12697187 pfam12697, Abhydrolase_6, Alpha/beta hydrolase fam 6e-11
COG1505648 COG1505, COG1505, Serine proteases of the peptidas 7e-09
pfam12695145 pfam12695, Abhydrolase_5, Alpha/beta hydrolase fam 7e-09
COG0657312 COG0657, Aes, Esterase/lipase [Lipid metabolism] 1e-08
COG0412236 COG0412, COG0412, Dienelactone hydrolase and relat 7e-08
pfam07859207 pfam07859, Abhydrolase_3, alpha/beta hydrolase fol 2e-04
COG0596282 COG0596, MhpC, Predicted hydrolases or acyltransfe 2e-04
COG1770682 COG1770, PtrB, Protease II [Amino acid transport a 3e-04
PRK10115686 PRK10115, PRK10115, protease 2; Provisional 4e-04
pfam01738215 pfam01738, DLH, Dienelactone hydrolase family 0.001
>gnl|CDD|224423 COG1506, DAP2, Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism] Back     alignment and domain information 
 Score =  170 bits (432), Expect = 1e-44
 Identities = 114/467 (24%), Positives = 186/467 (39%), Gaps = 52/467 (11%)

Query: 360 EDLPVVNLTESISSAFFPRFSPDGKFLVFLSAKSSVDSGAHSATDSLHRIDWPTNGNFSS 419
            +  + +LT    S     F  DGK +  L  +S            L       +G+ SS
Sbjct: 204 GNGELESLTPGEGSISKLAFDADGKSIALLGTESDRGLAEGDFILLLDGELGEVDGDLSS 263

Query: 420 LEKIVDVIPVVQCAEGDCFPGLYSSSILSNPWLSDGCTMLLSSIWGSSQVIISVNVSSGE 479
            +       V    +GD   GL   +                   GSS +     V    
Sbjct: 264 GDDTRGAWAVEGGLDGD---GLLFIAT---------------DGGGSSPLF---RVDDLG 302

Query: 480 LLRITPAESNFSWSLLTLDGDNIIAVSSSPVDVPQVKYGYFVDKANKGTWSWLNVSSPIS 539
                 +  +       +DG  +    SSP   P   Y Y   +  K       ++S  +
Sbjct: 303 GGVEGLSGDDGGVPGFDVDGRKLALAYSSP-TEPPEIYLYDRGEEAK-------LTSSNN 354

Query: 540 RCPEKVKSLLSSRQFSIMKIPVKGVSANLTKGAQKPFEAIFVSSSHKKDCSCDPLIVVLH 599
              +KVK L      +      + +   L K               KK     PLIV +H
Sbjct: 355 SGLKKVK-LAEPEPVTYKSNDGETIHGWLYKPPGFDPR--------KKY----PLIVYIH 401

Query: 600 GGPHSVSLSSYSKSLAFLSSVGYSLLIVNYRGSLGFGEEALQSLPGKVGSQDVNDVLTAI 659
           GGP +    S++  +  L+S GY++L  NYRGS G+G E   ++ G  G  D+ D++ A+
Sbjct: 402 GGPSAQVGYSFNPEIQVLASAGYAVLAPNYRGSTGYGREFADAIRGDWGGVDLEDLIAAV 461

Query: 660 DHVIDMGLANPSKVTVVGGSHGGFLTTHLIGQAPDKFVAAAARNPLCNLALMVGTTDIPD 719
           D ++ + L +P ++ + GGS+GG++T     + P  F AA A     +  L  G +    
Sbjct: 462 DALVKLPLVDPERIGITGGSYGGYMTLLAATKTPR-FKAAVAVAGGVDWLLYFGESTEGL 520

Query: 720 WCYVESYGSKGKDSFTESPSVEDLTRFHSKSPISHISKVKTPTIFLLGAQDLRVPVSNGL 779
               E  G    +         D  ++  +SPI +   +KTP + + G +D RVP+    
Sbjct: 521 RFDPEENGGGPPE---------DREKYEDRSPIFYADNIKTPLLLIHGEEDDRVPIEQAE 571

Query: 780 QYARALREKGVETKVIVFPNDVHGIERPQSDFESFLNIGLWFKKYCK 826
           Q   AL+ KG   +++VFP++ HG  RP++  +    I  WFK++ K
Sbjct: 572 QLVDALKRKGKPVELVVFPDEGHGFSRPENRVKVLKEILDWFKRHLK 618

Length = 620
>gnl|CDD|215859 pfam00326, Peptidase_S9, Prolyl oligopeptidase family Back     alignment and domain information
>gnl|CDD|221720 pfam12697, Abhydrolase_6, Alpha/beta hydrolase family Back     alignment and domain information
>gnl|CDD|224422 COG1505, COG1505, Serine proteases of the peptidase family S9A [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|221718 pfam12695, Abhydrolase_5, Alpha/beta hydrolase family Back     alignment and domain information
>gnl|CDD|223730 COG0657, Aes, Esterase/lipase [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|223489 COG0412, COG0412, Dienelactone hydrolase and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|219611 pfam07859, Abhydrolase_3, alpha/beta hydrolase fold Back     alignment and domain information
>gnl|CDD|223669 COG0596, MhpC, Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>gnl|CDD|224684 COG1770, PtrB, Protease II [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|182247 PRK10115, PRK10115, protease 2; Provisional Back     alignment and domain information
>gnl|CDD|216672 pfam01738, DLH, Dienelactone hydrolase family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 826
COG1506620 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-pept 100.0
PRK10115686 protease 2; Provisional 100.0
KOG2100755 consensus Dipeptidyl aminopeptidase [Posttranslati 100.0
KOG2281867 consensus Dipeptidyl aminopeptidases/acylaminoacyl 100.0
PF00326213 Peptidase_S9: Prolyl oligopeptidase family This fa 99.97
PRK01029428 tolB translocation protein TolB; Provisional 99.96
COG1770682 PtrB Protease II [Amino acid transport and metabol 99.96
COG1505648 Serine proteases of the peptidase family S9A [Amin 99.95
PRK03629429 tolB translocation protein TolB; Provisional 99.95
PRK05137435 tolB translocation protein TolB; Provisional 99.94
PRK04792448 tolB translocation protein TolB; Provisional 99.93
KOG2237712 consensus Predicted serine protease [Posttranslati 99.93
PRK04922433 tolB translocation protein TolB; Provisional 99.93
PRK02889427 tolB translocation protein TolB; Provisional 99.93
PRK04043419 tolB translocation protein TolB; Provisional 99.93
PRK00178430 tolB translocation protein TolB; Provisional 99.92
PRK05137435 tolB translocation protein TolB; Provisional 99.9
PRK01742429 tolB translocation protein TolB; Provisional 99.9
PRK01029428 tolB translocation protein TolB; Provisional 99.9
PRK04043419 tolB translocation protein TolB; Provisional 99.9
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 99.89
PRK03629429 tolB translocation protein TolB; Provisional 99.89
PRK02889427 tolB translocation protein TolB; Provisional 99.88
PRK04792448 tolB translocation protein TolB; Provisional 99.88
PRK10566249 esterase; Provisional 99.87
PRK04922433 tolB translocation protein TolB; Provisional 99.87
PRK13604307 luxD acyl transferase; Provisional 99.87
PRK00178430 tolB translocation protein TolB; Provisional 99.87
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 99.86
PLN02298330 hydrolase, alpha/beta fold family protein 99.85
COG0823425 TolB Periplasmic component of the Tol biopolymer t 99.85
KOG1455313 consensus Lysophospholipase [Lipid transport and m 99.85
PHA02857276 monoglyceride lipase; Provisional 99.85
PLN02385349 hydrolase; alpha/beta fold family protein 99.85
PLN02442283 S-formylglutathione hydrolase 99.84
PRK01742429 tolB translocation protein TolB; Provisional 99.83
PRK05077414 frsA fermentation/respiration switch protein; Revi 99.82
PRK10749330 lysophospholipase L2; Provisional 99.82
PF01738218 DLH: Dienelactone hydrolase family; InterPro: IPR0 99.82
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 99.81
TIGR02821275 fghA_ester_D S-formylglutathione hydrolase. This m 99.8
COG1647243 Esterase/lipase [General function prediction only] 99.8
PLN02652395 hydrolase; alpha/beta fold family protein 99.8
PRK10162318 acetyl esterase; Provisional 99.79
COG0823425 TolB Periplasmic component of the Tol biopolymer t 99.78
COG0412236 Dienelactone hydrolase and related enzymes [Second 99.77
PF05448320 AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR0 99.76
COG2267298 PldB Lysophospholipase [Lipid metabolism] 99.75
PRK11460232 putative hydrolase; Provisional 99.74
KOG1552258 consensus Predicted alpha/beta hydrolase [General 99.74
PRK05371 767 x-prolyl-dipeptidyl aminopeptidase; Provisional 99.73
TIGR01840212 esterase_phb esterase, PHB depolymerase family. Th 99.72
PRK00870302 haloalkane dehalogenase; Provisional 99.72
PRK10985324 putative hydrolase; Provisional 99.71
KOG4391300 consensus Predicted alpha/beta hydrolase BEM46 [Ge 99.7
TIGR03343282 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-die 99.7
PLN02511388 hydrolase 99.7
COG3458321 Acetyl esterase (deacetylase) [Secondary metabolit 99.69
COG0657312 Aes Esterase/lipase [Lipid metabolism] 99.69
PLN02824294 hydrolase, alpha/beta fold family protein 99.69
TIGR01607332 PST-A Plasmodium subtelomeric family (PST-A). Thes 99.68
TIGR03611257 RutD pyrimidine utilization protein D. This protei 99.68
KOG4178322 consensus Soluble epoxide hydrolase [Lipid transpo 99.68
TIGR02240276 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymer 99.67
PLN02965255 Probable pheophorbidase 99.67
KOG1515336 consensus Arylacetamide deacetylase [Defense mecha 99.66
TIGR02427251 protocat_pcaD 3-oxoadipate enol-lactonase. Members 99.66
PRK10673255 acyl-CoA esterase; Provisional 99.66
PF12695145 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3 99.66
PRK03592295 haloalkane dehalogenase; Provisional 99.66
TIGR00976 550 /NonD putative hydrolase, CocE/NonD family. This m 99.66
TIGR03056278 bchO_mg_che_rel putative magnesium chelatase acces 99.64
PF07859211 Abhydrolase_3: alpha/beta hydrolase fold A web pag 99.64
PLN02679360 hydrolase, alpha/beta fold family protein 99.64
PLN03087481 BODYGUARD 1 domain containing hydrolase; Provision 99.64
PF02129272 Peptidase_S15: X-Pro dipeptidyl-peptidase (S15 fam 99.63
TIGR01250288 pro_imino_pep_2 proline-specific peptidases, Bacil 99.61
TIGR03100274 hydr1_PEP hydrolase, ortholog 1, exosortase system 99.61
PF02230216 Abhydrolase_2: Phospholipase/Carboxylesterase; Int 99.6
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 99.6
PRK11071190 esterase YqiA; Provisional 99.6
TIGR03695251 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene 99.6
COG0429345 Predicted hydrolase of the alpha/beta-hydrolase fo 99.6
TIGR01738245 bioH putative pimeloyl-BioC--CoA transferase BioH. 99.6
PLN02894402 hydrolase, alpha/beta fold family protein 99.59
PRK03204286 haloalkane dehalogenase; Provisional 99.58
PRK10349256 carboxylesterase BioH; Provisional 99.58
COG4946668 Uncharacterized protein related to the periplasmic 99.58
PF06500411 DUF1100: Alpha/beta hydrolase of unknown function 99.57
PLN02872395 triacylglycerol lipase 99.57
KOG0271480 consensus Notchless-like WD40 repeat-containing pr 99.57
TIGR01836350 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synth 99.56
PF12697228 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3 99.56
PRK07581339 hypothetical protein; Validated 99.56
PRK14875371 acetoin dehydrogenase E2 subunit dihydrolipoyllysi 99.55
COG4099387 Predicted peptidase [General function prediction o 99.55
TIGR01249306 pro_imino_pep_1 proline iminopeptidase, Neisseria- 99.55
COG2945210 Predicted hydrolase of the alpha/beta superfamily 99.55
PLN02578354 hydrolase 99.55
PRK06489360 hypothetical protein; Provisional 99.55
PLN00021313 chlorophyllase 99.55
TIGR01392351 homoserO_Ac_trn homoserine O-acetyltransferase. Th 99.54
PRK00175379 metX homoserine O-acetyltransferase; Provisional 99.53
KOG4409365 consensus Predicted hydrolase/acyltransferase (alp 99.53
PF10503220 Esterase_phd: Esterase PHB depolymerase 99.52
KOG4667269 consensus Predicted esterase [Lipid transport and 99.52
PRK11126242 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxyl 99.52
TIGR03101266 hydr2_PEP hydrolase, ortholog 2, exosortase system 99.51
PLN03084383 alpha/beta hydrolase fold protein; Provisional 99.51
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 99.5
PLN02211273 methyl indole-3-acetate methyltransferase 99.49
COG0400207 Predicted esterase [General function prediction on 99.48
PF08840213 BAAT_C: BAAT / Acyl-CoA thioester hydrolase C term 99.48
KOG1838409 consensus Alpha/beta hydrolase [General function p 99.44
PRK08775343 homoserine O-acetyltransferase; Provisional 99.43
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.43
PF12715390 Abhydrolase_7: Abhydrolase family; PDB: 3NUZ_C 3G8 99.41
KOG3043242 consensus Predicted hydrolase related to dienelact 99.4
KOG0271480 consensus Notchless-like WD40 repeat-containing pr 99.4
KOG1454326 consensus Predicted hydrolase/acyltransferase (alp 99.4
COG3509312 LpqC Poly(3-hydroxybutyrate) depolymerase [Seconda 99.39
PLN029801655 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesi 99.35
PRK06765389 homoserine O-acetyltransferase; Provisional 99.34
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 99.34
TIGR01838532 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, 99.33
KOG0315311 consensus G-protein beta subunit-like protein (con 99.31
PRK05855 582 short chain dehydrogenase; Validated 99.29
KOG0318603 consensus WD40 repeat stress protein/actin interac 99.28
KOG0293519 consensus WD40 repeat-containing protein [Function 99.28
PRK10439411 enterobactin/ferric enterobactin esterase; Provisi 99.28
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.27
PF12740259 Chlorophyllase2: Chlorophyllase enzyme; InterPro: 99.23
COG4946668 Uncharacterized protein related to the periplasmic 99.23
KOG0279315 consensus G protein beta subunit-like protein [Sig 99.22
KOG2984277 consensus Predicted hydrolase [General function pr 99.21
KOG4627270 consensus Kynurenine formamidase [Amino acid trans 99.18
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 99.18
COG2936 563 Predicted acyl esterases [General function predict 99.18
PRK11028330 6-phosphogluconolactonase; Provisional 99.18
PF03583290 LIP: Secretory lipase ; InterPro: IPR005152 This e 99.18
PF05728187 UPF0227: Uncharacterised protein family (UPF0227); 99.18
KOG0265338 consensus U5 snRNP-specific protein-like factor an 99.17
PF00756251 Esterase: Putative esterase; InterPro: IPR000801 T 99.17
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 99.16
PRK11028330 6-phosphogluconolactonase; Provisional 99.15
PRK07868 994 acyl-CoA synthetase; Validated 99.15
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 99.14
KOG3101283 consensus Esterase D [General function prediction 99.14
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 99.13
PF08538303 DUF1749: Protein of unknown function (DUF1749); In 99.13
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.12
PF00561230 Abhydrolase_1: alpha/beta hydrolase fold A web pag 99.11
KOG0286343 consensus G-protein beta subunit [General function 99.1
KOG0266456 consensus WD40 repeat-containing protein [General 99.1
KOG0279315 consensus G protein beta subunit-like protein [Sig 99.1
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 99.1
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 99.06
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 99.05
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 99.05
COG4757281 Predicted alpha/beta hydrolase [General function p 99.05
cd00312 493 Esterase_lipase Esterases and lipases (includes fu 99.04
KOG0318603 consensus WD40 repeat stress protein/actin interac 99.04
PF03403379 PAF-AH_p_II: Platelet-activating factor acetylhydr 99.04
KOG0291893 consensus WD40-repeat-containing subunit of the 18 99.03
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.03
PRK13616591 lipoprotein LpqB; Provisional 99.01
KOG0266456 consensus WD40 repeat-containing protein [General 99.0
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.0
KOG2564343 consensus Predicted acetyltransferases and hydrola 98.99
PF06342297 DUF1057: Alpha/beta hydrolase of unknown function 98.94
KOG0645312 consensus WD40 repeat protein [General function pr 98.94
TIGR01839560 PHA_synth_II poly(R)-hydroxyalkanoic acid synthase 98.93
COG3571213 Predicted hydrolase of the alpha/beta-hydrolase fo 98.92
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 98.92
KOG1407313 consensus WD40 repeat protein [Function unknown] 98.9
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 98.9
PTZ00421493 coronin; Provisional 98.9
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 98.89
KOG2382315 consensus Predicted alpha/beta hydrolase [General 98.89
PTZ00421493 coronin; Provisional 98.88
KOG0293519 consensus WD40 repeat-containing protein [Function 98.88
COG2272 491 PnbA Carboxylesterase type B [Lipid metabolism] 98.87
KOG0275508 consensus Conserved WD40 repeat-containing protein 98.87
PRK13616591 lipoprotein LpqB; Provisional 98.85
KOG2055514 consensus WD40 repeat protein [General function pr 98.85
KOG2624403 consensus Triglyceride lipase-cholesterol esterase 98.84
PF10340374 DUF2424: Protein of unknown function (DUF2424); In 98.84
KOG0973 942 consensus Histone transcription regulator HIRA, WD 98.84
COG4188365 Predicted dienelactone hydrolase [General function 98.83
PF09752348 DUF2048: Uncharacterized conserved protein (DUF204 98.83
KOG0973 942 consensus Histone transcription regulator HIRA, WD 98.82
KOG0263707 consensus Transcription initiation factor TFIID, s 98.81
PF00135 535 COesterase: Carboxylesterase family The prints ent 98.81
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 98.81
KOG0291893 consensus WD40-repeat-containing subunit of the 18 98.8
PF06821171 Ser_hydrolase: Serine hydrolase; InterPro: IPR0106 98.79
KOG2139445 consensus WD40 repeat protein [General function pr 98.79
COG2382299 Fes Enterochelin esterase and related enzymes [Ino 98.79
PF07224307 Chlorophyllase: Chlorophyllase; InterPro: IPR01082 98.79
COG0596282 MhpC Predicted hydrolases or acyltransferases (alp 98.78
COG0627316 Predicted esterase [General function prediction on 98.78
PTZ00420568 coronin; Provisional 98.77
KOG2112206 consensus Lysophospholipase [Lipid transport and m 98.77
KOG0772641 consensus Uncharacterized conserved protein, conta 98.76
PTZ00420568 coronin; Provisional 98.75
COG3208244 GrsT Predicted thioesterase involved in non-riboso 98.74
KOG2055514 consensus WD40 repeat protein [General function pr 98.73
KOG0315311 consensus G-protein beta subunit-like protein (con 98.73
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 98.73
KOG3847399 consensus Phospholipase A2 (platelet-activating fa 98.73
KOG0284464 consensus Polyadenylation factor I complex, subuni 98.72
cd00707275 Pancreat_lipase_like Pancreatic lipase-like enzyme 98.7
PF02273294 Acyl_transf_2: Acyl transferase; InterPro: IPR0031 98.69
KOG0286343 consensus G-protein beta subunit [General function 98.68
COG2021368 MET2 Homoserine acetyltransferase [Amino acid tran 98.66
TIGR03230 442 lipo_lipase lipoprotein lipase. Members of this pr 98.66
TIGR01849406 PHB_depoly_PhaZ polyhydroxyalkanoate depolymerase, 98.66
COG2819264 Predicted hydrolase of the alpha/beta superfamily 98.65
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 98.61
PRK10115686 protease 2; Provisional 98.59
KOG0282503 consensus mRNA splicing factor [Function unknown] 98.59
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 98.59
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 98.57
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 98.57
TIGR03502792 lipase_Pla1_cef extracellular lipase, Pla-1/cef fa 98.57
KOG2314698 consensus Translation initiation factor 3, subunit 98.57
PLN00181793 protein SPA1-RELATED; Provisional 98.57
KOG0263707 consensus Transcription initiation factor TFIID, s 98.56
KOG4497447 consensus Uncharacterized conserved protein WDR8, 98.56
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 98.56
KOG0282503 consensus mRNA splicing factor [Function unknown] 98.55
KOG0296399 consensus Angio-associated migratory cell protein 98.5
KOG4497447 consensus Uncharacterized conserved protein WDR8, 98.5
KOG0296399 consensus Angio-associated migratory cell protein 98.48
KOG2096420 consensus WD40 repeat protein [General function pr 98.47
KOG0275508 consensus Conserved WD40 repeat-containing protein 98.46
PF03959212 FSH1: Serine hydrolase (FSH1); InterPro: IPR005645 98.46
COG1073299 Hydrolases of the alpha/beta superfamily [General 98.45
KOG0645312 consensus WD40 repeat protein [General function pr 98.44
KOG1407313 consensus WD40 repeat protein [Function unknown] 98.44
PRK04940180 hypothetical protein; Provisional 98.44
KOG2314698 consensus Translation initiation factor 3, subunit 98.42
KOG0643327 consensus Translation initiation factor 3, subunit 98.41
KOG1009434 consensus Chromatin assembly complex 1 subunit B/C 98.41
KOG0284464 consensus Polyadenylation factor I complex, subuni 98.37
PF11144403 DUF2920: Protein of unknown function (DUF2920); In 98.33
PF10230266 DUF2305: Uncharacterised conserved protein (DUF230 98.32
KOG1553517 consensus Predicted alpha/beta hydrolase BAT5 [Gen 98.32
KOG1274 933 consensus WD40 repeat protein [General function pr 98.3
PLN00181793 protein SPA1-RELATED; Provisional 98.29
KOG2096420 consensus WD40 repeat protein [General function pr 98.29
COG3243445 PhaC Poly(3-hydroxyalkanoate) synthetase [Lipid me 98.28
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 98.25
KOG2551230 consensus Phospholipase/carboxyhydrolase [Amino ac 98.23
KOG1274 933 consensus WD40 repeat protein [General function pr 98.22
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 98.22
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 98.2
KOG0283712 consensus WD40 repeat-containing protein [Function 98.2
KOG1273405 consensus WD40 repeat protein [General function pr 98.19
KOG2315566 consensus Predicted translation initiation factor 98.19
KOG0278334 consensus Serine/threonine kinase receptor-associa 98.18
KOG1516 545 consensus Carboxylesterase and related proteins [G 98.18
COG3386307 Gluconolactonase [Carbohydrate transport and metab 98.16
PF1214679 Hydrolase_4: Putative lysophospholipase; InterPro: 98.13
COG5354561 Uncharacterized protein, contains Trp-Asp (WD) rep 98.08
KOG0771398 consensus Prolactin regulatory element-binding pro 98.07
KOG14451012 consensus Tumor-specific antigen (contains WD repe 98.07
PF11339 581 DUF3141: Protein of unknown function (DUF3141); In 98.07
KOG0772641 consensus Uncharacterized conserved protein, conta 98.06
PF06028255 DUF915: Alpha/beta hydrolase of unknown function ( 98.06
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 98.04
KOG0288459 consensus WD40 repeat protein TipD [General functi 98.03
COG3545181 Predicted esterase of the alpha/beta hydrolase fol 98.01
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 98.0
KOG0639705 consensus Transducin-like enhancer of split protei 97.99
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 97.99
KOG3253 784 consensus Predicted alpha/beta hydrolase [General 97.96
PLN029191057 haloacid dehalogenase-like hydrolase family protei 97.95
KOG1524737 consensus WD40 repeat-containing protein CHE-2 [Ge 97.93
KOG0265338 consensus U5 snRNP-specific protein-like factor an 97.88
KOG2315566 consensus Predicted translation initiation factor 97.88
PF06057192 VirJ: Bacterial virulence protein (VirJ); InterPro 97.86
KOG0278334 consensus Serine/threonine kinase receptor-associa 97.85
COG3150191 Predicted esterase [General function prediction on 97.84
KOG0306888 consensus WD40-repeat-containing subunit of the 18 97.84
KOG0639705 consensus Transducin-like enhancer of split protei 97.83
KOG0319775 consensus WD40-repeat-containing subunit of the 18 97.83
PF10142367 PhoPQ_related: PhoPQ-activated pathogenicity-relat 97.81
KOG2931326 consensus Differentiation-related gene 1 protein ( 97.8
KOG0643327 consensus Translation initiation factor 3, subunit 97.8
KOG2139445 consensus WD40 repeat protein [General function pr 97.79
KOG0640430 consensus mRNA cleavage stimulating factor complex 97.79
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 97.76
KOG0288459 consensus WD40 repeat protein TipD [General functi 97.76
COG5354561 Uncharacterized protein, contains Trp-Asp (WD) rep 97.76
COG3391381 Uncharacterized conserved protein [Function unknow 97.74
KOG0313423 consensus Microtubule binding protein YTM1 (contai 97.73
PF12048310 DUF3530: Protein of unknown function (DUF3530); In 97.72
PF07819225 PGAP1: PGAP1-like protein; InterPro: IPR012908 The 97.71
TIGR02171912 Fb_sc_TIGR02171 Fibrobacter succinogenes paralogou 97.7
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 97.69
KOG2048691 consensus WD40 repeat protein [General function pr 97.68
KOG2106626 consensus Uncharacterized conserved protein, conta 97.68
PF03096283 Ndr: Ndr family; InterPro: IPR004142 This family c 97.67
KOG0641350 consensus WD40 repeat protein [General function pr 97.67
COG1770682 PtrB Protease II [Amino acid transport and metabol 97.66
PF00975229 Thioesterase: Thioesterase domain; InterPro: IPR00 97.65
KOG0295406 consensus WD40 repeat-containing protein [Function 97.65
PF05577 434 Peptidase_S28: Serine carboxypeptidase S28; InterP 97.63
KOG4840299 consensus Predicted hydrolases or acyltransferases 97.62
PF05705240 DUF829: Eukaryotic protein of unknown function (DU 97.61
KOG2106626 consensus Uncharacterized conserved protein, conta 97.59
COG4814288 Uncharacterized protein with an alpha/beta hydrola 97.59
KOG0319775 consensus WD40-repeat-containing subunit of the 18 97.59
PTZ00472 462 serine carboxypeptidase (CBP1); Provisional 97.58
KOG0303472 consensus Actin-binding protein Coronin, contains 97.56
KOG0771398 consensus Prolactin regulatory element-binding pro 97.56
PF05677365 DUF818: Chlamydia CHLPS protein (DUF818); InterPro 97.56
KOG0283712 consensus WD40 repeat-containing protein [Function 97.53
KOG1273405 consensus WD40 repeat protein [General function pr 97.53
KOG1539910 consensus WD repeat protein [General function pred 97.53
PF00151331 Lipase: Lipase; InterPro: IPR013818 Triglyceride l 97.53
KOG0647347 consensus mRNA export protein (contains WD40 repea 97.52
KOG0289506 consensus mRNA splicing factor [General function p 97.49
KOG0264422 consensus Nucleosome remodeling factor, subunit CA 97.49
PF01674219 Lipase_2: Lipase (class 2); InterPro: IPR002918 Li 97.49
KOG2394636 consensus WD40 protein DMR-N9 [General function pr 97.47
KOG0310487 consensus Conserved WD40 repeat-containing protein 97.45
KOG2048691 consensus WD40 repeat protein [General function pr 97.44
KOG0268433 consensus Sof1-like rRNA processing protein (conta 97.42
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 97.4
PF0767639 PD40: WD40-like Beta Propeller Repeat; InterPro: I 97.39
KOG0299479 consensus U3 snoRNP-associated protein (contains W 97.39
KOG2919406 consensus Guanine nucleotide-binding protein [Gene 97.37
KOG0306888 consensus WD40-repeat-containing subunit of the 18 97.37
COG4947227 Uncharacterized protein conserved in bacteria [Fun 97.35
PF04762928 IKI3: IKI3 family; InterPro: IPR006849 Members of 97.34
PLN02733 440 phosphatidylcholine-sterol O-acyltransferase 97.33
KOG0295406 consensus WD40 repeat-containing protein [Function 97.33
KOG0277311 consensus Peroxisomal targeting signal type 2 rece 97.33
PF07519 474 Tannase: Tannase and feruloyl esterase; InterPro: 97.31
KOG2919406 consensus Guanine nucleotide-binding protein [Gene 97.3
KOG0640430 consensus mRNA cleavage stimulating factor complex 97.28
PRK02888635 nitrous-oxide reductase; Validated 97.26
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 97.26
KOG0307 1049 consensus Vesicle coat complex COPII, subunit SEC3 97.26
KOG2110391 consensus Uncharacterized conserved protein, conta 97.25
TIGR02171912 Fb_sc_TIGR02171 Fibrobacter succinogenes paralogou 97.24
COG1506620 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-pept 97.24
KOG3975301 consensus Uncharacterized conserved protein [Funct 97.19
KOG1332299 consensus Vesicle coat complex COPII, subunit SEC1 97.16
KOG1524737 consensus WD40 repeat-containing protein CHE-2 [Ge 97.16
KOG0289506 consensus mRNA splicing factor [General function p 97.15
PLN029191057 haloacid dehalogenase-like hydrolase family protei 97.15
KOG1063764 consensus RNA polymerase II elongator complex, sub 97.14
KOG0316307 consensus Conserved WD40 repeat-containing protein 97.14
COG3386307 Gluconolactonase [Carbohydrate transport and metab 97.13
PF0767639 PD40: WD40-like Beta Propeller Repeat; InterPro: I 97.12
KOG0303472 consensus Actin-binding protein Coronin, contains 97.12
KOG0310487 consensus Conserved WD40 repeat-containing protein 97.12
KOG0316307 consensus Conserved WD40 repeat-containing protein 97.07
KOG4389 601 consensus Acetylcholinesterase/Butyrylcholinestera 97.05
PF05990233 DUF900: Alpha/beta hydrolase of unknown function ( 97.03
KOG1007370 consensus WD repeat protein TSSC1, WD repeat super 96.99
KOG2565469 consensus Predicted hydrolases or acyltransferases 96.99
KOG0650733 consensus WD40 repeat nucleolar protein Bop1, invo 96.99
KOG0294362 consensus WD40 repeat-containing protein [Function 96.98
KOG1523361 consensus Actin-related protein Arp2/3 complex, su 96.97
KOG1963792 consensus WD40 repeat protein [General function pr 96.96
KOG2394636 consensus WD40 protein DMR-N9 [General function pr 96.96
COG3391381 Uncharacterized conserved protein [Function unknow 96.94
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 96.91
COG3490366 Uncharacterized protein conserved in bacteria [Fun 96.91
PF00450 415 Peptidase_S10: Serine carboxypeptidase; InterPro: 96.86
KOG1063764 consensus RNA polymerase II elongator complex, sub 96.85
KOG0277311 consensus Peroxisomal targeting signal type 2 rece 96.84
KOG0308735 consensus Conserved WD40 repeat-containing protein 96.84
KOG4378673 consensus Nuclear protein COP1 [Signal transductio 96.83
KOG1009434 consensus Chromatin assembly complex 1 subunit B/C 96.82
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 96.74
KOG0285460 consensus Pleiotropic regulator 1 [RNA processing 96.72
KOG1445 1012 consensus Tumor-specific antigen (contains WD repe 96.71
KOG1332299 consensus Vesicle coat complex COPII, subunit SEC1 96.71
KOG0307 1049 consensus Vesicle coat complex COPII, subunit SEC3 96.7
KOG3967297 consensus Uncharacterized conserved protein [Funct 96.69
KOG2110391 consensus Uncharacterized conserved protein, conta 96.67
COG3490366 Uncharacterized protein conserved in bacteria [Fun 96.67
KOG0641350 consensus WD40 repeat protein [General function pr 96.65
KOG0302440 consensus Ribosome Assembly protein [General funct 96.64
KOG1539910 consensus WD repeat protein [General function pred 96.63
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 96.6
KOG0269839 consensus WD40 repeat-containing protein [Function 96.55
KOG0269 839 consensus WD40 repeat-containing protein [Function 96.54
KOG4328498 consensus WD40 protein [Function unknown] 96.52
PF07082250 DUF1350: Protein of unknown function (DUF1350); In 96.45
KOG0264422 consensus Nucleosome remodeling factor, subunit CA 96.43
KOG0313423 consensus Microtubule binding protein YTM1 (contai 96.42
KOG2182 514 consensus Hydrolytic enzymes of the alpha/beta hyd 96.37
PRK102521296 entF enterobactin synthase subunit F; Provisional 96.32
KOG0292 1202 consensus Vesicle coat complex COPI, alpha subunit 96.24
KOG2183 492 consensus Prolylcarboxypeptidase (angiotensinase C 96.24
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 96.22
KOG4378673 consensus Nuclear protein COP1 [Signal transductio 96.22
KOG2111346 consensus Uncharacterized conserved protein, conta 96.21
COG4782377 Uncharacterized protein conserved in bacteria [Fun 96.21
PF08386103 Abhydrolase_4: TAP-like protein; InterPro: IPR0135 96.18
KOG0299479 consensus U3 snoRNP-associated protein (contains W 96.11
PRK02888635 nitrous-oxide reductase; Validated 96.09
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 96.07
KOG0646476 consensus WD40 repeat protein [General function pr 96.06
KOG0292 1202 consensus Vesicle coat complex COPI, alpha subunit 96.06
COG3204316 Uncharacterized protein conserved in bacteria [Fun 96.04
KOG1007370 consensus WD repeat protein TSSC1, WD repeat super 95.99
KOG0647347 consensus mRNA export protein (contains WD40 repea 95.93
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 95.88
KOG4328498 consensus WD40 protein [Function unknown] 95.88
KOG4283397 consensus Transcription-coupled repair protein CSA 95.85
PLN03016 433 sinapoylglucose-malate O-sinapoyltransferase 95.78
KOG0285460 consensus Pleiotropic regulator 1 [RNA processing 95.76
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 95.76
COG3319257 Thioesterase domains of type I polyketide synthase 95.72
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 95.71
PLN02209 437 serine carboxypeptidase 95.66
TIGR03712511 acc_sec_asp2 accessory Sec system protein Asp2. Th 95.64
KOG2321703 consensus WD40 repeat protein [General function pr 95.61
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 95.59
KOG1282 454 consensus Serine carboxypeptidases (lysosomal cath 95.57
COG1075336 LipA Predicted acetyltransferases and hydrolases w 95.57
KOG0302440 consensus Ribosome Assembly protein [General funct 95.56
KOG4388 880 consensus Hormone-sensitive lipase HSL [Lipid tran 95.55
COG3204316 Uncharacterized protein conserved in bacteria [Fun 95.53
KOG1036323 consensus Mitotic spindle checkpoint protein BUB3, 95.48
KOG1408 1080 consensus WD40 repeat protein [Function unknown] 95.44
KOG3724 973 consensus Negative regulator of COPII vesicle form 95.11
KOG0267825 consensus Microtubule severing protein katanin p80 95.1
PF05057217 DUF676: Putative serine esterase (DUF676); InterPr 94.98
COG2319466 FOG: WD40 repeat [General function prediction only 94.94
PRK13614573 lipoprotein LpqB; Provisional 94.89
PF11187224 DUF2974: Protein of unknown function (DUF2974); In 94.89
KOG1523361 consensus Actin-related protein Arp2/3 complex, su 94.8
KOG0270463 consensus WD40 repeat-containing protein [Function 94.76
KOG4547541 consensus WD40 repeat-containing protein [General 94.41
KOG0650733 consensus WD40 repeat nucleolar protein Bop1, invo 94.41
KOG2321703 consensus WD40 repeat protein [General function pr 94.38
KOG0294362 consensus WD40 repeat-containing protein [Function 94.35
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 94.14
KOG1963792 consensus WD40 repeat protein [General function pr 94.13
PF02450 389 LCAT: Lecithin:cholesterol acyltransferase; InterP 94.11
KOG0321720 consensus WD40 repeat-containing protein L2DTL [Fu 94.05
KOG0267 825 consensus Microtubule severing protein katanin p80 94.05
KOG14081080 consensus WD40 repeat protein [Function unknown] 93.92
KOG3621726 consensus WD40 repeat-containing protein [General 93.77
COG2319466 FOG: WD40 repeat [General function prediction only 93.65
KOG4283397 consensus Transcription-coupled repair protein CSA 93.59
PF11768545 DUF3312: Protein of unknown function (DUF3312); In 93.51
KOG0268433 consensus Sof1-like rRNA processing protein (conta 93.47
TIGR02604367 Piru_Ver_Nterm putative membrane-bound dehydrogena 93.45
KOG1551371 consensus Uncharacterized conserved protein [Funct 93.19
COG2939 498 Carboxypeptidase C (cathepsin A) [Amino acid trans 93.17
PRK13613599 lipoprotein LpqB; Provisional 93.12
KOG0290364 consensus Conserved WD40 repeat-containing protein 93.0
KOG1034385 consensus Transcriptional repressor EED/ESC/FIE, r 92.95
KOG0308735 consensus Conserved WD40 repeat-containing protein 92.84
PRK13615557 lipoprotein LpqB; Provisional 92.71
PRK13613599 lipoprotein LpqB; Provisional 92.7
PF13449326 Phytase-like: Esterase-like activity of phytase 92.67
KOG1034385 consensus Transcriptional repressor EED/ESC/FIE, r 92.64
KOG2521350 consensus Uncharacterized conserved protein [Funct 92.49
KOG3914390 consensus WD repeat protein WDR4 [Function unknown 92.45
KOG0276 794 consensus Vesicle coat complex COPI, beta' subunit 92.43
KOG0646476 consensus WD40 repeat protein [General function pr 92.33
KOG0321720 consensus WD40 repeat-containing protein L2DTL [Fu 92.3
TIGR02604367 Piru_Ver_Nterm putative membrane-bound dehydrogena 92.29
COG4257353 Vgb Streptogramin lyase [Defense mechanisms] 92.27
KOG4532344 consensus WD40-like repeat containing protein [Gen 92.16
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 92.1
KOG2111346 consensus Uncharacterized conserved protein, conta 91.93
PF01764140 Lipase_3: Lipase (class 3); InterPro: IPR002921 Tr 91.89
KOG2100755 consensus Dipeptidyl aminopeptidase [Posttranslati 91.71
cd00741153 Lipase Lipase. Lipases are esterases that can hydr 91.6
smart00824212 PKS_TE Thioesterase. Peptide synthetases are invol 91.47
TIGR03606454 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH 90.95
PLN02606306 palmitoyl-protein thioesterase 90.95
PF11288207 DUF3089: Protein of unknown function (DUF3089); In 90.34
PF02089279 Palm_thioest: Palmitoyl protein thioesterase; Inte 90.22
PF07995331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 90.1
PF11768545 DUF3312: Protein of unknown function (DUF3312); In 90.08
PRK13614573 lipoprotein LpqB; Provisional 90.0
KOG0290364 consensus Conserved WD40 repeat-containing protein 89.91
PF0308889 Str_synth: Strictosidine synthase; InterPro: IPR01 89.88
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 89.82
KOG0974 967 consensus WD-repeat protein WDR6, WD repeat superf 89.64
PF03283361 PAE: Pectinacetylesterase 89.64
KOG3914390 consensus WD repeat protein WDR4 [Function unknown 89.63
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 89.01
PLN02517 642 phosphatidylcholine-sterol O-acyltransferase 88.57
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 88.55
KOG0649325 consensus WD40 repeat protein [General function pr 88.35
COG4287 507 PqaA PhoPQ-activated pathogenicity-related protein 88.3
KOG0300481 consensus WD40 repeat-containing protein [Function 87.91
>COG1506 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism] Back     alignment and domain information 
Probab=100.00  E-value=2.3e-49  Score=455.81  Aligned_cols=600  Identities=22%  Similarity=0.313  Sum_probs=422.6

Q ss_pred             ecCCCCcceEEEEEeechhhcccceeEEEEEEeecCCCCccceeecCCcceecccEEEEeCCCCCeEEEEecCCCCCCeE
Q 003363          102 NSGNGNGTQAMFSISQPNLLANKRKKFMLSTVISKENENSVTFQWAPFPVEMTGASAVVPSPSGSKLLVVRNPENESPIQ  181 (826)
Q Consensus       102 ~~~s~dg~~v~~~~~~~~~~~~~~~~~l~~~~i~~~~~~~~~lt~~~~~~~~~~~~~~~~SPdG~~la~~~~~~~~~~~~  181 (826)
                      +..+|+|..++|..+..+...+.....+|+.+...    ...++..      ..+..+.|||||+.++|.++.++...++
T Consensus        18 ~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~d~~~----~~~~~~~------~~~~~~~~spdg~~~~~~~~~~~~~~~l   87 (620)
T COG1506          18 PRVSPPGGRLAYILTGLDFLKPLYKSSLWVSDGKT----VRLLTFG------GGVSELRWSPDGSVLAFVSTDGGRVAQL   87 (620)
T ss_pred             cccCCCCceeEEeeccccccccccccceEEEeccc----ccccccC------CcccccccCCCCCEEEEEeccCCCcceE
Confidence            34468899999998887777788888999855321    2233333      4688999999999999998555456777


Q ss_pred             EEEecCCceeEEEecCCCccccccCCCcccceeecCCCCeEEEEeecCCCCCCCccCCCCCCCCCCccCCCCCCcceeec
Q 003363          182 FELWSQSQLEKEFHVPQTVHGSVYADGWFEGISWNSDETLIAYVAEEPSPSKPTFSLGSTKGGSSDKDCNSWKGQGDWEE  261 (826)
Q Consensus       182 ~~i~~~~~~~~~~~~~~~~~g~v~~~~~~~~~~wSPDg~~ia~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  261 (826)
                      +.+..++   .......++          ..+.|+|+|+.+++..........         +.   +......-..|..
T Consensus        88 ~l~~~~g---~~~~~~~~v----------~~~~~~~~g~~~~~~~~~~~~~~~---------~~---~~~~~~~~~~~~~  142 (620)
T COG1506          88 YLVDVGG---LITKTAFGV----------SDARWSPDGDRIAFLTAEGASKRD---------GG---DHLFVDRLPVWFD  142 (620)
T ss_pred             EEEecCC---ceeeeeccc----------ccceeCCCCCeEEEEecccccccC---------Cc---eeeeecccceeec
Confidence            7777444   222223333          688999999999994433221110         00   0000011111111


Q ss_pred             CCCccCCCccCceEEEEEccCCceEeccCCCCCCccceEEEeeCCCCCccEEEEEeecCcceeeeeeeeccCCCceEEEE
Q 003363          262 DWGETYAGKRQPSLFVININSGEVQAVKGIPKSLSVGQVVWAPLNEGLHQYLVFVGWSSETRKLGIKYCYNRPCALYAVR  341 (826)
Q Consensus       262 d~g~~~~~~~~~~l~v~d~~~g~~~~l~~~~~~~~~~~~~wSPDg~~~~~~lvf~~~~~~~~~~g~~~~~~~~~~l~~~d  341 (826)
                      .-|     ....+++++|.++ ....+  ......+..+.|.+|++.    ++........ .       ..-...+...
T Consensus       143 ~~g-----~~~~~l~~~d~~~-~~~~~--~~~~~~~~~~~~~~~~~~----~~~~~~~~~~-~-------~~~~~~~~~~  202 (620)
T COG1506         143 GRG-----GERSDLYVVDIES-KLIKL--GLGNLDVVSFATDGDGRL----VASIRLDDDA-D-------PWVTNLYVLI  202 (620)
T ss_pred             CCC-----CcccceEEEccCc-ccccc--cCCCCceeeeeeCCCCce----eEEeeecccc-C-------CceEeeEEEe
Confidence            111     2468899999877 44444  455556666666666775    5555432220 0       0111233333


Q ss_pred             cccccchhhhhhhhcCCCCCCcceecCCCCccccCceecCCCCEEEEEeccCCCCCCCCcccceEEEEeCCCCCCCCccc
Q 003363          342 VSLYKSEASELELKESSSEDLPVVNLTESISSAFFPRFSPDGKFLVFLSAKSSVDSGAHSATDSLHRIDWPTNGNFSSLE  421 (826)
Q Consensus       342 ~~~~~~~~~~~~~~~~~~~~~~~~~Lt~~~~~~~~p~~SpDG~~l~f~s~~~~~~~g~~~~~~~l~~~d~~~~~~~~~~~  421 (826)
                      .                 .++....++........+.|.+||+.+++.......  | ......+++++...+....   
T Consensus       203 ~-----------------~~~~~~~~~~~~~~~~~~~~~~~gk~~~~~~~~~~~--~-~~~~~~~~~~~~~~~~~d~---  259 (620)
T COG1506         203 E-----------------GNGELESLTPGEGSISKLAFDADGKSIALLGTESDR--G-LAEGDFILLLDGELGEVDG---  259 (620)
T ss_pred             c-----------------CCCceEEEcCCCceeeeeeeCCCCCeeEEeccCCcc--C-ccccceEEEEeccccccce---
Confidence            2                 467788888888889999999999999998887631  1 1233456666622222111   


Q ss_pred             ceeeeeeeeeccCCCCCcccccCCCCCCccccCCCEEEEEEEe-CCeEEEEEEECCCCcEEEecCCCCCeeeEEEeecCC
Q 003363          422 KIVDVIPVVQCAEGDCFPGLYSSSILSNPWLSDGCTMLLSSIW-GSSQVIISVNVSSGELLRITPAESNFSWSLLTLDGD  500 (826)
Q Consensus       422 ~~~~~~~~~~~~~~~~f~g~~~~~~~~~~ws~Dg~~l~~~~~~-~~~~~l~~vdl~tg~~~~lt~~~~~~~~~~~s~dg~  500 (826)
                          ......    . ..     +.....+.-++..++|.+.. .+...++.++..++....+..+.+  ....|+.+++
T Consensus       260 ----~~~~~~----~-~~-----~~~~~~~~~~~~~~~~~~~~~~g~~~l~~~~~~~~~~~~~~~~~~--~v~~f~~~~~  323 (620)
T COG1506         260 ----DLSSGD----D-TR-----GAWAVEGGLDGDGLLFIATDGGGSSPLFRVDDLGGGVEGLSGDDG--GVPGFDVDGR  323 (620)
T ss_pred             ----eeccCC----c-cc-----CcHHhccccCCCcEEEEEecCCCceEEEEEeccCCceeeecCCCc--eEEEEeeCCC
Confidence                000000    0 00     00111122345556666665 677788888765555555544434  4456777999


Q ss_pred             EEEEEEeCCCCCCeEEEEeecccCCCceeeeeccCCCCCCCchhhhhcccccceeeeeecccCceeeeccCCCeeEEEEE
Q 003363          501 NIIAVSSSPVDVPQVKYGYFVDKANKGTWSWLNVSSPISRCPEKVKSLLSSRQFSIMKIPVKGVSANLTKGAQKPFEAIF  580 (826)
Q Consensus       501 ~l~~~~s~~~~p~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~g~~l~~~~  580 (826)
                      .+++..+++..|+++++.+.. ..  ..+.         ..+.   ..+....+     . +...+.+...+|.++++|+
T Consensus       324 ~~~~~~s~~~~p~~i~~~~~~-~~--~~~~---------~~~~---~~~~~~~~-----~-~~e~~~~~~~dG~~i~~~l  382 (620)
T COG1506         324 KLALAYSSPTEPPEIYLYDRG-EE--AKLT---------SSNN---SGLKKVKL-----A-EPEPVTYKSNDGETIHGWL  382 (620)
T ss_pred             EEEEEecCCCCccceEEEcCC-Cc--eEEe---------eccc---cccccccc-----C-CceEEEEEcCCCCEEEEEE
Confidence            999999999999999998862 11  1110         0011   11111111     1 1112245566889999999


Q ss_pred             EecCCCCCCCCCcEEEEEcCCCCCCCCccchHHHHHHHHCCcEEEEECCCCCCCCchhhhhcCCCCCCcchHHHHHHHHH
Q 003363          581 VSSSHKKDCSCDPLIVVLHGGPHSVSLSSYSKSLAFLSSVGYSLLIVNYRGSLGFGEEALQSLPGKVGSQDVNDVLTAID  660 (826)
Q Consensus       581 ~~P~~~~~~~~~P~vv~~HGg~~~~~~~~~~~~~~~la~~G~~Vl~~d~rG~~g~G~~~~~~~~~~~~~~~~~D~~~~i~  660 (826)
                      +.|.++++.+++|+||++||||.......+....+.|+++||+|+.+||||+.|||++|.+....+++..+.+|+.++++
T Consensus       383 ~~P~~~~~~k~yP~i~~~hGGP~~~~~~~~~~~~q~~~~~G~~V~~~n~RGS~GyG~~F~~~~~~~~g~~~~~D~~~~~~  462 (620)
T COG1506         383 YKPPGFDPRKKYPLIVYIHGGPSAQVGYSFNPEIQVLASAGYAVLAPNYRGSTGYGREFADAIRGDWGGVDLEDLIAAVD  462 (620)
T ss_pred             ecCCCCCCCCCCCEEEEeCCCCccccccccchhhHHHhcCCeEEEEeCCCCCCccHHHHHHhhhhccCCccHHHHHHHHH
Confidence            99999988888999999999998887778889999999999999999999999999999999999999999999999999


Q ss_pred             HHHHcCCCCCCcEEEEEecchHHHHHHHHHhCCCceeEEEecCCccchhhhccCCCCCCchhhhhccCcCCccCCCCCCh
Q 003363          661 HVIDMGLANPSKVTVVGGSHGGFLTTHLIGQAPDKFVAAAARNPLCNLALMVGTTDIPDWCYVESYGSKGKDSFTESPSV  740 (826)
Q Consensus       661 ~l~~~~~~d~~rv~l~G~S~GG~~a~~~a~~~p~~~~a~v~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  740 (826)
                      ++.+.+.+|++||+|+|+|+||+|+++++++.| .|+++++..+.+++..+........+........        .+.+
T Consensus       463 ~l~~~~~~d~~ri~i~G~SyGGymtl~~~~~~~-~f~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--------~~~~  533 (620)
T COG1506         463 ALVKLPLVDPERIGITGGSYGGYMTLLAATKTP-RFKAAVAVAGGVDWLLYFGESTEGLRFDPEENGG--------GPPE  533 (620)
T ss_pred             HHHhCCCcChHHeEEeccChHHHHHHHHHhcCc-hhheEEeccCcchhhhhccccchhhcCCHHHhCC--------Cccc
Confidence            999999999999999999999999999999877 8999999999888887776665544433322221        1212


Q ss_pred             hhHHHHhhcCcccccCCCCCcEEEEEeCCCCCCCcHHHHHHHHHHHhCCCCEEEEEeCCCCCCCCCCCCHHHHHHHHHHH
Q 003363          741 EDLTRFHSKSPISHISKVKTPTIFLLGAQDLRVPVSNGLQYARALREKGVETKVIVFPNDVHGIERPQSDFESFLNIGLW  820 (826)
Q Consensus       741 ~~~~~~~~~sp~~~~~~i~~PvLii~G~~D~~vp~~~~~~~~~~l~~~g~~~~~~~~p~~~H~~~~~~~~~~~~~~i~~w  820 (826)
                       +.+.+...||+.++.++++|+|||||+.|.+||.+|+++++++|+.+|+++++++||+++|++..+++....++.+++|
T Consensus       534 -~~~~~~~~sp~~~~~~i~~P~LliHG~~D~~v~~~q~~~~~~aL~~~g~~~~~~~~p~e~H~~~~~~~~~~~~~~~~~~  612 (620)
T COG1506         534 -DREKYEDRSPIFYADNIKTPLLLIHGEEDDRVPIEQAEQLVDALKRKGKPVELVVFPDEGHGFSRPENRVKVLKEILDW  612 (620)
T ss_pred             -ChHHHHhcChhhhhcccCCCEEEEeecCCccCChHHHHHHHHHHHHcCceEEEEEeCCCCcCCCCchhHHHHHHHHHHH
Confidence             5678999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHcC
Q 003363          821 FKKYCK  826 (826)
Q Consensus       821 ~~~~l~  826 (826)
                      |++|++
T Consensus       613 ~~~~~~  618 (620)
T COG1506         613 FKRHLK  618 (620)
T ss_pred             HHHHhc
Confidence            999985

>PRK10115 protease 2; Provisional Back     alignment and domain information
>KOG2100 consensus Dipeptidyl aminopeptidase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2281 consensus Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00326 Peptidase_S9: Prolyl oligopeptidase family This family belongs to family S9 of the peptidase classification Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG1770 PtrB Protease II [Amino acid transport and metabolism] Back     alignment and domain information
>COG1505 Serine proteases of the peptidase family S9A [Amino acid transport and metabolism] Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2237 consensus Predicted serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK10566 esterase; Provisional Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK13604 luxD acyl transferase; Provisional Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PLN02298 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1455 consensus Lysophospholipase [Lipid transport and metabolism] Back     alignment and domain information
>PHA02857 monoglyceride lipase; Provisional Back     alignment and domain information
>PLN02385 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>PLN02442 S-formylglutathione hydrolase Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK05077 frsA fermentation/respiration switch protein; Reviewed Back     alignment and domain information
>PRK10749 lysophospholipase L2; Provisional Back     alignment and domain information
>PF01738 DLH: Dienelactone hydrolase family; InterPro: IPR002925 Dienelactone hydrolases play a crucial role in chlorocatechol degradation via the modified ortho cleavage pathway Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>TIGR02821 fghA_ester_D S-formylglutathione hydrolase Back     alignment and domain information
>COG1647 Esterase/lipase [General function prediction only] Back     alignment and domain information
>PLN02652 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>PRK10162 acetyl esterase; Provisional Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>COG0412 Dienelactone hydrolase and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF05448 AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR008391 This family consists of several bacterial acetyl xylan esterase proteins Back     alignment and domain information
>COG2267 PldB Lysophospholipase [Lipid metabolism] Back     alignment and domain information
>PRK11460 putative hydrolase; Provisional Back     alignment and domain information
>KOG1552 consensus Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>PRK05371 x-prolyl-dipeptidyl aminopeptidase; Provisional Back     alignment and domain information
>TIGR01840 esterase_phb esterase, PHB depolymerase family Back     alignment and domain information
>PRK00870 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PRK10985 putative hydrolase; Provisional Back     alignment and domain information
>KOG4391 consensus Predicted alpha/beta hydrolase BEM46 [General function prediction only] Back     alignment and domain information
>TIGR03343 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase Back     alignment and domain information
>PLN02511 hydrolase Back     alignment and domain information
>COG3458 Acetyl esterase (deacetylase) [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG0657 Aes Esterase/lipase [Lipid metabolism] Back     alignment and domain information
>PLN02824 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>TIGR01607 PST-A Plasmodium subtelomeric family (PST-A) Back     alignment and domain information
>TIGR03611 RutD pyrimidine utilization protein D Back     alignment and domain information
>KOG4178 consensus Soluble epoxide hydrolase [Lipid transport and metabolism] Back     alignment and domain information
>TIGR02240 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymerase Back     alignment and domain information
>PLN02965 Probable pheophorbidase Back     alignment and domain information
>KOG1515 consensus Arylacetamide deacetylase [Defense mechanisms] Back     alignment and domain information
>TIGR02427 protocat_pcaD 3-oxoadipate enol-lactonase Back     alignment and domain information
>PRK10673 acyl-CoA esterase; Provisional Back     alignment and domain information
>PF12695 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3D0K_B 2I3D_B 3DOH_B 3DOI_B 3PFB_A 3S2Z_B 3PFC_A 3QM1_A 3PF8_B 3PF9_A Back     alignment and domain information
>PRK03592 haloalkane dehalogenase; Provisional Back     alignment and domain information
>TIGR00976 /NonD putative hydrolase, CocE/NonD family Back     alignment and domain information
>TIGR03056 bchO_mg_che_rel putative magnesium chelatase accessory protein Back     alignment and domain information
>PF07859 Abhydrolase_3: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>PLN02679 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PLN03087 BODYGUARD 1 domain containing hydrolase; Provisional Back     alignment and domain information
>PF02129 Peptidase_S15: X-Pro dipeptidyl-peptidase (S15 family); InterPro: IPR000383 This entry represents a domain found peptidases Xaa-Pro dipeptidyl-peptidase and glutaryl-7-aminocephalosporanic-acid acylase, which belong to MEROPS peptidase families S15 and S45 respectively [] Back     alignment and domain information
>TIGR01250 pro_imino_pep_2 proline-specific peptidases, Bacillus coagulans-type subfamily Back     alignment and domain information
>TIGR03100 hydr1_PEP hydrolase, ortholog 1, exosortase system type 1 associated Back     alignment and domain information
>PF02230 Abhydrolase_2: Phospholipase/Carboxylesterase; InterPro: IPR003140 This entry represents the alpha/beta hydrolase domain found in phospholipases [], carboxylesterases [] and thioesterases Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PRK11071 esterase YqiA; Provisional Back     alignment and domain information
>TIGR03695 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Back     alignment and domain information
>COG0429 Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only] Back     alignment and domain information
>TIGR01738 bioH putative pimeloyl-BioC--CoA transferase BioH Back     alignment and domain information
>PLN02894 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PRK03204 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PRK10349 carboxylesterase BioH; Provisional Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>PF06500 DUF1100: Alpha/beta hydrolase of unknown function (DUF1100); InterPro: IPR010520 Proteins in this entry display esterase activity toward pNP-butyrate [] Back     alignment and domain information
>PLN02872 triacylglycerol lipase Back     alignment and domain information
>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>TIGR01836 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synthase, class III, PhaC subunit Back     alignment and domain information
>PF12697 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3LLC_A 3A2N_E 3A2M_A 3A2L_A 3AFI_F 3C5V_A 3C5W_P 3E0X_A 2ZJF_A 3QYJ_A Back     alignment and domain information
>PRK07581 hypothetical protein; Validated Back     alignment and domain information
>PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional Back     alignment and domain information
>COG4099 Predicted peptidase [General function prediction only] Back     alignment and domain information
>TIGR01249 pro_imino_pep_1 proline iminopeptidase, Neisseria-type subfamily Back     alignment and domain information
>COG2945 Predicted hydrolase of the alpha/beta superfamily [General function prediction only] Back     alignment and domain information
>PLN02578 hydrolase Back     alignment and domain information
>PRK06489 hypothetical protein; Provisional Back     alignment and domain information
>PLN00021 chlorophyllase Back     alignment and domain information
>TIGR01392 homoserO_Ac_trn homoserine O-acetyltransferase Back     alignment and domain information
>PRK00175 metX homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>KOG4409 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>PF10503 Esterase_phd: Esterase PHB depolymerase Back     alignment and domain information
>KOG4667 consensus Predicted esterase [Lipid transport and metabolism] Back     alignment and domain information
>PRK11126 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase; Provisional Back     alignment and domain information
>TIGR03101 hydr2_PEP hydrolase, ortholog 2, exosortase system type 1 associated Back     alignment and domain information
>PLN03084 alpha/beta hydrolase fold protein; Provisional Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>PLN02211 methyl indole-3-acetate methyltransferase Back     alignment and domain information
>COG0400 Predicted esterase [General function prediction only] Back     alignment and domain information
>PF08840 BAAT_C: BAAT / Acyl-CoA thioester hydrolase C terminal; InterPro: IPR014940 Acyl-CoA thioesterases are a group of enzymes that catalyse the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acids and CoASH Back     alignment and domain information
>KOG1838 consensus Alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>PRK08775 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>PF12715 Abhydrolase_7: Abhydrolase family; PDB: 3NUZ_C 3G8Y_A Back     alignment and domain information
>KOG3043 consensus Predicted hydrolase related to dienelactone hydrolase [General function prediction only] Back     alignment and domain information
>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1454 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>COG3509 LpqC Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PLN02980 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesium ion binding / thiamin pyrophosphate binding Back     alignment and domain information
>PRK06765 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>TIGR01838 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, class I Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PRK10439 enterobactin/ferric enterobactin esterase; Provisional Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>PF12740 Chlorophyllase2: Chlorophyllase enzyme; InterPro: IPR010821 This family consists of several chlorophyllase proteins (3 Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG2984 consensus Predicted hydrolase [General function prediction only] Back     alignment and domain information
>KOG4627 consensus Kynurenine formamidase [Amino acid transport and metabolism] Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG2936 Predicted acyl esterases [General function prediction only] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>PF03583 LIP: Secretory lipase ; InterPro: IPR005152 This entry represents a family of secreted lipases Back     alignment and domain information
>PF05728 UPF0227: Uncharacterised protein family (UPF0227); InterPro: IPR008886 Despite being classed as uncharacterised proteins, the members of this family are almost certainly enzymes in that they contain a domain distantly related to IPR000073 from INTERPRO Back     alignment and domain information
>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] Back     alignment and domain information
>PF00756 Esterase: Putative esterase; InterPro: IPR000801 This family contains several seemingly unrelated proteins, including human esterase D; mycobacterial antigen 85, which is responsible for the high affinity of mycobacteria to fibronectin; Corynebacterium glutamicum major secreted protein PS1; and hypothetical proteins from Escherichia coli, yeast, mycobacteria and Haemophilus influenzae Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>PRK07868 acyl-CoA synthetase; Validated Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG3101 consensus Esterase D [General function prediction only] Back     alignment and domain information
>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>PF08538 DUF1749: Protein of unknown function (DUF1749); InterPro: IPR013744 This is a plant and fungal family of unknown function Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>PF00561 Abhydrolase_1: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>COG4757 Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>cd00312 Esterase_lipase Esterases and lipases (includes fungal lipases, cholinesterases, etc Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>PF03403 PAF-AH_p_II: Platelet-activating factor acetylhydrolase, isoform II; PDB: 3F98_B 3F97_B 3D59_A 3F96_A 3D5E_B 3F9C_A Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG2564 consensus Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>PF06342 DUF1057: Alpha/beta hydrolase of unknown function (DUF1057); InterPro: IPR010463 This entry consists of proteins of unknown function which have an alpha/beta hydrolase fold Back     alignment and domain information
>KOG0645 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>TIGR01839 PHA_synth_II poly(R)-hydroxyalkanoic acid synthase, class II Back     alignment and domain information
>COG3571 Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only] Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2382 consensus Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>COG2272 PnbA Carboxylesterase type B [Lipid metabolism] Back     alignment and domain information
>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2624 consensus Triglyceride lipase-cholesterol esterase [Lipid transport and metabolism] Back     alignment and domain information
>PF10340 DUF2424: Protein of unknown function (DUF2424); InterPro: IPR019436 Sterol homeostasis in eukaryotic cells relies on the reciprocal interconversion of free sterols and steryl esters Back     alignment and domain information
>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>COG4188 Predicted dienelactone hydrolase [General function prediction only] Back     alignment and domain information
>PF09752 DUF2048: Uncharacterized conserved protein (DUF2048); InterPro: IPR019149 This family of proteins has no known function Back     alignment and domain information
>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>PF00135 COesterase: Carboxylesterase family The prints entry is specific to acetylcholinesterase; InterPro: IPR002018 Higher eukaryotes have many distinct esterases Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>PF06821 Ser_hydrolase: Serine hydrolase; InterPro: IPR010662 This family contains a number of hypothetical bacterial proteins of unknown function, which may be cytosolic Back     alignment and domain information
>KOG2139 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG2382 Fes Enterochelin esterase and related enzymes [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF07224 Chlorophyllase: Chlorophyllase; InterPro: IPR010821 This family consists of several chlorophyllase proteins (3 Back     alignment and domain information
>COG0596 MhpC Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>COG0627 Predicted esterase [General function prediction only] Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG2112 consensus Lysophospholipase [Lipid transport and metabolism] Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>COG3208 GrsT Predicted thioesterase involved in non-ribosomal peptide biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG3847 consensus Phospholipase A2 (platelet-activating factor acetylhydrolase in humans) [Lipid transport and metabolism] Back     alignment and domain information
>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] Back     alignment and domain information
>cd00707 Pancreat_lipase_like Pancreatic lipase-like enzymes Back     alignment and domain information
>PF02273 Acyl_transf_2: Acyl transferase; InterPro: IPR003157 LuxD proteins are bacterial acyl transferases Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>COG2021 MET2 Homoserine acetyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03230 lipo_lipase lipoprotein lipase Back     alignment and domain information
>TIGR01849 PHB_depoly_PhaZ polyhydroxyalkanoate depolymerase, intracellular Back     alignment and domain information
>COG2819 Predicted hydrolase of the alpha/beta superfamily [General function prediction only] Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>TIGR03502 lipase_Pla1_cef extracellular lipase, Pla-1/cef family Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>KOG2096 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF03959 FSH1: Serine hydrolase (FSH1); InterPro: IPR005645 This entry represents proteins belonging to the AB hydrolase family Back     alignment and domain information
>COG1073 Hydrolases of the alpha/beta superfamily [General function prediction only] Back     alignment and domain information
>KOG0645 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>PRK04940 hypothetical protein; Provisional Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] Back     alignment and domain information
>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair] Back     alignment and domain information
>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] Back     alignment and domain information
>PF11144 DUF2920: Protein of unknown function (DUF2920); InterPro: IPR022605 This bacterial family of proteins has no known function Back     alignment and domain information
>PF10230 DUF2305: Uncharacterised conserved protein (DUF2305); InterPro: IPR019363 This entry contains proteins that have no known function Back     alignment and domain information
>KOG1553 consensus Predicted alpha/beta hydrolase BAT5 [General function prediction only] Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG2096 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG3243 PhaC Poly(3-hydroxyalkanoate) synthetase [Lipid metabolism] Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG2551 consensus Phospholipase/carboxyhydrolase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1273 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>KOG1516 consensus Carboxylesterase and related proteins [General function prediction only] Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF12146 Hydrolase_4: Putative lysophospholipase; InterPro: IPR022742 This domain is found in bacteria and eukaryotes and is approximately 110 amino acids in length Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] Back     alignment and domain information
>PF11339 DUF3141: Protein of unknown function (DUF3141); InterPro: IPR024501 This family of proteins appears to be predominantly expressed in Proteobacteria Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>PF06028 DUF915: Alpha/beta hydrolase of unknown function (DUF915); InterPro: IPR010315 This family consists of bacterial proteins of unknown function, which are hydrolase-like Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>COG3545 Predicted esterase of the alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>KOG3253 consensus Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only] Back     alignment and domain information
>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF06057 VirJ: Bacterial virulence protein (VirJ); InterPro: IPR010333 This entry contains several bacterial VirJ virulence proteins Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>COG3150 Predicted esterase [General function prediction only] Back     alignment and domain information
>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>PF10142 PhoPQ_related: PhoPQ-activated pathogenicity-related protein; InterPro: IPR009199 Proteins in this entry are believed to play a role in virulence/pathogenicity in Salmonella Back     alignment and domain information
>KOG2931 consensus Differentiation-related gene 1 protein (NDR1 protein), related proteins [Function unknown] Back     alignment and domain information
>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] Back     alignment and domain information
>KOG2139 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] Back     alignment and domain information
>PF12048 DUF3530: Protein of unknown function (DUF3530); InterPro: IPR022529 This family of proteins is functionally uncharacterised Back     alignment and domain information
>PF07819 PGAP1: PGAP1-like protein; InterPro: IPR012908 The sequences found in this family are similar to PGAP1 (Q765A7 from SWISSPROT) Back     alignment and domain information
>TIGR02171 Fb_sc_TIGR02171 Fibrobacter succinogenes paralogous family TIGR02171 Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] Back     alignment and domain information
>PF03096 Ndr: Ndr family; InterPro: IPR004142 This family consists of proteins from different gene families: Ndr1/RTP/Drg1, Ndr2, and Ndr3 Back     alignment and domain information
>KOG0641 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG1770 PtrB Protease II [Amino acid transport and metabolism] Back     alignment and domain information
>PF00975 Thioesterase: Thioesterase domain; InterPro: IPR001031 Thioesterase domains often occur integrated in or associated with peptide synthetases which are involved in the non-ribosomal synthesis of peptide antibiotics [] Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PF05577 Peptidase_S28: Serine carboxypeptidase S28; InterPro: IPR008758 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG4840 consensus Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>PF05705 DUF829: Eukaryotic protein of unknown function (DUF829); InterPro: IPR008547 This signature identifies Transmembrane protein 53, that have no known function but are predicted to be integral membrane proteins Back     alignment and domain information
>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] Back     alignment and domain information
>COG4814 Uncharacterized protein with an alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>PTZ00472 serine carboxypeptidase (CBP1); Provisional Back     alignment and domain information
>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton] Back     alignment and domain information
>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF05677 DUF818: Chlamydia CHLPS protein (DUF818); InterPro: IPR008536 This family of unknown function includes several Chlamydia CHLPS proteins and Legionella SidB proteins Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1273 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>PF00151 Lipase: Lipase; InterPro: IPR013818 Triglyceride lipases (3 Back     alignment and domain information
>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] Back     alignment and domain information
>PF01674 Lipase_2: Lipase (class 2); InterPro: IPR002918 Lipases or triacylglycerol acylhydrolases hydrolyse ester bonds in triacylglycerol giving diacylglycerol, monoacylglycerol, glycerol and free fatty acids [] Back     alignment and domain information
>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only] Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>PF07676 PD40: WD40-like Beta Propeller Repeat; InterPro: IPR011659 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only] Back     alignment and domain information
>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>COG4947 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>PLN02733 phosphatidylcholine-sterol O-acyltransferase Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF07519 Tannase: Tannase and feruloyl esterase; InterPro: IPR011118 This family includes fungal tannase [] and feruloyl esterase [, ] Back     alignment and domain information
>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only] Back     alignment and domain information
>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>TIGR02171 Fb_sc_TIGR02171 Fibrobacter succinogenes paralogous family TIGR02171 Back     alignment and domain information
>COG1506 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism] Back     alignment and domain information
>KOG3975 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only] Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF07676 PD40: WD40-like Beta Propeller Repeat; InterPro: IPR011659 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton] Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG4389 consensus Acetylcholinesterase/Butyrylcholinesterase [Signal transduction mechanisms] Back     alignment and domain information
>PF05990 DUF900: Alpha/beta hydrolase of unknown function (DUF900); InterPro: IPR010297 This domain is associated with proteins of unknown function, which are hydrolase-like Back     alignment and domain information
>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown] Back     alignment and domain information
>KOG2565 consensus Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0294 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton] Back     alignment and domain information
>KOG1963 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only] Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF00450 Peptidase_S10: Serine carboxypeptidase; InterPro: IPR001563 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair] Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] Back     alignment and domain information
>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] Back     alignment and domain information
>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3967 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG0641 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0302 consensus Ribosome Assembly protein [General function prediction only] Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>KOG0269 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0269 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG4328 consensus WD40 protein [Function unknown] Back     alignment and domain information
>PF07082 DUF1350: Protein of unknown function (DUF1350); InterPro: IPR010765 This family consists of several hypothetical proteins from both cyanobacteria and plants Back     alignment and domain information
>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] Back     alignment and domain information
>KOG2182 consensus Hydrolytic enzymes of the alpha/beta hydrolase fold [Posttranslational modification, protein turnover, chaperones; General function prediction only] Back     alignment and domain information
>PRK10252 entF enterobactin synthase subunit F; Provisional Back     alignment and domain information
>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2183 consensus Prolylcarboxypeptidase (angiotensinase C) [Posttranslational modification, protein turnover, chaperones; General function prediction only] Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>COG4782 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF08386 Abhydrolase_4: TAP-like protein; InterPro: IPR013595 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown] Back     alignment and domain information
>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>KOG4328 consensus WD40 protein [Function unknown] Back     alignment and domain information
>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair] Back     alignment and domain information
>PLN03016 sinapoylglucose-malate O-sinapoyltransferase Back     alignment and domain information
>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>COG3319 Thioesterase domains of type I polyketide synthases or non-ribosomal peptide synthetases [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PLN02209 serine carboxypeptidase Back     alignment and domain information
>TIGR03712 acc_sec_asp2 accessory Sec system protein Asp2 Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1282 consensus Serine carboxypeptidases (lysosomal cathepsin A) [Posttranslational modification, protein turnover, chaperones; Amino acid transport and metabolism] Back     alignment and domain information
>COG1075 LipA Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>KOG0302 consensus Ribosome Assembly protein [General function prediction only] Back     alignment and domain information
>KOG4388 consensus Hormone-sensitive lipase HSL [Lipid transport and metabolism] Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1408 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG3724 consensus Negative regulator of COPII vesicle formation [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF05057 DUF676: Putative serine esterase (DUF676); InterPro: IPR007751 This domain, whose function is unknown, is found within a group of putative lipases Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>PRK13614 lipoprotein LpqB; Provisional Back     alignment and domain information
>PF11187 DUF2974: Protein of unknown function (DUF2974); InterPro: IPR024499 This family of proteins has no known function Back     alignment and domain information
>KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton] Back     alignment and domain information
>KOG0270 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG4547 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0294 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>KOG1963 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF02450 LCAT: Lecithin:cholesterol acyltransferase; InterPro: IPR003386 Lecithin:cholesterol acyltransferase (LACT), also known as phosphatidylcholine-sterol acyltransferase (2 Back     alignment and domain information
>KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown] Back     alignment and domain information
>KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1408 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG3621 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair] Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>KOG1551 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG2939 Carboxypeptidase C (cathepsin A) [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13613 lipoprotein LpqB; Provisional Back     alignment and domain information
>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown] Back     alignment and domain information
>KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription] Back     alignment and domain information
>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PRK13615 lipoprotein LpqB; Provisional Back     alignment and domain information
>PRK13613 lipoprotein LpqB; Provisional Back     alignment and domain information
>PF13449 Phytase-like: Esterase-like activity of phytase Back     alignment and domain information
>KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription] Back     alignment and domain information
>KOG2521 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3914 consensus WD repeat protein WDR4 [Function unknown] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown] Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>KOG4532 consensus WD40-like repeat containing protein [General function prediction only] Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>PF01764 Lipase_3: Lipase (class 3); InterPro: IPR002921 Triglyceride lipases are lipolytic enzymes that hydrolyse ester linkages of triglycerides [] Back     alignment and domain information
>KOG2100 consensus Dipeptidyl aminopeptidase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00741 Lipase Lipase Back     alignment and domain information
>smart00824 PKS_TE Thioesterase Back     alignment and domain information
>TIGR03606 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH family Back     alignment and domain information
>PLN02606 palmitoyl-protein thioesterase Back     alignment and domain information
>PF11288 DUF3089: Protein of unknown function (DUF3089); InterPro: IPR021440 This family of proteins has no known function Back     alignment and domain information
>PF02089 Palm_thioest: Palmitoyl protein thioesterase; InterPro: IPR002472 Neuronal ceroid lipofuscinoses (NCL) represent a group of encephalopathies that occur in 1 in 12,500 children Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>PRK13614 lipoprotein LpqB; Provisional Back     alignment and domain information
>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown] Back     alignment and domain information
>PF03088 Str_synth: Strictosidine synthase; InterPro: IPR018119 This entry represents a conserved region found in strictosidine synthase (4 Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>PF03283 PAE: Pectinacetylesterase Back     alignment and domain information
>KOG3914 consensus WD repeat protein WDR4 [Function unknown] Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>PLN02517 phosphatidylcholine-sterol O-acyltransferase Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>KOG0649 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG4287 PqaA PhoPQ-activated pathogenicity-related protein [General function prediction only] Back     alignment and domain information
>KOG0300 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query826
2qzp_A562 Crystal Structure Of Mutation Of An Acylptide Hydro 2e-12
1ve6_A582 Crystal Structure Of An Acylpeptide HydrolaseESTERA 2e-12
2hu8_A582 Binding Of Inhibitors By Acylaminoacyl Peptidase Le 3e-12
3o4j_A582 Structure And Catalysis Of Acylaminoacyl Peptidase 6e-12
3o4h_A582 Structure And Catalysis Of Acylaminoacyl Peptidase 2e-11
3azo_A662 Crystal Structure Of Puromycin Hydrolase Length = 6 2e-11
2qr5_A582 Aeropyrum Pernix Acylaminoacyl Peptidase, H367a Mut 2e-11
2ecf_A741 Crystal Structure Of Dipeptidyl Aminopeptidase Iv F 1e-10
2z3w_A706 Prolyl Tripeptidyl Aminopeptidase Mutant E636a Leng 2e-09
2d5l_A706 Crystal Structure Of Prolyl Tripeptidyl Aminopeptid 2e-09
2dcm_A706 The Crystal Structure Of S603a Mutated Prolyl Tripe 4e-09
2gbc_A730 Native Dpp-Iv (Cd26) From Rat Length = 730 5e-09
1z68_A719 Crystal Structure Of Human Fibroblast Activation Pr 6e-09
1orv_A728 Crystal Structure Of Porcine Dipeptidyl Peptidase I 4e-08
4a5s_A740 Crystal Structure Of Human Dpp4 In Complex With A N 5e-08
3q8w_A732 A B-Aminoacyl Containing Thiazolidine Derivative An 6e-08
3nox_A753 Crystal Structure Of Human Dpp-Iv In Complex With S 6e-08
2g5p_A726 Crystal Structure Of Human Dipeptidyl Peptidase Iv 6e-08
1j2e_A740 Crystal Structure Of Human Dipeptidyl Peptidase Iv 6e-08
2jid_A736 Human Dipeptidyl Peptidase Iv In Complex With 1-(3, 6e-08
1x70_A728 Human Dipeptidyl Peptidase Iv In Complex With A Bet 6e-08
1n1m_A728 Human Dipeptidyl Peptidase IvCD26 IN COMPLEX WITH A 6e-08
2rgu_A734 Crystal Structure Of Complex Of Human Dpp4 And Inhi 6e-08
2bgr_A738 Crystal Structure Of Hiv-1 Tat Derived Nonapeptides 6e-08
1u8e_A728 Human Dipeptidyl Peptidase IvCD26 MUTANT Y547F Leng 6e-08
3ccb_A740 Crystal Structure Of Human Dpp4 In Complex With A B 6e-08
2rip_A729 Structure Of Dppiv In Complex With An Inhibitor Len 6e-08
1pfq_A731 Crystal Structure Of Human Apo Dipeptidyl Peptidase 6e-08
3qbj_A748 Crystal Structure Of Dipeptidyl Peptidase Iv In Com 6e-08
1r9n_A739 Crystal Structure Of Human Dipeptidyl Peptidase Iv 6e-08
2qjr_A748 Dipepdyl Peptidase Iv In Complex With Inhibitor Pzf 6e-08
2onc_A731 Crystal Structure Of Human Dpp-4 Length = 731 7e-08
2qt9_A766 Human Dipeptidyl Peptidase IvCD26 IN COMPLEX WITH A 7e-08
1r9m_A733 Crystal Structure Of Human Dipeptidyl Peptidase Iv 7e-08
3azp_A662 Crystal Structure Of Puromycin Hydrolase S511a Muta 2e-07
2bkl_A695 Structural And Mechanistic Analysis Of Two Prolyl E 7e-06
4hvt_A711 Structure Of A Post-Proline Cleaving Enzyme From Ri 1e-04
>pdb|2QZP|A Chain A, Crystal Structure Of Mutation Of An Acylptide HydrolaseESTERASE FROM AEROPYRUM PERNIX K1 Length = 562 Back     alignment and structure 
Iteration: 1

 Score = 71.6 bits (174), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 53/212 (25%), Positives = 89/212 (41%), Gaps = 14/212 (6%)
Query: 593 PLIVVLHGGPHXXXXXXXXXXXXXXXXVGYSLLIVNYRGSLGFGEEALQSLPGKVGSQDV 652
           P +V++HGGP                  G+ +++ NYRGS G+GEE    + G     ++
Sbjct: 341 PTVVLVHGGPFAEDSDSWDTFAASLAAAGFHVVMPNYRGSTGYGEEWRLKIIGDPCGGEL 400
Query: 653 NDVLTAIDHVIDMGLANPSKVTVVGGSHGGFLTTHLIGQAPDKFVAAAARNPLCNLALMV 712
            DV  A     + GLA  S++ ++G S+GG++T   +   P  F A  A           
Sbjct: 401 EDVSAAARWARESGLA--SELYIMGYSYGGYMTLCALTMKPGLFKAGVA----------- 447
Query: 713 GTTDIPDWCYVESYGSKGKDSFTESPSVEDLTRFHSKSPISHISKVKTPTIFLLGAQDLR 772
               + DW  +         +F E  +        S+SPI+H+ ++K P   +    D R
Sbjct: 448 -GASVVDWEEMYELSDAAFRNFIEQLTGGSREIMRSRSPINHVDRIKEPLALIHPQNDSR 506
Query: 773 VPVSNGLQYARALREKGVETKVIVFPNDVHGI 804
            P+   L+    L  +G   +  + P+  H I
Sbjct: 507 TPLKPLLRLMGELLARGKTFEAHIIPDAGHAI 538
>pdb|1VE6|A Chain A, Crystal Structure Of An Acylpeptide HydrolaseESTERASE FROM Aeropyrum Pernix K1 Length = 582 Back     alignment and structure
>pdb|2HU8|A Chain A, Binding Of Inhibitors By Acylaminoacyl Peptidase Length = 582 Back     alignment and structure
>pdb|3O4J|A Chain A, Structure And Catalysis Of Acylaminoacyl Peptidase Length = 582 Back     alignment and structure
>pdb|3O4H|A Chain A, Structure And Catalysis Of Acylaminoacyl Peptidase Length = 582 Back     alignment and structure
>pdb|3AZO|A Chain A, Crystal Structure Of Puromycin Hydrolase Length = 662 Back     alignment and structure
>pdb|2QR5|A Chain A, Aeropyrum Pernix Acylaminoacyl Peptidase, H367a Mutant Length = 582 Back     alignment and structure
>pdb|2ECF|A Chain A, Crystal Structure Of Dipeptidyl Aminopeptidase Iv From Stenotrophomonas Maltophilia Length = 741 Back     alignment and structure
>pdb|2Z3W|A Chain A, Prolyl Tripeptidyl Aminopeptidase Mutant E636a Length = 706 Back     alignment and structure
>pdb|2D5L|A Chain A, Crystal Structure Of Prolyl Tripeptidyl Aminopeptidase From Porphyromonas Gingivalis Length = 706 Back     alignment and structure
>pdb|2DCM|A Chain A, The Crystal Structure Of S603a Mutated Prolyl Tripeptidyl Aminopeptidase Complexed With Substrate Length = 706 Back     alignment and structure
>pdb|2GBC|A Chain A, Native Dpp-Iv (Cd26) From Rat Length = 730 Back     alignment and structure
>pdb|1Z68|A Chain A, Crystal Structure Of Human Fibroblast Activation Protein Alpha Length = 719 Back     alignment and structure
>pdb|1ORV|A Chain A, Crystal Structure Of Porcine Dipeptidyl Peptidase Iv (Cd26) Length = 728 Back     alignment and structure
>pdb|4A5S|A Chain A, Crystal Structure Of Human Dpp4 In Complex With A Noval Heterocyclic Dpp4 Inhibitor Length = 740 Back     alignment and structure
>pdb|3Q8W|A Chain A, A B-Aminoacyl Containing Thiazolidine Derivative And Dppiv Complex Length = 732 Back     alignment and structure
>pdb|3NOX|A Chain A, Crystal Structure Of Human Dpp-Iv In Complex With Sa-(+)-(6- (Aminomethyl)-5-(2,4-Dichlorophenyl)-7-Methylimidazo[1, 2-A]pyrimidin- 2-Yl)(Morpholino)methanone Length = 753 Back     alignment and structure
>pdb|2G5P|A Chain A, Crystal Structure Of Human Dipeptidyl Peptidase Iv (Dppiv) Complexed With Cyanopyrrolidine (C5-Pro-Pro) Inhibitor 21ac Length = 726 Back     alignment and structure
>pdb|1J2E|A Chain A, Crystal Structure Of Human Dipeptidyl Peptidase Iv Length = 740 Back     alignment and structure
>pdb|2JID|A Chain A, Human Dipeptidyl Peptidase Iv In Complex With 1-(3,4- Dimethoxy-Phenyl)-3-M-Tolyl-Piperidine-4-Ylamine Length = 736 Back     alignment and structure
>pdb|1X70|A Chain A, Human Dipeptidyl Peptidase Iv In Complex With A Beta Amino Acid Inhibitor Length = 728 Back     alignment and structure
>pdb|1N1M|A Chain A, Human Dipeptidyl Peptidase IvCD26 IN COMPLEX WITH AN INHIBITOR Length = 728 Back     alignment and structure
>pdb|2RGU|A Chain A, Crystal Structure Of Complex Of Human Dpp4 And Inhibitor Length = 734 Back     alignment and structure
>pdb|2BGR|A Chain A, Crystal Structure Of Hiv-1 Tat Derived Nonapeptides Tat(1-9) Bound To The Active Site Of Dipeptidyl Peptidase Iv (Cd26) Length = 738 Back     alignment and structure
>pdb|1U8E|A Chain A, Human Dipeptidyl Peptidase IvCD26 MUTANT Y547F Length = 728 Back     alignment and structure
>pdb|3CCB|A Chain A, Crystal Structure Of Human Dpp4 In Complex With A Benzimidazole Derivative Length = 740 Back     alignment and structure
>pdb|2RIP|A Chain A, Structure Of Dppiv In Complex With An Inhibitor Length = 729 Back     alignment and structure
>pdb|1PFQ|A Chain A, Crystal Structure Of Human Apo Dipeptidyl Peptidase Iv / Cd26 Length = 731 Back     alignment and structure
>pdb|3QBJ|A Chain A, Crystal Structure Of Dipeptidyl Peptidase Iv In Complex With Inhibitor Length = 748 Back     alignment and structure
>pdb|1R9N|A Chain A, Crystal Structure Of Human Dipeptidyl Peptidase Iv In Complex With A Decapeptide (Tnpy) At 2.3 Ang. Resolution Length = 739 Back     alignment and structure
>pdb|2QJR|A Chain A, Dipepdyl Peptidase Iv In Complex With Inhibitor Pzf Length = 748 Back     alignment and structure
>pdb|2ONC|A Chain A, Crystal Structure Of Human Dpp-4 Length = 731 Back     alignment and structure
>pdb|2QT9|A Chain A, Human Dipeptidyl Peptidase IvCD26 IN COMPLEX WITH A 4-Aryl Cyclohexylalanine Inhibitor Length = 766 Back     alignment and structure
>pdb|1R9M|A Chain A, Crystal Structure Of Human Dipeptidyl Peptidase Iv At 2.1 Ang. Resolution. Length = 733 Back     alignment and structure
>pdb|3AZP|A Chain A, Crystal Structure Of Puromycin Hydrolase S511a Mutant Length = 662 Back     alignment and structure
>pdb|2BKL|A Chain A, Structural And Mechanistic Analysis Of Two Prolyl Endopeptidases: Role Of Inter-Domain Dynamics In Catalysis And Specificity Length = 695 Back     alignment and structure
>pdb|4HVT|A Chain A, Structure Of A Post-Proline Cleaving Enzyme From Rickettsia Typhi Length = 711 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query826
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 3e-66
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 9e-63
1l7a_A318 Cephalosporin C deacetylase; structural genomics, 3e-35
3ksr_A290 Putative serine hydrolase; catalytic triad, struct 1e-32
3fcy_A346 Xylan esterase 1; alpha/beta hydrolase, carbohydra 1e-28
1vlq_A337 Acetyl xylan esterase; TM0077, structural genomics 8e-26
3hlk_A446 Acyl-coenzyme A thioesterase 2, mitochondrial; alp 5e-21
3k2i_A422 Acyl-coenzyme A thioesterase 4; alpha/beta hydrola 3e-19
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 1e-18
4a5s_A740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 1e-18
1z68_A719 Fibroblast activation protein, alpha subunit; sepr 2e-18
3fnb_A405 Acylaminoacyl peptidase SMU_737; alpha-beta-alpha 2e-18
3bxp_A277 Putative lipase/esterase; putative carboxylesteras 1e-17
3hxk_A276 Sugar hydrolase; alpha-beta protein., structural g 3e-17
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 1e-16
3doh_A380 Esterase; alpha-beta hydrolase, beta sheet; 2.60A 1e-16
1xfd_A723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 3e-16
2jbw_A386 Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine 4e-16
1ufo_A238 Hypothetical protein TT1662; alpha-beta fold, hydr 5e-16
3bjr_A283 Putative carboxylesterase; structural genomics, jo 5e-16
2wtm_A251 EST1E; hydrolase; 1.60A {Clostridium proteoclastic 8e-16
3mve_A415 FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/ 2e-14
1vkh_A273 Putative serine hydrolase; structural genomics, jo 8e-14
2pbl_A262 Putative esterase/lipase/thioesterase; alpha/beta- 2e-13
1tht_A305 Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1. 2e-12
4e15_A303 Kynurenine formamidase; alpha/beta hydrolase fold, 3e-12
2o2g_A223 Dienelactone hydrolase; YP_324580.1, structural ge 4e-12
3h04_A275 Uncharacterized protein; protein with unknown func 9e-11
2ocg_A254 Valacyclovir hydrolase; alpha beta hydrolase fold; 1e-10
3pfb_A270 Cinnamoyl esterase; alpha/beta hydrolase fold, hyd 9e-10
2qru_A274 Uncharacterized protein; alpha/beta-hydrolase, str 8e-09
3rm3_A270 MGLP, thermostable monoacylglycerol lipase; alpha/ 1e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-06
3dkr_A251 Esterase D; alpha beta hydrolase, mechanism, catal 7e-08
3f67_A241 Putative dienelactone hydrolase; alpha-beta-alpha 2e-07
3e0x_A245 Lipase-esterase related protein; APC60309, clostri 6e-07
4ao6_A259 Esterase; hydrolase, thermo label; 1.60A {Unidenti 4e-06
1u2e_A289 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase 6e-06
3llc_A270 Putative hydrolase; structural genomics, joint cen 7e-06
3g8y_A391 SUSD/RAGB-associated esterase-like protein; struct 8e-06
1tqh_A247 Carboxylesterase precursor; tetrahedral intermedia 1e-05
2hdw_A367 Hypothetical protein PA2218; alpha/beta hydrolase 1e-05
3fak_A322 Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Unc 2e-05
3vis_A306 Esterase; alpha/beta-hydrolase fold, polyethylene 3e-05
3k6k_A322 Esterase/lipase; alpha/beta hydrolase fold; 2.20A 7e-05
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 2e-04
2wue_A291 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolas 2e-04
1xkl_A273 SABP2, salicylic acid-binding protein 2; alpha-bet 2e-04
2puj_A286 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; 2e-04
4ezi_A377 Uncharacterized protein; alpha-beta hydrolases fol 2e-04
2qjw_A176 Uncharacterized protein XCC1541; putative hydrolas 3e-04
2xe4_A751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 3e-04
2wfl_A264 Polyneuridine-aldehyde esterase; alkaloid metaboli 3e-04
1iup_A282 META-cleavage product hydrolase; aromatic compound 4e-04
1k32_A 1045 Tricorn protease; protein degradation, substrate g 6e-04
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 6e-04
3r0v_A262 Alpha/beta hydrolase fold protein; structural geno 7e-04
1imj_A210 CIB, CCG1-interacting factor B; alpha/beta hydrola 7e-04
3nuz_A398 Putative acetyl xylan esterase; structural genomic 8e-04
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Length = 582 Back     alignment and structure
 Score =  230 bits (588), Expect = 3e-66
 Identities = 105/681 (15%), Positives = 205/681 (30%), Gaps = 138/681 (20%)

Query: 158 AVVPSPSGSKLLVVRNPENESPIQFELWSQSQLEKEFHVPQTVHGSVYADGWFEGISWNS 217
           ++     G KLLVV   E        L+   +  K    P                    
Sbjct: 26  SLQGVVDGDKLLVVGFSEGSVNAY--LYDGGETVKLNREPINSVL----------DPHYG 73

Query: 218 DETLIAYVAEEPSPSKPTFSLGSTKGGSSDKDCNSWKGQ--GDWEED-WGETYAGKRQPS 274
              +I          +      +T     ++   + K        +      + G  +  
Sbjct: 74  VGRVILVRDVSKGAEQHALFKVNTSRPGEEQRLEAVKPMRILSGVDTGEAVVFTGATEDR 133

Query: 275 LFVININSGEVQAVKGIPKSLSVGQVVWAPLNEGLHQYLVFVGWSSETRKLGIKYCYNRP 334
           + +  ++ G ++            ++   P          FV         G+ +     
Sbjct: 134 VALYALDGGGLR------------ELARLP-------GFGFVSDIRGDLIAGLGFFGGGR 174

Query: 335 CALYAVRVSLYKSEASELELKESSSEDLPVVNLTESISSAFFPRFSPDGKFLVFLSAKSS 394
            +L+   +      +  L +                  S      SP  K    L     
Sbjct: 175 VSLFTSNL-----SSGGLRV------------FDSGEGSFSSASISPGMKVTAGLE---- 213

Query: 395 VDSGAHSATDSLHRIDWPTNGNFSSLEKIVDVIPVVQCAEGDCFPGLYSSSILSNPWLSD 454
                 +    L  +D                +  ++    D F     ++I    +L D
Sbjct: 214 -----TAREARLVTVDPRDGS-----------VEDLELPSKD-FSSYRPTAITWLGYLPD 256

Query: 455 GCTMLLSSIWGSSQVIISVNVSSGELLRITPAESNFSWSLLTLDGDNIIAVSSSPVDVPQ 514
           G   +++   G S V I      GE +         +   + L    ++   +S    P+
Sbjct: 257 GRLAVVARREGRSAVFID-----GERVEAPQG----NHGRVVLWRGKLVTSHTSLSTPPR 307

Query: 515 VKYGYFVDKANKGTWSWLNVSSPISRCPEKVKSLLSSRQFSIMK-IPVKG-----VSANL 568
           +     +          L    P              R  +  + + V+      V   +
Sbjct: 308 I---VSLPSGEP----LLEGGLP----------EDLRRSIAGSRLVWVESFDGSRVPTYV 350

Query: 569 TK--GAQKPFEAIFVSSSHKKDCSCDPLIVVLHGGPHSVSLSSYSKSLAFLSSVGYSLLI 626
            +   A  P                 P +V++HGGP +    S+    A L++ G+ +++
Sbjct: 351 LESGRAPTPG----------------PTVVLVHGGPFAEDSDSWDTFAASLAAAGFHVVM 394

Query: 627 VNYRGSLGFGEEALQSLPGKVGSQDVNDVLTAIDHVIDMGLANPSKVTVVGGSHGGFLTT 686
            NYRGS G+GEE    + G     ++ DV  A     + GLA+  ++ ++G S+GG++T 
Sbjct: 395 PNYRGSTGYGEEWRLKIIGDPCGGELEDVSAAARWARESGLAS--ELYIMGYSYGGYMTL 452

Query: 687 HLIGQAPDKFVAAAARNPLCNLALMVGTTDIPDWCYVES-YGSKGKDSFTESPSVEDLTR 745
             +   P  F A  A   + +   M   +D     ++E   G                  
Sbjct: 453 CALTMKPGLFKAGVAGASVVDWEEMYELSDAAFRNFIEQLTG-------------GSREI 499

Query: 746 FHSKSPISHISKVKTPTIFLLGAQDLRVPVSNGLQYARALREKGVETKVIVFPNDVHGIE 805
             S+SPI+H+ ++K P   +      R P+   L+    L  +G   +  + P+  H I 
Sbjct: 500 MRSRSPINHVDRIKEPLALIHPQNASRTPLKPLLRLMGELLARGKTFEAHIIPDAGHAIN 559

Query: 806 RPQSDFESFLNIGLWFKKYCK 826
             +   +  L    +     +
Sbjct: 560 TMEDAVKILLPAVFFLATQRE 580
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Length = 662 Back     alignment and structure
>1l7a_A Cephalosporin C deacetylase; structural genomics, alpha-beta-alpha sandwich, PSI, protein structure initiative; 1.50A {Bacillus subtilis} SCOP: c.69.1.25 PDB: 1odt_C 1ods_A 3fvt_A 3fvr_A 3fyu_A* 2xlb_A 2xlc_A 3fyt_A* 3fyu_B* Length = 318 Back     alignment and structure
>3ksr_A Putative serine hydrolase; catalytic triad, structural genomics, JOIN for structural genomics, JCSG; 2.69A {Xanthomonas campestris PV} Length = 290 Back     alignment and structure
>3fcy_A Xylan esterase 1; alpha/beta hydrolase, carbohydrate esterase, CE7; 2.10A {Thermoanaerobacterium SP} Length = 346 Back     alignment and structure
>1vlq_A Acetyl xylan esterase; TM0077, structural genomics, JCSG, PR structure initiative, PSI, joint center for structural GENO hydrolase; 2.10A {Thermotoga maritima} SCOP: c.69.1.25 PDB: 3m81_A 3m83_A* 3m82_A* Length = 337 Back     alignment and structure
>3hlk_A Acyl-coenzyme A thioesterase 2, mitochondrial; alpha/beta hydrolase, alternative splicing, hydrolase, mitochondrion, polymorphism, serine esterase; 2.10A {Homo sapiens} Length = 446 Back     alignment and structure
>3k2i_A Acyl-coenzyme A thioesterase 4; alpha/beta hydrolase fold seven-stranded beta-sandwich, structural genomics, structural genomics consortium, SGC; 2.40A {Homo sapiens} Length = 422 Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Length = 706 Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Length = 740 Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Length = 719 Back     alignment and structure
>3fnb_A Acylaminoacyl peptidase SMU_737; alpha-beta-alpha sandwich, helix bundle, structural genomics protein structure initiative; HET: PGE; 2.12A {Streptococcus mutans} Length = 405 Back     alignment and structure
>3bxp_A Putative lipase/esterase; putative carboxylesterase, structural genomics, joint center structural genomics, JCSG; HET: EPE; 1.70A {Lactobacillus plantarum WCFS1} PDB: 3d3n_A* Length = 277 Back     alignment and structure
>3hxk_A Sugar hydrolase; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.20A {Lactococcus lactis subsp} Length = 276 Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Length = 741 Back     alignment and structure
>3doh_A Esterase; alpha-beta hydrolase, beta sheet; 2.60A {Thermotoga maritima} PDB: 3doi_A Length = 380 Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Length = 723 Back     alignment and structure
>2jbw_A Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine hydrolase; alpha/beta hydrolase, META-cleavage pathway; 2.1A {Arthrobacter nicotinovorans} SCOP: c.69.1.41 Length = 386 Back     alignment and structure
>1ufo_A Hypothetical protein TT1662; alpha-beta fold, hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.60A {Thermus thermophilus} SCOP: c.69.1.27 Length = 238 Back     alignment and structure
>3bjr_A Putative carboxylesterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.09A {Lactobacillus plantarum WCFS1} Length = 283 Back     alignment and structure
>2wtm_A EST1E; hydrolase; 1.60A {Clostridium proteoclasticum} PDB: 2wtn_A* Length = 251 Back     alignment and structure
>3mve_A FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/respiration switch protein, hydrolase ACTI lyase; 2.20A {Vibrio vulnificus} PDB: 3our_A Length = 415 Back     alignment and structure
>1vkh_A Putative serine hydrolase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.85A {Saccharomyces cerevisiae} SCOP: c.69.1.32 Length = 273 Back     alignment and structure
>2pbl_A Putative esterase/lipase/thioesterase; alpha/beta-hydrolases fold, structural genomics, joint cente structural genomics, JCSG; 1.79A {Silicibacter SP} SCOP: c.69.1.2 Length = 262 Back     alignment and structure
>1tht_A Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.13 Length = 305 Back     alignment and structure
>4e15_A Kynurenine formamidase; alpha/beta hydrolase fold, hydrolase-hydrolase inhibitor COM; HET: SEB; 1.50A {Drosophila melanogaster} PDB: 4e14_A* 4e11_A Length = 303 Back     alignment and structure
>2o2g_A Dienelactone hydrolase; YP_324580.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.92A {Anabaena variabilis} Length = 223 Back     alignment and structure
>3h04_A Uncharacterized protein; protein with unknown function, structural genomics, MCSG, PS protein structure initiative; 1.90A {Staphylococcus aureus subsp} Length = 275 Back     alignment and structure
>2ocg_A Valacyclovir hydrolase; alpha beta hydrolase fold; 1.75A {Homo sapiens} PDB: 2oci_A* 2ock_A 2ocl_A Length = 254 Back     alignment and structure
>3pfb_A Cinnamoyl esterase; alpha/beta hydrolase fold, hydrolase, cinnamoyl/Fe esterase, hydroxycinammates, extracellular; HET: ZYC; 1.58A {Lactobacillus johnsonii} PDB: 3pf9_A* 3pfc_A* 3s2z_A* 3pf8_A 3qm1_A* Length = 270 Back     alignment and structure
>2qru_A Uncharacterized protein; alpha/beta-hydrolase, structural GENO PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.65A {Enterococcus faecalis} Length = 274 Back     alignment and structure
>3rm3_A MGLP, thermostable monoacylglycerol lipase; alpha/beta hydrolase fold, hydrolase; 1.20A {Bacillus SP} Length = 270 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3dkr_A Esterase D; alpha beta hydrolase, mechanism, catalytic triad, rotation; 1.60A {Lactobacillus rhamnosus} PDB: 3dlt_A 3dyi_A 3dyv_A 3e1g_A Length = 251 Back     alignment and structure
>3f67_A Putative dienelactone hydrolase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 1.74A {Klebsiella pneumoniae subsp} Length = 241 Back     alignment and structure
>3e0x_A Lipase-esterase related protein; APC60309, clostridium acetobutylicum ATCC 824, structural genomics, PSI-2; HET: MSE; 1.45A {Clostridium acetobutylicum} Length = 245 Back     alignment and structure
>4ao6_A Esterase; hydrolase, thermo label; 1.60A {Unidentified} PDB: 4ao7_A 4ao8_A Length = 259 Back     alignment and structure
>1u2e_A 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase; alpha/beta hydrolase fold; 2.10A {Escherichia coli} Length = 289 Back     alignment and structure
>3llc_A Putative hydrolase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE PG4; 1.80A {Agrobacterium vitis} Length = 270 Back     alignment and structure
>3g8y_A SUSD/RAGB-associated esterase-like protein; structural genom joint center for structural genomics, JCSG; HET: MSE; 1.90A {Bacteroides vulgatus atcc 8482} Length = 391 Back     alignment and structure
>1tqh_A Carboxylesterase precursor; tetrahedral intermediate, alpha/beta hydrolase; 1.63A {Geobacillus stearothermophilus} SCOP: c.69.1.29 PDB: 1r1d_A* 4diu_A Length = 247 Back     alignment and structure
>2hdw_A Hypothetical protein PA2218; alpha/beta hydrolase fold, structural genomics, PSI, structure initiative; 2.00A {Pseudomonas aeruginosa} Length = 367 Back     alignment and structure
>3fak_A Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Uncultured bacterium} PDB: 3g9t_A 3g9u_A 3g9z_A 3h17_A* 3h18_A* 3h19_A 3h1a_A 3h1b_A 3l1h_A 3l1i_A 3l1j_A 3v9a_A Length = 322 Back     alignment and structure
>3vis_A Esterase; alpha/beta-hydrolase fold, polyethylene terephthal hydrolase; HET: PE4; 1.76A {Thermobifida alba} Length = 306 Back     alignment and structure
>3k6k_A Esterase/lipase; alpha/beta hydrolase fold; 2.20A {Uncultured bacterium} PDB: 3dnm_A Length = 322 Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Length = 347 Back     alignment and structure
>2wue_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolase BPHD; HET: KEK; 1.80A {Mycobacterium tuberculosis} PDB: 2wud_A* 2wuf_A* 2wug_A* 2vf2_A Length = 291 Back     alignment and structure
>1xkl_A SABP2, salicylic acid-binding protein 2; alpha-beta protein, structural genomics, protein structure initiative, PSI; HET: STH; 2.00A {Nicotiana tabacum} SCOP: c.69.1.20 PDB: 1y7i_A* 1y7h_A* Length = 273 Back     alignment and structure
>2puj_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; C-C bond hydrolase, hydrolase; HET: HPZ; 1.57A {Burkholderia xenovorans} PDB: 2pu7_A* 3v1m_A* 3v1l_A* 2puh_A* 3v1n_A* 3v1k_A* 2og1_A 2pu5_A 2rhw_A* 2rht_A* 2ri6_A Length = 286 Back     alignment and structure
>4ezi_A Uncharacterized protein; alpha-beta hydrolases fold, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.15A {Legionella pneumophila subsp} Length = 377 Back     alignment and structure
>2qjw_A Uncharacterized protein XCC1541; putative hydrolase of the alpha/beta superfamily, structural genomics; HET: MSE TLA P6G; 1.35A {Xanthomonas campestris PV} Length = 176 Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Length = 751 Back     alignment and structure
>2wfl_A Polyneuridine-aldehyde esterase; alkaloid metabolism, monoterpenoid indole alkaloids, PNAE, hydrolase, serine esterase; HET: CME; 2.10A {Rauvolfia serpentina} PDB: 2wfm_A 3gzj_A* Length = 264 Back     alignment and structure
>1iup_A META-cleavage product hydrolase; aromatic compounds, cumene, isopropylbenzene, META-cleavage compound hydrolase; 1.60A {Pseudomonas fluorescens} SCOP: c.69.1.10 PDB: 1iun_A 1iuo_A 1uk6_A 1uk7_A 1uk8_A 1uk9_A 1uka_A 1ukb_A 2d0d_A Length = 282 Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Length = 1045 Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Length = 710 Back     alignment and structure
>3r0v_A Alpha/beta hydrolase fold protein; structural genomics, PSI-biology, protein structure initiati alpha/beta hydrolase; HET: MSE; 1.38A {Sphaerobacter thermophilus} Length = 262 Back     alignment and structure
>1imj_A CIB, CCG1-interacting factor B; alpha/beta hydrolase, CCG1 interactor; 2.20A {Homo sapiens} SCOP: c.69.1.23 Length = 210 Back     alignment and structure
>3nuz_A Putative acetyl xylan esterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology; 2.30A {Bacteroides fragilis} Length = 398 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query826
4a5s_A740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 100.0
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 100.0
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 100.0
1xfd_A723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 100.0
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 100.0
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 100.0
1z68_A719 Fibroblast activation protein, alpha subunit; sepr 100.0
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 100.0
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 100.0
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 100.0
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 100.0
2xe4_A751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 100.0
4hvt_A711 Ritya.17583.B, post-proline cleaving enzyme; ssgci 100.0
4ao6_A259 Esterase; hydrolase, thermo label; 1.60A {Unidenti 99.92
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.91
3hxk_A276 Sugar hydrolase; alpha-beta protein., structural g 99.91
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 99.91
3f67_A241 Putative dienelactone hydrolase; alpha-beta-alpha 99.9
2wtm_A251 EST1E; hydrolase; 1.60A {Clostridium proteoclastic 99.9
3bxp_A277 Putative lipase/esterase; putative carboxylesteras 99.9
2jbw_A386 Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine 99.89
3k2i_A422 Acyl-coenzyme A thioesterase 4; alpha/beta hydrola 99.89
3doh_A380 Esterase; alpha-beta hydrolase, beta sheet; 2.60A 99.89
1vlq_A337 Acetyl xylan esterase; TM0077, structural genomics 99.89
3bjr_A283 Putative carboxylesterase; structural genomics, jo 99.88
3hlk_A446 Acyl-coenzyme A thioesterase 2, mitochondrial; alp 99.88
3ebl_A365 Gibberellin receptor GID1; alpha/beta hydrolase, l 99.88
3pfb_A270 Cinnamoyl esterase; alpha/beta hydrolase fold, hyd 99.88
2i3d_A249 AGR_C_3351P, hypothetical protein ATU1826; structu 99.88
2o2g_A223 Dienelactone hydrolase; YP_324580.1, structural ge 99.88
1zi8_A236 Carboxymethylenebutenolidase; alpha and beta prote 99.88
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 99.88
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.88
4a5s_A740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.87
3ga7_A326 Acetyl esterase; phosphoserine, IDP00896, hydrolas 99.87
3fak_A322 Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Unc 99.87
4fbl_A281 LIPS lipolytic enzyme; thermostable, structural ge 99.87
1l7a_A318 Cephalosporin C deacetylase; structural genomics, 99.87
3fcy_A346 Xylan esterase 1; alpha/beta hydrolase, carbohydra 99.87
3ksr_A290 Putative serine hydrolase; catalytic triad, struct 99.87
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.86
2hdw_A367 Hypothetical protein PA2218; alpha/beta hydrolase 99.86
3trd_A208 Alpha/beta hydrolase; cellular processes; 1.50A {C 99.86
2zsh_A351 Probable gibberellin receptor GID1L1; plant hormon 99.86
1mpx_A 615 Alpha-amino acid ester hydrolase; alpha/beta hydro 99.86
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 99.85
3hju_A342 Monoglyceride lipase; alpha/beta hydrolase, hydrol 99.85
3pe6_A303 Monoglyceride lipase; alpha-beta hydrolase fold, 2 99.85
3fcx_A282 FGH, esterase D, S-formylglutathione hydrolase; re 99.85
2b9v_A 652 Alpha-amino acid ester hydrolase; catalytic triad, 99.85
3vis_A306 Esterase; alpha/beta-hydrolase fold, polyethylene 99.85
1jfr_A262 Lipase; serine hydrolase; 1.90A {Streptomyces exfo 99.85
3i6y_A280 Esterase APC40077; lipase, structural genomics, PS 99.85
3h04_A275 Uncharacterized protein; protein with unknown func 99.85
2hm7_A310 Carboxylesterase; alpha/beta hydrolase fold, hydro 99.85
2fuk_A220 XC6422 protein; A/B hydrolase, structural genomics 99.85
1vkh_A273 Putative serine hydrolase; structural genomics, jo 99.84
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 99.84
1lzl_A323 Heroin esterase; alpha/beta hydrolase; 1.30A {Rhod 99.84
4e15_A303 Kynurenine formamidase; alpha/beta hydrolase fold, 99.84
3llc_A270 Putative hydrolase; structural genomics, joint cen 99.84
3k6k_A322 Esterase/lipase; alpha/beta hydrolase fold; 2.20A 99.84
1xfd_A723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.84
2wir_A313 Pesta, alpha/beta hydrolase fold-3 domain protein; 99.84
3ain_A323 303AA long hypothetical esterase; carboxylesterase 99.84
3ls2_A280 S-formylglutathione hydrolase; psychrophilic organ 99.84
2o7r_A338 CXE carboxylesterase; alpha/beta hydrolase; 1.40A 99.84
3fnb_A405 Acylaminoacyl peptidase SMU_737; alpha-beta-alpha 99.84
3qh4_A317 Esterase LIPW; structural genomics, ssgcid, seattl 99.84
3e4d_A278 Esterase D; S-formylglutathione hydrolase, hydrola 99.83
4h0c_A210 Phospholipase/carboxylesterase; PSI-biology, midwe 99.83
2c7b_A311 Carboxylesterase, ESTE1; carboxyesterase, thermoph 99.83
1jkm_A361 Brefeldin A esterase; serine hydrolase, degradatio 99.83
1ufo_A238 Hypothetical protein TT1662; alpha-beta fold, hydr 99.83
3og9_A209 Protein YAHD A copper inducible hydrolase; alpha/b 99.83
1fj2_A232 Protein (acyl protein thioesterase 1); alpha/beta 99.83
1lns_A 763 X-prolyl dipeptidyl aminopetidase; alpha beta hydr 99.82
3dkr_A251 Esterase D; alpha beta hydrolase, mechanism, catal 99.82
1z68_A719 Fibroblast activation protein, alpha subunit; sepr 99.82
2pbl_A262 Putative esterase/lipase/thioesterase; alpha/beta- 99.82
3bdi_A207 Uncharacterized protein TA0194; NP_393672.1, predi 99.82
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.81
1auo_A218 Carboxylesterase; hydrolase; 1.80A {Pseudomonas fl 99.81
4f0j_A315 Probable hydrolytic enzyme; alpha/beta hydrolase f 99.81
3cn9_A226 Carboxylesterase; alpha/beta hydrolase fold super- 99.81
3rm3_A270 MGLP, thermostable monoacylglycerol lipase; alpha/ 99.81
3d7r_A326 Esterase; alpha/beta fold, hydrolase; 2.01A {Staph 99.81
2uz0_A263 Esterase, tributyrin esterase; alpha/beta hydrolas 99.8
4b6g_A283 Putative esterase; hydrolase, formaldehyde detoxif 99.8
1k32_A 1045 Tricorn protease; protein degradation, substrate g 99.8
4fhz_A285 Phospholipase/carboxylesterase; alpha/beta hydrola 99.8
1jjf_A268 Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-x 99.8
3b5e_A223 MLL8374 protein; NP_108484.1, carboxylesterase, st 99.8
2h1i_A226 Carboxylesterase; structural genomics, PSI-2, prot 99.79
3u0v_A239 Lysophospholipase-like protein 1; alpha, beta hydr 99.79
3mve_A415 FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/ 99.79
1k8q_A377 Triacylglycerol lipase, gastric; APHA beta hydrola 99.79
1jji_A311 Carboxylesterase; alpha-beta hydrolase fold, hydro 99.79
3d0k_A304 Putative poly(3-hydroxybutyrate) depolymerase LPQ; 99.79
2r8b_A251 AGR_C_4453P, uncharacterized protein ATU2452; APC6 99.79
2qjw_A176 Uncharacterized protein XCC1541; putative hydrolas 99.79
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 99.78
4ezi_A377 Uncharacterized protein; alpha-beta hydrolases fol 99.78
2y6u_A398 Peroxisomal membrane protein LPX1; hydrolase, puta 99.78
2fx5_A258 Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pse 99.78
1imj_A210 CIB, CCG1-interacting factor B; alpha/beta hydrola 99.77
1tht_A305 Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1. 99.77
3r0v_A262 Alpha/beta hydrolase fold protein; structural geno 99.77
3ia2_A271 Arylesterase; alpha-beta hydrolase fold, transitio 99.77
1qlw_A328 Esterase; anisotropic refinement, atomic resolutio 99.77
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.76
2qru_A274 Uncharacterized protein; alpha/beta-hydrolase, str 99.76
2pl5_A366 Homoserine O-acetyltransferase; alpha/beta hydrola 99.76
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.75
3kxp_A314 Alpha-(N-acetylaminomethylene)succinic acid hydrol 99.75
3v48_A268 Aminohydrolase, putative aminoacrylate hydrolase R 99.75
3fob_A281 Bromoperoxidase; structural genomics, IDP00046, ba 99.75
1brt_A277 Bromoperoxidase A2; haloperoxidase, oxidoreductase 99.75
1a88_A275 Chloroperoxidase L; haloperoxidase, oxidoreductase 99.75
3sty_A267 Methylketone synthase 1; alpha/beta hydrolase, dec 99.75
1tqh_A247 Carboxylesterase precursor; tetrahedral intermedia 99.75
1a8s_A273 Chloroperoxidase F; haloperoxidase, oxidoreductase 99.75
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.75
4fle_A202 Esterase; structural genomics, PSI-biology, northe 99.75
1zoi_A276 Esterase; alpha/beta hydrolase fold; 1.60A {Pseudo 99.75
1a8q_A274 Bromoperoxidase A1; haloperoxidase, oxidoreductase 99.75
1sfr_A304 Antigen 85-A; alpha/beta hydrolase, structural gen 99.75
3dqz_A258 Alpha-hydroxynitrIle lyase-like protein; A/B-hydrl 99.74
1q0r_A298 RDMC, aclacinomycin methylesterase; anthracycline, 99.74
3iii_A 560 COCE/NOND family hydrolase; structural genomics, c 99.74
2yys_A286 Proline iminopeptidase-related protein; TTHA1809, 99.74
3vdx_A 456 Designed 16NM tetrahedral protein CAGE containing 99.74
3i2k_A 587 Cocaine esterase; alpha/beta hydrolase, hydrolase; 99.74
3u1t_A309 DMMA haloalkane dehalogenase; alpha/beta-hydrolase 99.74
3om8_A266 Probable hydrolase; structural genomics, PSI-2, pr 99.74
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.74
2ocg_A254 Valacyclovir hydrolase; alpha beta hydrolase fold; 99.73
4f21_A246 Carboxylesterase/phospholipase family protein; str 99.73
3nwo_A330 PIP, proline iminopeptidase; structural genomics, 99.73
2puj_A286 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; 99.73
3qvm_A282 OLEI00960; structural genomics, PSI-biology, midwe 99.73
4dnp_A269 DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petu 99.73
3qit_A286 CURM TE, polyketide synthase; thioesterase, alpha/ 99.73
2r11_A306 Carboxylesterase NP; 2632844, putative hydrolase, 99.73
2xua_A266 PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, cate 99.73
1mtz_A293 Proline iminopeptidase; alpha-beta hydrolase, CAP 99.73
1r88_A280 MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBP 99.73
1iup_A282 META-cleavage product hydrolase; aromatic compound 99.73
1k32_A 1045 Tricorn protease; protein degradation, substrate g 99.73
3fsg_A272 Alpha/beta superfamily hydrolase; PF00561, MCSG, P 99.72
1c4x_A285 BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-di 99.72
3oos_A278 Alpha/beta hydrolase family protein; APC67239.0, p 99.72
3i1i_A377 Homoserine O-acetyltransferase; structural genomic 99.72
3d59_A383 Platelet-activating factor acetylhydrolase; secret 99.72
2qm0_A275 BES; alpha-beta structure, structural genomics, PS 99.72
2wue_A291 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolas 99.71
1hkh_A279 Gamma lactamase; hydrolase, alpha/beta hydrolase, 99.71
1gkl_A297 Endo-1,4-beta-xylanase Y; hydrolase, esterase fami 99.71
2qs9_A194 Retinoblastoma-binding protein 9; B5T overexpresse 99.71
3hss_A293 Putative bromoperoxidase; alpha beta hydrolase, ox 99.71
3h2g_A397 Esterase; xanthomonas oryzae PV. oryzae, cell WALL 99.71
3g8y_A391 SUSD/RAGB-associated esterase-like protein; struct 99.71
3e0x_A245 Lipase-esterase related protein; APC60309, clostri 99.7
3bf7_A255 Esterase YBFF; thioesterase, helical CAP, hydrolas 99.7
3r40_A306 Fluoroacetate dehalogenase; FACD, defluorinase, al 99.7
1u2e_A289 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase 99.7
1j1i_A296 META cleavage compound hydrolase; carbazole degrad 99.7
2b61_A377 Homoserine O-acetyltransferase; acyl-enzyme, aspar 99.69
2wfl_A264 Polyneuridine-aldehyde esterase; alkaloid metaboli 99.69
3nuz_A398 Putative acetyl xylan esterase; structural genomic 99.69
2xt0_A297 Haloalkane dehalogenase; hydrolase, alpha-beta hyd 99.69
3p2m_A330 Possible hydrolase; alpha/beta hydrolase superfami 99.69
1b6g_A310 Haloalkane dehalogenase; hydrolase, alpha/beta-hyd 99.69
3g9x_A299 Haloalkane dehalogenase; alpha/beta hydrolase, hel 99.69
4g9e_A279 AHL-lactonase, alpha/beta hydrolase fold protein; 99.68
1uxo_A192 YDEN protein; hydrolase, A/B hydrolase, esterase, 99.68
3i28_A555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 99.68
3afi_E316 Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 99.68
2e3j_A 356 Epoxide hydrolase EPHB; epoxide hydrolase B, struc 99.68
3bwx_A285 Alpha/beta hydrolase; YP_496220.1, joint center fo 99.68
2xmz_A269 Hydrolase, alpha/beta hydrolase fold family; menaq 99.68
1xkl_A273 SABP2, salicylic acid-binding protein 2; alpha-bet 99.68
1dqz_A280 85C, protein (antigen 85-C); fibronectin, structur 99.67
2vat_A444 Acetyl-COA--deacetylcephalosporin C acetyltransfer 99.67
3guu_A462 Lipase A; protein structure, hydrolase; HET: 1PE; 99.67
2cjp_A328 Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tu 99.67
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.66
1wm1_A317 Proline iminopeptidase; complex with inhibitor, hy 99.66
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 99.66
3c6x_A257 Hydroxynitrilase; atomic resolution, hydroxynitril 99.66
2rau_A354 Putative esterase; NP_343859.1, putative lipase, s 99.66
1wom_A271 RSBQ, sigma factor SIGB regulation protein RSBQ; a 99.66
3kda_A301 CFTR inhibitory factor (CIF); alpha/beta hydrolase 99.66
1ehy_A294 Protein (soluble epoxide hydrolase); alpha/beta hy 99.65
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.65
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 99.65
2qvb_A297 Haloalkane dehalogenase 3; RV2579, alpha-beta hydr 99.65
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 99.65
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 99.65
3fla_A267 RIFR; alpha-beta hydrolase thioesterase, hydrolase 99.65
3bdv_A191 Uncharacterized protein DUF1234; DUF1234 family pr 99.64
1isp_A181 Lipase; alpha/beta hydrolase fold, hydrolase; 1.30 99.64
1mj5_A302 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; 99.63
1azw_A313 Proline iminopeptidase; aminopeptidase, serine pro 99.63
3ibt_A264 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, 99.63
2qmq_A286 Protein NDRG2, protein NDR2; alpha/beta-hydrolases 99.62
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 99.62
1ycd_A243 Hypothetical 27.3 kDa protein in AAP1-SMF2 interge 99.62
3c8d_A403 Enterochelin esterase; alpha-beta-alpha sandwich, 99.62
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.61
1m33_A258 BIOH protein; alpha-betta-alpha sandwich, structur 99.61
2q0x_A335 Protein DUF1749, uncharacterized protein; alpha/be 99.61
1r3d_A264 Conserved hypothetical protein VC1974; structural 99.61
1pja_A302 Palmitoyl-protein thioesterase 2 precursor; hydrol 99.61
2gzs_A278 IROE protein; enterobactin, salmochelin, DFP, hydr 99.6
2psd_A318 Renilla-luciferin 2-monooxygenase; alpha/beta-hydr 99.6
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.6
3l80_A292 Putative uncharacterized protein SMU.1393C; alpha/ 99.6
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 99.59
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 99.58
3b12_A304 Fluoroacetate dehalogenase; dehalogease, hydrolase 99.35
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.57
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.56
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 99.55
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 99.55
2ymu_A577 WD-40 repeat protein; unknown function, two domain 99.53
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.53
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.53
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.53
2xe4_A751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 99.52
2wj6_A276 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxid 99.52
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.52
1qe3_A 489 PNB esterase, para-nitrobenzyl esterase; alpha-bet 99.52
3qmv_A280 Thioesterase, REDJ; alpha/beta hydrolase fold, hyd 99.52
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 99.51
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 99.51
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 99.5
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.5
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 99.5
4i19_A388 Epoxide hydrolase; structural genomics, PSI-biolog 99.5
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.49
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.49
3qyj_A291 ALR0039 protein; alpha/beta fold, hydrolase; 1.78A 99.49
4g56_B357 MGC81050 protein; protein arginine methyltransfera 99.49
2ymu_A577 WD-40 repeat protein; unknown function, two domain 99.48
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 99.48
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 99.48
3ow8_A321 WD repeat-containing protein 61; structural genomi 99.48
3c5v_A316 PME-1, protein phosphatase methylesterase 1; demet 99.46
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 99.46
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.46
3gff_A331 IROE-like serine hydrolase; NP_718593.1, structura 99.46
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.46
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 99.46
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 99.45
3pic_A375 CIP2; alpha/beta hydrolase fold, glucuronoyl ester 99.44
3ow8_A321 WD repeat-containing protein 61; structural genomi 99.44
4g56_B357 MGC81050 protein; protein arginine methyltransfera 99.42
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 99.41
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 99.4
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.4
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 99.4
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 99.4
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 99.4
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 99.4
3fle_A249 SE_1780 protein; structural genomics, APC61035.1, 99.39
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 99.38
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 99.38
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 99.38
4g4g_A433 4-O-methyl-glucuronoyl methylesterase; alpha/beta 99.38
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 99.38
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 99.37
3lcr_A319 Tautomycetin biosynthetic PKS; alpha-beta hydrolas 99.36
2d81_A 318 PHB depolymerase; alpha/beta hydrolase fold, circu 99.36
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 99.35
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 99.35
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 99.35
4fol_A299 FGH, S-formylglutathione hydrolase; D-type esteras 99.35
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.35
3ds8_A254 LIN2722 protein; unkonwn function, structural geno 99.34
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 99.34
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.34
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 99.33
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 99.33
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 99.33
2j04_A588 TAU60, YPL007P, hypothetical protein YPL007C; beta 99.33
3g02_A408 Epoxide hydrolase; alpha/beta hydrolase fold, enan 99.32
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 99.32
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 99.32
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.31
1kez_A300 Erythronolide synthase; polyketide synthase, modul 99.31
2j04_A588 TAU60, YPL007P, hypothetical protein YPL007C; beta 99.31
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 99.31
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 99.31
3lp5_A250 Putative cell surface hydrolase; structural genom 99.31
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 99.3
4e54_B435 DNA damage-binding protein 2; beta barrel, double 99.3
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 99.29
1ukc_A 522 ESTA, esterase; fungi, A/B hydrolase fold, acetylc 99.29
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 99.29
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 99.29
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 99.29
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 99.29
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.28
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 99.28
2k2q_B242 Surfactin synthetase thioesterase subunit; A/B-hyd 99.27
3ils_A265 PKS, aflatoxin biosynthesis polyketide synthase; A 99.26
1tca_A317 Lipase; hydrolase(carboxylic esterase); HET: NAG; 99.26
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 99.26
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 99.26
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 99.26
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 99.25
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 99.25
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 99.24
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 99.24
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 99.24
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.23
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 99.23
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 99.23
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 99.23
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 99.2
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.2
3jrp_A379 Fusion protein of protein transport protein SEC13 99.2
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 99.19
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 99.19
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 99.19
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 99.18
2pm7_B297 Protein transport protein SEC13, protein transport 99.18
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 99.17
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.15
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 99.15
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 99.14
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 99.14
2pm7_B297 Protein transport protein SEC13, protein transport 99.11
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 99.11
2h7c_A 542 Liver carboxylesterase 1; enzyme, cholesteryl este 99.11
1thg_A 544 Lipase; hydrolase(carboxylic esterase); HET: NAG N 99.11
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 99.11
3jrp_A379 Fusion protein of protein transport protein SEC13 99.11
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 99.11
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 99.11
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 99.11
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 99.1
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 99.1
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 99.09
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.08
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 99.08
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 99.07
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 99.07
1ei9_A279 Palmitoyl protein thioesterase 1; alpha/beta hydro 99.07
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 99.06
1llf_A 534 Lipase 3; candida cylindracea cholesterol esterase 99.06
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 99.06
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.04
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 99.03
4e54_B435 DNA damage-binding protein 2; beta barrel, double 99.03
2xyi_A430 Probable histone-binding protein CAF1; transcripti 99.03
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 99.03
2xyi_A430 Probable histone-binding protein CAF1; transcripti 99.03
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 99.02
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 99.02
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 99.02
2ogt_A 498 Thermostable carboxylesterase EST50; alpha/beta hy 99.02
2ha2_A 543 ACHE, acetylcholinesterase; hydrolase fold, serine 99.02
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 99.01
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 99.01
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 99.0
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 99.0
1gpl_A 432 RP2 lipase; serine esterase, hydrolase, lipid degr 98.99
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 98.98
3jro_A 753 Fusion protein of protein transport protein SEC13 98.98
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 98.97
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 98.97
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 98.97
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 98.96
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 98.95
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 98.94
1p0i_A 529 Cholinesterase; serine hydrolase, butyrate, hydrol 98.94
2fj0_A 551 JuvenIle hormone esterase; manduca sexta, alpha-be 98.93
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 98.93
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 98.93
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 98.93
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 98.92
1jmk_C230 SRFTE, surfactin synthetase; thioesterase, non-rib 98.91
1ea5_A 537 ACHE, acetylcholinesterase; hydrolase, serine hydr 98.91
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 98.91
3jro_A 753 Fusion protein of protein transport protein SEC13 98.91
3icv_A316 Lipase B, CALB; circular permutation, cleavage on 98.9
2cb9_A244 Fengycin synthetase; thioesterase, non-ribosomal p 98.9
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 98.89
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 98.89
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 98.88
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 98.88
1dx4_A 585 ACHE, acetylcholinesterase; hydrolase, serine este 98.88
1ex9_A285 Lactonizing lipase; alpha-beta hydrolase fold, pho 98.87
2bce_A 579 Cholesterol esterase; hydrolase, serine esterase, 98.85
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 98.85
3tej_A329 Enterobactin synthase component F; nonribosomal pe 98.84
1ys1_X320 Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor h 98.83
3bix_A 574 Neuroligin-1, neuroligin I; esterase domain, alpha 98.82
1bu8_A 452 Protein (pancreatic lipase related protein 2); hyd 98.82
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 98.82
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 98.8
2x5x_A342 PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE 98.8
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 98.79
1w52_X 452 Pancreatic lipase related protein 2; detergent, cl 98.79
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 98.78
2hfk_A319 Pikromycin, type I polyketide synthase pikaiv; alp 98.76
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 98.76
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 98.75
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 98.75
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 98.74
3n2z_B 446 Lysosomal Pro-X carboxypeptidase; alpha/beta hydro 98.71
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 98.69
2zyr_A 484 Lipase, putative; fatty acid, hydrolase; HET: 1PE; 98.67
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 98.67
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 98.67
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 98.65
1hpl_A 449 Lipase; hydrolase(carboxylic esterase); 2.30A {Equ 98.63
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 98.62
1rp1_A 450 Pancreatic lipase related protein 1; hydrolase, li 98.6
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 98.6
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 98.59
3tjm_A283 Fatty acid synthase; thioesterase domain, fatty ac 98.59
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 98.59
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 98.59
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 98.56
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 98.55
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 98.53
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 98.53
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 98.52
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 98.5
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 98.5
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 98.44
2dst_A131 Hypothetical protein TTHA1544; conserved hypotheti 98.44
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 98.41
2ece_A462 462AA long hypothetical selenium-binding protein; 98.4
2ece_A462 462AA long hypothetical selenium-binding protein; 98.37
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 98.37
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 98.33
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 98.31
2hih_A431 Lipase 46 kDa form; A1 phospholipase, phospholipid 98.29
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 98.23
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 98.22
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 98.21
3v65_B386 Low-density lipoprotein receptor-related protein; 98.19
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 98.19
2dsn_A 387 Thermostable lipase; T1 lipase, hydrolase; 1.50A { 98.19
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 98.14
2p4o_A306 Hypothetical protein; putative lactonase, structur 98.14
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 98.13
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 98.12
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 98.07
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 98.06
3p5b_L400 Low density lipoprotein receptor variant; B-propel 98.05
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 98.03
2qe8_A343 Uncharacterized protein; structural genomics, join 98.03
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 98.02
3v65_B386 Low-density lipoprotein receptor-related protein; 98.02
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 98.01
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 98.01
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 97.93
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 97.87
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 97.86
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 97.86
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 97.85
3p5b_L400 Low density lipoprotein receptor variant; B-propel 97.84
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 97.8
2fp8_A322 Strictosidine synthase; six bladed beta propeller 97.79
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 97.78
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 97.76
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 97.75
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 97.74
4a0p_A628 LRP6, LRP-6, low-density lipoprotein receptor-rela 97.69
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 97.69
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 97.69
1whs_A255 Serine carboxypeptidase II; HET: NAG FUC; 2.00A {T 97.68
4ebb_A 472 Dipeptidyl peptidase 2; hydrolase; HET: MSE NAG; 2 97.65
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 97.62
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 97.61
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 97.59
1ivy_A 452 Human protective protein; carboxypeptidase, serine 97.58
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 97.55
4a0p_A628 LRP6, LRP-6, low-density lipoprotein receptor-rela 97.5
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 97.48
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 97.43
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 97.42
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 97.42
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 97.42
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 97.36
2qe8_A343 Uncharacterized protein; structural genomics, join 97.26
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 97.24
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 97.23
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 97.21
2px6_A316 Thioesterase domain; thioesaterse domain, orlistat 97.13
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 97.01
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 96.98
4az3_A300 Lysosomal protective protein 32 kDa chain; hydrola 96.93
2p4o_A306 Hypothetical protein; putative lactonase, structur 96.89
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 96.84
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
Probab=100.00  E-value=5.7e-57  Score=540.59  Aligned_cols=610  Identities=14%  Similarity=0.182  Sum_probs=432.9

Q ss_pred             ecCCCCcceEEEEEeechhhcccceeEEEEEEeecCCCCccceeecCCcceecccEEEEeCCCCCeEEEEecCCCCCCeE
Q 003363          102 NSGNGNGTQAMFSISQPNLLANKRKKFMLSTVISKENENSVTFQWAPFPVEMTGASAVVPSPSGSKLLVVRNPENESPIQ  181 (826)
Q Consensus       102 ~~~s~dg~~v~~~~~~~~~~~~~~~~~l~~~~i~~~~~~~~~lt~~~~~~~~~~~~~~~~SPdG~~la~~~~~~~~~~~~  181 (826)
                      ..+||||++|+|.......-.......+|++++.  +++.++|+..+     ..+..|+|||||++|||+++.     .+
T Consensus        67 ~~~Spdg~~l~~~~~~~~~~r~~~~~~~~~~d~~--~~~~~~l~~~~-----~~~~~~~~SPdG~~la~~~~~-----~i  134 (740)
T 4a5s_A           67 YSISPDGQFILLEYNYVKQWRHSYTASYDIYDLN--KRQLITEERIP-----NNTQWVTWSPVGHKLAYVWNN-----DI  134 (740)
T ss_dssp             EEECTTSSEEEEEEEEEECSSSCEEEEEEEEETT--TTEECCSSCCC-----TTEEEEEECSSTTCEEEEETT-----EE
T ss_pred             eEECCCCCEEEEEECCeeeEEEccceEEEEEECC--CCcEEEcccCC-----CcceeeEECCCCCEEEEEECC-----eE
Confidence            4569999999998765443333445788888864  34556666544     468999999999999999764     36


Q ss_pred             EEEe-cCCceeEEEecCC------CccccccCCCc---ccceeecCCCCeEEEEeecCCCCCCCccCCCCCCCCCCccCC
Q 003363          182 FELW-SQSQLEKEFHVPQ------TVHGSVYADGW---FEGISWNSDETLIAYVAEEPSPSKPTFSLGSTKGGSSDKDCN  251 (826)
Q Consensus       182 ~~i~-~~~~~~~~~~~~~------~~~g~v~~~~~---~~~~~wSPDg~~ia~~~~~~~~~~~~~~~~~~~~~~~~~~~~  251 (826)
                      +... .+++.++++....      +...+||.++.   ...++|||||++|||.+.+..... .|.........   ...
T Consensus       135 ~~~~~~~~~~~~lt~~g~~~~~~~g~~~~v~~ee~~~~~~~~~wSpDg~~la~~~~d~~~v~-~~~~~~~~~~~---~~~  210 (740)
T 4a5s_A          135 YVKIEPNLPSYRITWTGKEDIIYNGITDWVYEEEVFSAYSALWWSPNGTFLAYAQFNDTEVP-LIEYSFYSDES---LQY  210 (740)
T ss_dssp             EEESSTTSCCEECCSCCBTTTEEESBCCHHHHHHTSSSSBCEEECTTSSEEEEEEEECTTCC-EEEEEECCSTT---CSS
T ss_pred             EEEECCCCceEEEcCCCCccceecCcccccccchhcCCCcceEECCCCCEEEEEEEcccCCc-eEEEEeecCCC---CCC
Confidence            6665 5666666654211      12233333221   246899999999999987664321 22110000000   000


Q ss_pred             CCCCcceeecCCCccCCCccCceEEEEEccC---C---ceEeccCCC-----CCCccceEEEeeCCCCCccEEEEEeecC
Q 003363          252 SWKGQGDWEEDWGETYAGKRQPSLFVININS---G---EVQAVKGIP-----KSLSVGQVVWAPLNEGLHQYLVFVGWSS  320 (826)
Q Consensus       252 ~~~~~~~~~~d~g~~~~~~~~~~l~v~d~~~---g---~~~~l~~~~-----~~~~~~~~~wSPDg~~~~~~lvf~~~~~  320 (826)
                      .......|... |+.   .....|+++|+++   +   +.+.+. .+     ....+..++|||||+.    +++..++.
T Consensus       211 ~~~~~~~yp~~-G~~---~~~~~l~v~d~~~~~~~~~~~~~~l~-~~~~~~~~~~~~~~~~wspdg~~----~~~~~~r~  281 (740)
T 4a5s_A          211 PKTVRVPYPKA-GAV---NPTVKFFVVNTDSLSSVTNATSIQIT-APASMLIGDHYLCDVTWATQERI----SLQWLRRI  281 (740)
T ss_dssp             CEEEEEECCBT-TSC---CCEEEEEEEETTSCCSSSCCCEEEEC-CCHHHHTSCEEEEEEEEEETTEE----EEEEEESS
T ss_pred             CcceeecCCCC-cCc---CCeeEEEEEECCCCCCCCcceEEEec-CCccCCCCCeEEEEEEEeCCCeE----EEEEeCCC
Confidence            11112223322 211   1234799999999   8   666663 21     3445778999999998    88877543


Q ss_pred             cceeeeeeeeccCCCceEEEEcccccchhhhhhhhcCCCCCCc-------ceec--CCCCcc-----ccCceecCCCCEE
Q 003363          321 ETRKLGIKYCYNRPCALYAVRVSLYKSEASELELKESSSEDLP-------VVNL--TESISS-----AFFPRFSPDGKFL  386 (826)
Q Consensus       321 ~~~~~g~~~~~~~~~~l~~~d~~~~~~~~~~~~~~~~~~~~~~-------~~~L--t~~~~~-----~~~p~~SpDG~~l  386 (826)
                      ..           ...|+++|+                 ++++       .+++  ..+...     ...|.|||||+.|
T Consensus       282 ~~-----------~~~i~~~d~-----------------~tg~~~~~~~~~~~l~~~~~~~~v~~~~~~~p~fspDG~~l  333 (740)
T 4a5s_A          282 QN-----------YSVMDICDY-----------------DESSGRWNCLVARQHIEMSTTGWVGRFRPSEPHFTLDGNSF  333 (740)
T ss_dssp             TT-----------EEEEEEEEE-----------------ETTTTEEEECGGGCEEEECSSSCSSSSSCCCCEECTTSSEE
T ss_pred             CC-----------EEEEEEEEC-----------------CCCccccceeEEEEeeeccCCceEccCcCCCceEcCCCCEE
Confidence            32           236999998                 5554       3333  112222     3489999999999


Q ss_pred             E-EEeccCCCCCCCCcccceEEEEeCCCCCCCCcccceeeeeeeeeccCCCCCcccccCCCCCCccccCCCEEEEEEEe-
Q 003363          387 V-FLSAKSSVDSGAHSATDSLHRIDWPTNGNFSSLEKIVDVIPVVQCAEGDCFPGLYSSSILSNPWLSDGCTMLLSSIW-  464 (826)
Q Consensus       387 ~-f~s~~~~~~~g~~~~~~~l~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~f~g~~~~~~~~~~ws~Dg~~l~~~~~~-  464 (826)
                      + |.+.++        +..+||++|++++..++++.+..++..                     .+++||+.|+|.+.. 
T Consensus       334 ~~~~s~~~--------G~~~l~~~~~~~~~~~~lT~g~~~v~~---------------------~~~~d~~~i~f~~~~~  384 (740)
T 4a5s_A          334 YKIISNEE--------GYRHICYFQIDKKDCTFITKGTWEVIG---------------------IEALTSDYLYYISNEY  384 (740)
T ss_dssp             EEEEECTT--------SCEEEEEEETTCSSCEESCCSSSCEEE---------------------EEEECSSEEEEEESCG
T ss_pred             EEEEEcCC--------CceEEEEEECCCCceEecccCCEEEEE---------------------EEEEeCCEEEEEEecC
Confidence            8 666553        457899999999888888766544333                     123568899999876 


Q ss_pred             ---CCeEEEEEEECCCCcEE-EecCC----CCCeeeEEEeecCCEEEEEEeCCCCCCeEEEEeecccCCCceeeeeccCC
Q 003363          465 ---GSSQVIISVNVSSGELL-RITPA----ESNFSWSLLTLDGDNIIAVSSSPVDVPQVKYGYFVDKANKGTWSWLNVSS  536 (826)
Q Consensus       465 ---~~~~~l~~vdl~tg~~~-~lt~~----~~~~~~~~~s~dg~~l~~~~s~~~~p~~l~~~~~~~~~~~~~~~~~~~~~  536 (826)
                         .+..+||++++++++.+ +|+..    ...+....||++++.+++.++++. |+.+++.+...++ ...        
T Consensus       385 ~~~~~~~~ly~v~~~g~~~~~~lt~~~~~~~~~~~~~~~S~dg~~~~~~~s~~~-~p~~~l~~~~~~~-~~~--------  454 (740)
T 4a5s_A          385 KGMPGGRNLYKIQLIDYTKVTCLSCELNPERCQYYSVSFSKEAKYYQLRCSGPG-LPLYTLHSSVNDK-GLR--------  454 (740)
T ss_dssp             GGCTTCBEEEEEETTEEEEEEESSTTTSTTTBCBEEEEECTTSSEEEEEECSBS-SCEEEEEETTTTE-EEE--------
T ss_pred             CCCCceeEEEEEECCCCCcceeeccccCCCCCceEEEEECCCCCEEEEEeCCCC-CCEEEEEECCCCc-EEE--------
Confidence               46789999999887765 77754    234566789999999999999987 8899998865432 111        


Q ss_pred             CCCCCchhhhhcccccceeeeeecccCceeeeccCCCeeEEEEEEecCCCCCCCCCcEEEEEcCCCCCCCC-ccch-HHH
Q 003363          537 PISRCPEKVKSLLSSRQFSIMKIPVKGVSANLTKGAQKPFEAIFVSSSHKKDCSCDPLIVVLHGGPHSVSL-SSYS-KSL  614 (826)
Q Consensus       537 ~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~g~~l~~~~~~P~~~~~~~~~P~vv~~HGg~~~~~~-~~~~-~~~  614 (826)
                       +...|+.+...+....+...+.      ..+ ..+|.+++++++.|+++++.+++|+||++|||++.... ..|. ...
T Consensus       455 -~l~~n~~~~~~~~~~~~~~~~~------~~~-~~dg~~l~~~~~~P~~~~~~~~~P~vv~~HGg~~~~~~~~~~~~~~~  526 (740)
T 4a5s_A          455 -VLEDNSALDKMLQNVQMPSKKL------DFI-ILNETKFWYQMILPPHFDKSKKYPLLLDVYAGPCSQKADTVFRLNWA  526 (740)
T ss_dssp             -EEECCHHHHHHHTTEECCEEEE------EEE-EETTEEEEEEEEECTTCCTTSCEEEEEECCCCTTCCCCCCCCCCSHH
T ss_pred             -EeccChhhhhhhhhccCCccEE------EEE-ccCCeEEEEEEEeCCCCCCCCCccEEEEECCCCcccccccccCcCHH
Confidence             1223444434343332221111      122 45789999999999988778899999999999877432 2222 233


Q ss_pred             HHHH-HCCcEEEEECCCCCCCCchhhhhcCCCCCCcchHHHHHHHHHHHHHcCCCCCCcEEEEEecchHHHHHHHHHhCC
Q 003363          615 AFLS-SVGYSLLIVNYRGSLGFGEEALQSLPGKVGSQDVNDVLTAIDHVIDMGLANPSKVTVVGGSHGGFLTTHLIGQAP  693 (826)
Q Consensus       615 ~~la-~~G~~Vl~~d~rG~~g~G~~~~~~~~~~~~~~~~~D~~~~i~~l~~~~~~d~~rv~l~G~S~GG~~a~~~a~~~p  693 (826)
                      ..|+ ++||+|+++|+||++++|..+.......++..+++|+.++++++.+++.+|++||+|+|||+||++++.++.++|
T Consensus       527 ~~l~~~~G~~Vv~~D~rG~g~~g~~~~~~~~~~~~~~~~~D~~~~i~~l~~~~~~d~~ri~i~G~S~GG~~a~~~a~~~p  606 (740)
T 4a5s_A          527 TYLASTENIIVASFDGRGSGYQGDKIMHAINRRLGTFEVEDQIEAARQFSKMGFVDNKRIAIWGWSYGGYVTSMVLGSGS  606 (740)
T ss_dssp             HHHHHTTCCEEEEECCTTCSSSCHHHHGGGTTCTTSHHHHHHHHHHHHHHTSTTEEEEEEEEEEETHHHHHHHHHHTTTC
T ss_pred             HHHHhcCCeEEEEEcCCCCCcCChhHHHHHHhhhCcccHHHHHHHHHHHHhcCCcCCccEEEEEECHHHHHHHHHHHhCC
Confidence            4555 599999999999999999998888888888888999999999999888899999999999999999999999999


Q ss_pred             CceeEEEecCCccchhhhccCCCCCCchhhhhccCcCCccCCCCC-ChhhHHHHhhcCcccccCCCCC-cEEEEEeCCCC
Q 003363          694 DKFVAAAARNPLCNLALMVGTTDIPDWCYVESYGSKGKDSFTESP-SVEDLTRFHSKSPISHISKVKT-PTIFLLGAQDL  771 (826)
Q Consensus       694 ~~~~a~v~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~sp~~~~~~i~~-PvLii~G~~D~  771 (826)
                      ++|+++|+.+|+.++..+..       .+.+.        +.+.+ ..+..+.+...+|...+.++++ |+||+||+.|.
T Consensus       607 ~~~~~~v~~~p~~~~~~~~~-------~~~~~--------~~~~p~~~~~~~~~~~~~~~~~~~~i~~~P~Lii~G~~D~  671 (740)
T 4a5s_A          607 GVFKCGIAVAPVSRWEYYDS-------VYTER--------YMGLPTPEDNLDHYRNSTVMSRAENFKQVEYLLIHGTADD  671 (740)
T ss_dssp             SCCSEEEEESCCCCGGGSBH-------HHHHH--------HHCCSSTTTTHHHHHHSCSGGGGGGGGGSEEEEEEETTCS
T ss_pred             CceeEEEEcCCccchHHhhh-------HHHHH--------HcCCCCccccHHHHHhCCHHHHHhcCCCCcEEEEEcCCCC
Confidence            99999999999988654311       11111        11222 1345667888899999999987 99999999999


Q ss_pred             CCCcHHHHHHHHHHHhCCCCEEEEEeCCCCCCCCCCCCHHHHHHHHHHHHHHHcC
Q 003363          772 RVPVSNGLQYARALREKGVETKVIVFPNDVHGIERPQSDFESFLNIGLWFKKYCK  826 (826)
Q Consensus       772 ~vp~~~~~~~~~~l~~~g~~~~~~~~p~~~H~~~~~~~~~~~~~~i~~w~~~~l~  826 (826)
                      +||+.++.+++++|+++|+++++++||+++|.+...+...+++..+.+||+++|+
T Consensus       672 ~v~~~~~~~l~~~l~~~g~~~~~~~~~~~~H~~~~~~~~~~~~~~i~~fl~~~l~  726 (740)
T 4a5s_A          672 NVHFQQSAQISKALVDVGVDFQAMWYTDEDHGIASSTAHQHIYTHMSHFIKQCFS  726 (740)
T ss_dssp             SSCTHHHHHHHHHHHHTTCCCEEEEETTCCTTCCSHHHHHHHHHHHHHHHHHHTT
T ss_pred             ccCHHHHHHHHHHHHHCCCCeEEEEECCCCCcCCCCccHHHHHHHHHHHHHHHcC
Confidence            9999999999999999999999999999999997666677889999999999874
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>4hvt_A Ritya.17583.B, post-proline cleaving enzyme; ssgcid, structural genomics, S structural genomics center for infectious disease; 1.70A {Rickettsia typhi} Back     alignment and structure
>4ao6_A Esterase; hydrolase, thermo label; 1.60A {Unidentified} PDB: 4ao7_A 4ao8_A Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>3hxk_A Sugar hydrolase; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.20A {Lactococcus lactis subsp} Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>3f67_A Putative dienelactone hydrolase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 1.74A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2wtm_A EST1E; hydrolase; 1.60A {Clostridium proteoclasticum} PDB: 2wtn_A* Back     alignment and structure
>3bxp_A Putative lipase/esterase; putative carboxylesterase, structural genomics, joint center structural genomics, JCSG; HET: EPE; 1.70A {Lactobacillus plantarum WCFS1} PDB: 3d3n_A* Back     alignment and structure
>2jbw_A Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine hydrolase; alpha/beta hydrolase, META-cleavage pathway; 2.1A {Arthrobacter nicotinovorans} SCOP: c.69.1.41 Back     alignment and structure
>3k2i_A Acyl-coenzyme A thioesterase 4; alpha/beta hydrolase fold seven-stranded beta-sandwich, structural genomics, structural genomics consortium, SGC; 2.40A {Homo sapiens} Back     alignment and structure
>3doh_A Esterase; alpha-beta hydrolase, beta sheet; 2.60A {Thermotoga maritima} PDB: 3doi_A Back     alignment and structure
>1vlq_A Acetyl xylan esterase; TM0077, structural genomics, JCSG, PR structure initiative, PSI, joint center for structural GENO hydrolase; 2.10A {Thermotoga maritima} SCOP: c.69.1.25 PDB: 3m81_A 3m83_A* 3m82_A* Back     alignment and structure
>3bjr_A Putative carboxylesterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.09A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3hlk_A Acyl-coenzyme A thioesterase 2, mitochondrial; alpha/beta hydrolase, alternative splicing, hydrolase, mitochondrion, polymorphism, serine esterase; 2.10A {Homo sapiens} Back     alignment and structure
>3ebl_A Gibberellin receptor GID1; alpha/beta hydrolase, lipase, gibberellin signaling pathway, hydrolase, nucleus, hydrolase receptor; HET: GA4; 1.90A {Oryza sativa subsp} PDB: 3ed1_A* Back     alignment and structure
>3pfb_A Cinnamoyl esterase; alpha/beta hydrolase fold, hydrolase, cinnamoyl/Fe esterase, hydroxycinammates, extracellular; HET: ZYC; 1.58A {Lactobacillus johnsonii} PDB: 3pf9_A* 3pfc_A* 3s2z_A* 3pf8_A 3qm1_A* Back     alignment and structure
>2i3d_A AGR_C_3351P, hypothetical protein ATU1826; structural genomics, APC5865, hydrolase, PSI-2, protein STRU initiative; HET: MSE; 1.50A {Agrobacterium tumefaciens str} SCOP: c.69.1.36 Back     alignment and structure
>2o2g_A Dienelactone hydrolase; YP_324580.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.92A {Anabaena variabilis} Back     alignment and structure
>1zi8_A Carboxymethylenebutenolidase; alpha and beta proteins, 3-D structure, serine esterase, HYD aromatic hydrocarbons, catabolism; 1.40A {Pseudomonas putida} PDB: 1zj5_A* 1zi9_A 1zi6_A 1zj4_A* 1din_A 1ziy_A* 1zic_A 1zix_A 1ggv_A* Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>3ga7_A Acetyl esterase; phosphoserine, IDP00896, hydrolase, serine structural genomics, center for structural genomics of INFE diseases, csgid; HET: SEP MSE; 1.55A {Salmonella typhimurium} Back     alignment and structure
>3fak_A Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Uncultured bacterium} PDB: 3g9t_A 3g9u_A 3g9z_A 3h17_A* 3h18_A* 3h19_A 3h1a_A 3h1b_A 3l1h_A 3l1i_A 3l1j_A 3v9a_A Back     alignment and structure
>4fbl_A LIPS lipolytic enzyme; thermostable, structural genomics, enzyme function initiativ structural proteomics in europe, spine; HET: SPD; 1.99A {Unidentified} PDB: 4fbm_A Back     alignment and structure
>1l7a_A Cephalosporin C deacetylase; structural genomics, alpha-beta-alpha sandwich, PSI, protein structure initiative; 1.50A {Bacillus subtilis} SCOP: c.69.1.25 PDB: 1odt_C 1ods_A 3fvt_A 3fvr_A 3fyu_A* 2xlb_A 2xlc_A 3fyt_A* 3fyu_B* Back     alignment and structure
>3fcy_A Xylan esterase 1; alpha/beta hydrolase, carbohydrate esterase, CE7; 2.10A {Thermoanaerobacterium SP} Back     alignment and structure
>3ksr_A Putative serine hydrolase; catalytic triad, structural genomics, JOIN for structural genomics, JCSG; 2.69A {Xanthomonas campestris PV} Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>2hdw_A Hypothetical protein PA2218; alpha/beta hydrolase fold, structural genomics, PSI, structure initiative; 2.00A {Pseudomonas aeruginosa} Back     alignment and structure
>3trd_A Alpha/beta hydrolase; cellular processes; 1.50A {Coxiella burnetii} Back     alignment and structure
>2zsh_A Probable gibberellin receptor GID1L1; plant hormone receptor, gibberellin, gibberellin signaling pathway, hydrolase, nucleus, receptor, developmental protein; HET: GA3; 1.80A {Arabidopsis thaliana} PDB: 2zsi_A* Back     alignment and structure
>1mpx_A Alpha-amino acid ester hydrolase; alpha/beta hydrolase, jellyroll, selenomethionine; 1.90A {Xanthomonas citri} SCOP: b.18.1.13 c.69.1.21 Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3hju_A Monoglyceride lipase; alpha/beta hydrolase, hydrolase, serine esterase; 2.20A {Homo sapiens} Back     alignment and structure
>3pe6_A Monoglyceride lipase; alpha-beta hydrolase fold, 2-arachidonyl-glycerol, M associated, hydrolase, hydrolase-hydrolase inhibitor comple; HET: ZYH; 1.35A {Homo sapiens} PDB: 3jw8_A 3jwe_A* Back     alignment and structure
>3fcx_A FGH, esterase D, S-formylglutathione hydrolase; retinoblastoma, genetic marker, cytoplasm, cytoplasmic vesicle, polymorphism, serine esterase; 1.50A {Homo sapiens} SCOP: c.69.1.0 Back     alignment and structure
>2b9v_A Alpha-amino acid ester hydrolase; catalytic triad, alpha/beta-hydrolase; 2.00A {Acetobacter pasteurianus} SCOP: b.18.1.13 c.69.1.21 PDB: 2b4k_A 1nx9_A* 1ryy_A Back     alignment and structure
>3vis_A Esterase; alpha/beta-hydrolase fold, polyethylene terephthal hydrolase; HET: PE4; 1.76A {Thermobifida alba} Back     alignment and structure
>1jfr_A Lipase; serine hydrolase; 1.90A {Streptomyces exfoliatus} SCOP: c.69.1.16 Back     alignment and structure
>3i6y_A Esterase APC40077; lipase, structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic hydrolase; HET: MSE; 1.75A {Oleispira antarctica} PDB: 3s8y_A Back     alignment and structure
>3h04_A Uncharacterized protein; protein with unknown function, structural genomics, MCSG, PS protein structure initiative; 1.90A {Staphylococcus aureus subsp} Back     alignment and structure
>2hm7_A Carboxylesterase; alpha/beta hydrolase fold, hydrolase; 2.00A {Alicyclobacillus acidocaldarius} PDB: 1evq_A* 1u4n_A 1qz3_A Back     alignment and structure
>2fuk_A XC6422 protein; A/B hydrolase, structural genomics, X-RAY diffraction; 1.60A {Xanthomonas campestris} SCOP: c.69.1.36 Back     alignment and structure
>1vkh_A Putative serine hydrolase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.85A {Saccharomyces cerevisiae} SCOP: c.69.1.32 Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>1lzl_A Heroin esterase; alpha/beta hydrolase; 1.30A {Rhodococcus SP} SCOP: c.69.1.2 PDB: 1lzk_A Back     alignment and structure
>4e15_A Kynurenine formamidase; alpha/beta hydrolase fold, hydrolase-hydrolase inhibitor COM; HET: SEB; 1.50A {Drosophila melanogaster} PDB: 4e14_A* 4e11_A Back     alignment and structure
>3llc_A Putative hydrolase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE PG4; 1.80A {Agrobacterium vitis} Back     alignment and structure
>3k6k_A Esterase/lipase; alpha/beta hydrolase fold; 2.20A {Uncultured bacterium} PDB: 3dnm_A Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>3ain_A 303AA long hypothetical esterase; carboxylesterase, thermophilic, dimer, archaea, R267G, hydro; 1.65A {Sulfolobus tokodaii} PDB: 3aio_A 3ail_A 3aik_A 3aim_A Back     alignment and structure
>3ls2_A S-formylglutathione hydrolase; psychrophilic organism; 2.20A {Pseudoalteromonas haloplanktis} SCOP: c.69.1.0 Back     alignment and structure
>2o7r_A CXE carboxylesterase; alpha/beta hydrolase; 1.40A {Actinidia eriantha} PDB: 2o7v_A Back     alignment and structure
>3fnb_A Acylaminoacyl peptidase SMU_737; alpha-beta-alpha sandwich, helix bundle, structural genomics protein structure initiative; HET: PGE; 2.12A {Streptococcus mutans} Back     alignment and structure
>3qh4_A Esterase LIPW; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, tuberculosis, O LIPW, heroin esterase; 1.75A {Mycobacterium marinum} Back     alignment and structure
>3e4d_A Esterase D; S-formylglutathione hydrolase, hydrolase fold family, catalytic triad, kinetics, proposed reaction mechanism; HET: MSE; 2.01A {Agrobacterium tumefaciens} SCOP: c.69.1.0 Back     alignment and structure
>4h0c_A Phospholipase/carboxylesterase; PSI-biology, midwest center for structural genomics, MCSG, hydrolase; HET: CIT; 1.62A {Dyadobacter fermentans} Back     alignment and structure
>2c7b_A Carboxylesterase, ESTE1; carboxyesterase, thermophilic enzyme, hydrolase, HSL, alpha/beta hydrolase fold; 2.3A {Uncultured archaeon} Back     alignment and structure
>1jkm_A Brefeldin A esterase; serine hydrolase, degradation of brefeldin A, alpha/beta hydrolase family; 1.85A {Bacillus subtilis} SCOP: c.69.1.2 Back     alignment and structure
>1ufo_A Hypothetical protein TT1662; alpha-beta fold, hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.60A {Thermus thermophilus} SCOP: c.69.1.27 Back     alignment and structure
>3og9_A Protein YAHD A copper inducible hydrolase; alpha/beta hydrolase, copper homeostasis, malic acid; 1.88A {Lactococcus lactis subsp} SCOP: c.69.1.0 Back     alignment and structure
>1fj2_A Protein (acyl protein thioesterase 1); alpha/beta hydrolase, serine hydrolase, SAD, anomalous diffr hydrolase; 1.50A {Homo sapiens} SCOP: c.69.1.14 Back     alignment and structure
>1lns_A X-prolyl dipeptidyl aminopetidase; alpha beta hydrolase fold; 2.20A {Lactococcus lactis} SCOP: a.40.2.1 b.18.1.13 c.69.1.21 Back     alignment and structure
>3dkr_A Esterase D; alpha beta hydrolase, mechanism, catalytic triad, rotation; 1.60A {Lactobacillus rhamnosus} SCOP: c.69.1.0 PDB: 3dlt_A 3dyi_A 3dyv_A 3e1g_A Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>2pbl_A Putative esterase/lipase/thioesterase; alpha/beta-hydrolases fold, structural genomics, joint cente structural genomics, JCSG; 1.79A {Silicibacter SP} SCOP: c.69.1.2 Back     alignment and structure
>3bdi_A Uncharacterized protein TA0194; NP_393672.1, predicted CIB-like hydrolase, structural genomi center for structural genomics; HET: MSE; 1.45A {Thermoplasma acidophilum dsm 1728} Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>1auo_A Carboxylesterase; hydrolase; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.14 PDB: 1aur_A* Back     alignment and structure
>4f0j_A Probable hydrolytic enzyme; alpha/beta hydrolase fold, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>3cn9_A Carboxylesterase; alpha/beta hydrolase fold super-family, hydrolase; HET: 2PE; 2.09A {Pseudomonas aeruginosa} PDB: 3cn7_A* Back     alignment and structure
>3rm3_A MGLP, thermostable monoacylglycerol lipase; alpha/beta hydrolase fold, hydrolase; 1.20A {Bacillus SP} PDB: 3rli_A Back     alignment and structure
>3d7r_A Esterase; alpha/beta fold, hydrolase; 2.01A {Staphylococcus aureus subsp} Back     alignment and structure
>2uz0_A Esterase, tributyrin esterase; alpha/beta hydrolase, hydrolase, A virulence facto LUNG infection; HET: MSE; 1.7A {Streptococcus pneumoniae} Back     alignment and structure
>4b6g_A Putative esterase; hydrolase, formaldehyde detoxification, alpha/beta serine HY; 1.40A {Neisseria meningitidis MC58} Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>4fhz_A Phospholipase/carboxylesterase; alpha/beta hydrolase superfamily, central beta-STR sheet, flanked alpha helices, hydrolase; 2.01A {Rhodobacter sphaeroides} PDB: 4ftw_A* Back     alignment and structure
>1jjf_A Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-xylan; feruloyl esterase, ferulic acid esterase, FAE_XYNZ, XYNZ, structural genomics; 1.75A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1jt2_A* Back     alignment and structure
>3b5e_A MLL8374 protein; NP_108484.1, carboxylesterase, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; 1.75A {Mesorhizobium loti} SCOP: c.69.1.14 Back     alignment and structure
>2h1i_A Carboxylesterase; structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics, MCSG, H; HET: MSE; 2.80A {Bacillus cereus} SCOP: c.69.1.14 Back     alignment and structure
>3u0v_A Lysophospholipase-like protein 1; alpha, beta hydrolase fold, hydrolase; 1.72A {Homo sapiens} Back     alignment and structure
>3mve_A FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/respiration switch protein, hydrolase ACTI lyase; 2.20A {Vibrio vulnificus} PDB: 3our_A Back     alignment and structure
>1k8q_A Triacylglycerol lipase, gastric; APHA beta hydrolase fold, hydrolase; HET: NAG BOG C11; 2.70A {Canis lupus familiaris} SCOP: c.69.1.6 PDB: 1hlg_A* Back     alignment and structure
>1jji_A Carboxylesterase; alpha-beta hydrolase fold, hydrolase; HET: EPE; 2.20A {Archaeoglobus fulgidus} SCOP: c.69.1.2 Back     alignment and structure
>3d0k_A Putative poly(3-hydroxybutyrate) depolymerase LPQ; alpha-beta-alpha sandwich, structural genomics, PSI-2; 1.83A {Bordetella parapertussis 12822} Back     alignment and structure
>2r8b_A AGR_C_4453P, uncharacterized protein ATU2452; APC6088, agrobacterium tumefaciens STR. C58 structural genomics, PSI-2; 2.56A {Agrobacterium tumefaciens str} SCOP: c.69.1.14 Back     alignment and structure
>2qjw_A Uncharacterized protein XCC1541; putative hydrolase of the alpha/beta superfamily, structural genomics; HET: MSE TLA P6G; 1.35A {Xanthomonas campestris PV} Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>4ezi_A Uncharacterized protein; alpha-beta hydrolases fold, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.15A {Legionella pneumophila subsp} Back     alignment and structure
>2y6u_A Peroxisomal membrane protein LPX1; hydrolase, putative esterase, putative lipase; HET: CME CSO; 1.90A {Saccharomyces cerevisiae} PDB: 2y6v_A* Back     alignment and structure
>2fx5_A Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pseudomonas mendocina} Back     alignment and structure
>1imj_A CIB, CCG1-interacting factor B; alpha/beta hydrolase, CCG1 interactor; 2.20A {Homo sapiens} SCOP: c.69.1.23 Back     alignment and structure
>1tht_A Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.13 Back     alignment and structure
>3r0v_A Alpha/beta hydrolase fold protein; structural genomics, PSI-biology, protein structure initiati alpha/beta hydrolase; HET: MSE; 1.38A {Sphaerobacter thermophilus} Back     alignment and structure
>3ia2_A Arylesterase; alpha-beta hydrolase fold, transition state analog, hydrolas oxidoreductase, peroxidase; 1.65A {Pseudomonas fluorescens} SCOP: c.69.1.12 PDB: 1va4_A 3t52_A* 3t4u_A* 3hi4_A 3hea_A Back     alignment and structure
>1qlw_A Esterase; anisotropic refinement, atomic resolution, alpha/beta hydrolase; 1.09A {Alcaligenes SP} SCOP: c.69.1.15 PDB: 2wkw_A* Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>2qru_A Uncharacterized protein; alpha/beta-hydrolase, structural GENO PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.65A {Enterococcus faecalis} Back     alignment and structure
>2pl5_A Homoserine O-acetyltransferase; alpha/beta hydrolase superfa transferase; 2.20A {Leptospira interrogans} SCOP: c.69.1.40 Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3kxp_A Alpha-(N-acetylaminomethylene)succinic acid hydrolase; alpha/beta hydrolase, PLP degradation, E-2- (acetamidomethylene)succinate; 2.26A {Mesorhizobium loti} Back     alignment and structure
>3v48_A Aminohydrolase, putative aminoacrylate hydrolase RUTD; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.10A {Escherichia coli SE11} Back     alignment and structure
>3fob_A Bromoperoxidase; structural genomics, IDP00046, bacillus ANT peroxidase, oxidoreductase; 1.74A {Bacillus anthracis str} SCOP: c.69.1.0 Back     alignment and structure
>1brt_A Bromoperoxidase A2; haloperoxidase, oxidoreductase, alpha/beta hydrolase fold, mutant M99T; 1.50A {Streptomyces aureofaciens} SCOP: c.69.1.12 PDB: 1bro_A 1a8u_A 1a7u_A Back     alignment and structure
>1a88_A Chloroperoxidase L; haloperoxidase, oxidoreductase; 1.90A {Streptomyces lividans} SCOP: c.69.1.12 Back     alignment and structure
>3sty_A Methylketone synthase 1; alpha/beta hydrolase, decarboxylase, hydrolase; HET: DKA; 1.70A {Lycopersicon hirsutum F} PDB: 3stu_A* 3stt_A* 3stv_A* 3stw_A* 3stx_A* Back     alignment and structure
>1tqh_A Carboxylesterase precursor; tetrahedral intermediate, alpha/beta hydrolase; 1.63A {Geobacillus stearothermophilus} SCOP: c.69.1.29 PDB: 1r1d_A* 4diu_A Back     alignment and structure
>1a8s_A Chloroperoxidase F; haloperoxidase, oxidoreductase, propionate complex; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.12 Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>4fle_A Esterase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, alpha-beta protein, rossmann fold, HY; 2.10A {Yersinia enterocolitica subsp} Back     alignment and structure
>1zoi_A Esterase; alpha/beta hydrolase fold; 1.60A {Pseudomonas putida} PDB: 4dgq_A Back     alignment and structure
>1a8q_A Bromoperoxidase A1; haloperoxidase, oxidoreductase; 1.75A {Streptomyces aureofaciens} SCOP: c.69.1.12 Back     alignment and structure
>1sfr_A Antigen 85-A; alpha/beta hydrolase, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 2.70A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>3dqz_A Alpha-hydroxynitrIle lyase-like protein; A/B-hydrloase fold, cyanogenesis; 2.50A {Arabidopsis thaliana} SCOP: c.69.1.0 Back     alignment and structure
>1q0r_A RDMC, aclacinomycin methylesterase; anthracycline, hydrolase, polyketide, tailoring enzyme, structural proteomics in europe, spine; HET: AKT 1PE; 1.45A {Streptomyces purpurascens} SCOP: c.69.1.28 PDB: 1q0z_A* Back     alignment and structure
>3iii_A COCE/NOND family hydrolase; structural genomics, center for structural genomi infectious diseases, csgid; HET: MSE PLM; 1.95A {Staphylococcus aureus subsp} PDB: 3ib3_A* Back     alignment and structure
>2yys_A Proline iminopeptidase-related protein; TTHA1809, structural genomics, unknown function; 2.20A {Thermus thermophilus} Back     alignment and structure
>3vdx_A Designed 16NM tetrahedral protein CAGE containing bromoperoxidase BPO-A2 and matrix...; protein design, bionanotechnology; 3.00A {Streptomyces aureofaciens} PDB: 4d9j_A Back     alignment and structure
>3i2k_A Cocaine esterase; alpha/beta hydrolase, hydrolase; HET: DBC GOL; 1.51A {Rhodococcus SP} PDB: 3i2j_A* 3puh_A 3i2h_A* 3i2i_A* 3i2g_A* 3ida_A* 3i2f_A* 3pui_A 1ju3_A 1ju4_A 1l7q_A 1l7r_A Back     alignment and structure
>3u1t_A DMMA haloalkane dehalogenase; alpha/beta-hydrolase, hydrolase; 2.20A {Unidentified} Back     alignment and structure
>3om8_A Probable hydrolase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MES; 2.25A {Pseudomonas aeruginosa} SCOP: c.69.1.0 Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>2ocg_A Valacyclovir hydrolase; alpha beta hydrolase fold; 1.75A {Homo sapiens} PDB: 2oci_A* 2ock_A 2ocl_A Back     alignment and structure
>4f21_A Carboxylesterase/phospholipase family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Francisella tularensis subsp} Back     alignment and structure
>3nwo_A PIP, proline iminopeptidase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, mycobac smegmatis; 1.90A {Mycobacterium smegmatis} Back     alignment and structure
>2puj_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; C-C bond hydrolase, hydrolase; HET: HPZ; 1.57A {Burkholderia xenovorans} PDB: 2pu7_A* 3v1m_A* 3v1l_A* 2puh_A* 3v1n_A* 3v1k_A* 2og1_A 2pu5_A 2rhw_A* 2rht_A* 2ri6_A Back     alignment and structure
>3qvm_A OLEI00960; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase fold, hydrolase; 2.00A {Oleispira antarctica} Back     alignment and structure
>4dnp_A DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petunia hybrida} PDB: 4dnq_A Back     alignment and structure
>3qit_A CURM TE, polyketide synthase; thioesterase, alpha/beta hydrolase, decarboxylase, sulfate elimination, terminal alkene production; 1.68A {Lyngbya majuscula 19L} Back     alignment and structure
>2r11_A Carboxylesterase NP; 2632844, putative hydrolase, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE; 1.96A {Bacillus subtilis} Back     alignment and structure
>2xua_A PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, catechol metabolism; 1.90A {Burkholderia xenovorans} Back     alignment and structure
>1mtz_A Proline iminopeptidase; alpha-beta hydrolase, CAP domain, caged active site, prolyl peptidase; 1.80A {Thermoplasma acidophilum} SCOP: c.69.1.7 PDB: 1mt3_A 1mu0_A* 1xrr_A 1xrq_A 1xro_A 1xrn_A 1xrm_A 1xrp_A 1xrl_A* 1xqw_A* 1xqx_A* 1xqy_A 1xqv_A Back     alignment and structure
>1r88_A MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBPC1, immune system; 1.71A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>1iup_A META-cleavage product hydrolase; aromatic compounds, cumene, isopropylbenzene, META-cleavage compound hydrolase; 1.60A {Pseudomonas fluorescens} SCOP: c.69.1.10 PDB: 1iun_A 1iuo_A 1uk6_A 1uk7_A 1uk8_A 1uk9_A 1uka_A 1ukb_A 2d0d_A Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>3fsg_A Alpha/beta superfamily hydrolase; PF00561, MCSG, PSI, PSI-2, structural genomics, protein structure initiative, midwest for structural genomics; 2.00A {Oenococcus oeni} Back     alignment and structure
>1c4x_A BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoat hydrolase); PCB degradation; 2.40A {Rhodococcus SP} SCOP: c.69.1.10 Back     alignment and structure
>3oos_A Alpha/beta hydrolase family protein; APC67239.0, protein structure initiative, PSI-2, structural midwest center for structural genomics, MCSG; HET: MSE PG4; 1.65A {Bacillus anthracis} Back     alignment and structure
>3i1i_A Homoserine O-acetyltransferase; structural genomics, IDP01610, O-acetyltransfera bacillus anthracis; HET: MSE; 2.44A {Bacillus anthracis str} Back     alignment and structure
>3d59_A Platelet-activating factor acetylhydrolase; secreted protein, alpha/beta-hydrolase-fold, LDL-bound, lipoprotein associated phospholipase A2, LP-PLA2; 1.50A {Homo sapiens} PDB: 3d5e_A 3f97_A* 3f98_A 3f9c_A* 3f96_A* Back     alignment and structure
>2qm0_A BES; alpha-beta structure, structural genomics, PSI-2, protein ST initiative, midwest center for structural genomics, MCSG; HET: SVY; 1.84A {Bacillus cereus atcc 14579} Back     alignment and structure
>2wue_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolase BPHD; HET: KEK; 1.80A {Mycobacterium tuberculosis} PDB: 2wud_A* 2wuf_A* 2wug_A* 2vf2_A Back     alignment and structure
>1hkh_A Gamma lactamase; hydrolase, alpha/beta hydrolase, CO-factor free haloperoxidase,; 1.73A {Microbacterium} SCOP: c.69.1.12 PDB: 1hl7_A* Back     alignment and structure
>1gkl_A Endo-1,4-beta-xylanase Y; hydrolase, esterase family 1, inactive mutant; HET: FER; 1.4A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1wb4_A* 1wb5_A* 1wb6_A* 1gkk_A* Back     alignment and structure
>2qs9_A Retinoblastoma-binding protein 9; B5T overexpressed gene protein, BOG, RBBP9, RBBP10, HR2978, NESG, structural genomics, PSI-2; 1.72A {Homo sapiens} Back     alignment and structure
>3hss_A Putative bromoperoxidase; alpha beta hydrolase, oxidoreductase, hydrolase; 1.90A {Mycobacterium tuberculosis} PDB: 3e3a_A 3hys_A 3hzo_A Back     alignment and structure
>3h2g_A Esterase; xanthomonas oryzae PV. oryzae, cell WALL degrading enzyme, RICE, virulence, innate immune responses, pathogenesis; 1.86A {Xanthomonas oryzae PV} PDB: 3h2j_A 3h2k_A* 3h2h_A 3h2i_A Back     alignment and structure
>3g8y_A SUSD/RAGB-associated esterase-like protein; structural genom joint center for structural genomics, JCSG; HET: MSE; 1.90A {Bacteroides vulgatus atcc 8482} Back     alignment and structure
>3e0x_A Lipase-esterase related protein; APC60309, clostridium acetobutylicum ATCC 824, structural genomics, PSI-2; HET: MSE; 1.45A {Clostridium acetobutylicum} Back     alignment and structure
>3bf7_A Esterase YBFF; thioesterase, helical CAP, hydrolase; 1.10A {Escherichia coli} PDB: 3bf8_A Back     alignment and structure
>3r40_A Fluoroacetate dehalogenase; FACD, defluorinase, alpha/beta hydrolase, hydrolase; 1.05A {Rhodopseudomonas palustris} PDB: 3r3w_A 3r3x_A 3r3v_A 3r3u_A 3r3z_A 3r41_A 3r3y_A Back     alignment and structure
>1u2e_A 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase; alpha/beta hydrolase fold; 2.10A {Escherichia coli} Back     alignment and structure
>1j1i_A META cleavage compound hydrolase; carbazole degradation, META cleavage product hydrolase, histidine tagged protein, alpha/beta-hydrolase; 1.86A {Janthinobacterium} SCOP: c.69.1.10 Back     alignment and structure
>2b61_A Homoserine O-acetyltransferase; acyl-enzyme, aspartate pathway, coenzyme A, structure-functi studies, alpha-beta hydrolase fold; 1.65A {Haemophilus influenzae} SCOP: c.69.1.40 Back     alignment and structure
>2wfl_A Polyneuridine-aldehyde esterase; alkaloid metabolism, monoterpenoid indole alkaloids, PNAE, hydrolase, serine esterase; HET: CME; 2.10A {Rauvolfia serpentina} PDB: 2wfm_A 3gzj_A* Back     alignment and structure
>3nuz_A Putative acetyl xylan esterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology; 2.30A {Bacteroides fragilis} Back     alignment and structure
>2xt0_A Haloalkane dehalogenase; hydrolase, alpha-beta hydrolase fold; 1.90A {Plesiocystis pacifica} Back     alignment and structure
>3p2m_A Possible hydrolase; alpha/beta hydrolase superfamily; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>1b6g_A Haloalkane dehalogenase; hydrolase, alpha/beta-hydrolase; 1.15A {Xanthobacter autotrophicus} SCOP: c.69.1.8 PDB: 1be0_A 1cij_A 2yxp_X 1edd_A 1edb_A 2dhc_A 2dhe_A 2eda_A 2edc_A 2had_A 1ede_A 2pky_X 1bez_A 1bee_A 2dhd_A* 1hde_A Back     alignment and structure
>3g9x_A Haloalkane dehalogenase; alpha/beta hydrolase, helical CAP domain, catalytic triad (A His272, Glu130), mutant, I135F, haloalkanes; 0.95A {Rhodococcus SP} SCOP: c.69.1.8 PDB: 3fwh_A 3fbw_A 3rlt_A 3rk4_A 1bn6_A 1bn7_A 4fwb_A 1cqw_A 3sk0_A 2v9z_A Back     alignment and structure
>4g9e_A AHL-lactonase, alpha/beta hydrolase fold protein; AHL-binding; HET: C4L; 1.09A {Ochrobactrum} PDB: 4g5x_A* 4g8b_A* 4g8d_A 4g8c_A* 4g9g_A Back     alignment and structure
>1uxo_A YDEN protein; hydrolase, A/B hydrolase, esterase, PSI, protein structure initiative, MCSG, midwest center for structural genomics; 1.8A {Bacillus subtilis} SCOP: c.69.1.31 Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Back     alignment and structure
>3afi_E Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 1.75A {Bradyrhizobium japonicum} PDB: 3a2m_A* 3a2n_A 3a2l_A* Back     alignment and structure
>2e3j_A Epoxide hydrolase EPHB; epoxide hydrolase B, structural mycobacterium tuberculosis structural proteomics project, X hydrolase; 2.10A {Mycobacterium tuberculosis} PDB: 2zjf_A* Back     alignment and structure
>3bwx_A Alpha/beta hydrolase; YP_496220.1, joint center for structural genomics, protein structure initiative, PSI-2; HET: MSE; 1.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>2xmz_A Hydrolase, alpha/beta hydrolase fold family; menaquinone biosynthesis, lyase; 1.94A {Staphylococcus aureus} Back     alignment and structure
>1xkl_A SABP2, salicylic acid-binding protein 2; alpha-beta protein, structural genomics, protein structure initiative, PSI; HET: STH; 2.00A {Nicotiana tabacum} SCOP: c.69.1.20 PDB: 1y7i_A* 1y7h_A* Back     alignment and structure
>1dqz_A 85C, protein (antigen 85-C); fibronectin, structural genomics, PSI, protein structure initiative, TB structural genomics consortium; 1.50A {Mycobacterium tuberculosis} SCOP: c.69.1.3 PDB: 3hrh_A 1dqy_A 1va5_A* 1f0n_A* 1f0p_A* Back     alignment and structure
>2vat_A Acetyl-COA--deacetylcephalosporin C acetyltransferase; A/B- hydrolase fold, acyltransferase, acetyl coenzyme A, antibiotic biosynthesis; HET: COA; 2.2A {Acremonium chrysogenum} SCOP: c.69.1.40 PDB: 2vav_A* 2vax_A* Back     alignment and structure
>3guu_A Lipase A; protein structure, hydrolase; HET: 1PE; 2.10A {Candida antarctica} PDB: 2veo_A* Back     alignment and structure
>2cjp_A Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tuberosum} PDB: 3cxu_A* Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>1wm1_A Proline iminopeptidase; complex with inhibitor, hydrolase; HET: PTB; 2.10A {Serratia marcescens} SCOP: c.69.1.7 PDB: 1qtr_A* 1x2b_A* 1x2e_A* Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3c6x_A Hydroxynitrilase; atomic resolution, hydroxynitril lyase, catalysis, protonation state, AB initio calculations, substrate bindin; 1.05A {Hevea brasiliensis} SCOP: c.69.1.20 PDB: 1sc9_A 1yas_A* 2g4l_A* 2yas_A 1qj4_A 3c6y_A 3c6z_A 3c70_A 3yas_A 4yas_A 5yas_A* 6yas_A 7yas_A* 1yb6_A* 1yb7_A 1sck_A 1sci_A 1scq_A 1dwo_A 1dwp_A ... Back     alignment and structure
>2rau_A Putative esterase; NP_343859.1, putative lipase, structural genomics, joint CEN structural genomics, JCSG; HET: PG4 UNL; 1.85A {Sulfolobus solfataricus P2} Back     alignment and structure
>1wom_A RSBQ, sigma factor SIGB regulation protein RSBQ; alpha/beta hydrolase, signaling protein; 2.50A {Bacillus subtilis} PDB: 1wpr_A* Back     alignment and structure
>3kda_A CFTR inhibitory factor (CIF); alpha/beta hydrolase, hydrolase; 1.50A {Pseudomonas aeruginosa ucbpp-pa14} PDB: 3kd2_A 3pi6_A Back     alignment and structure
>1ehy_A Protein (soluble epoxide hydrolase); alpha/beta hydrolase fold, epoxide degradation, epichlorohydrin; 2.10A {Agrobacterium tumefaciens} SCOP: c.69.1.11 Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>2qvb_A Haloalkane dehalogenase 3; RV2579, alpha-beta hydrolase protei structural genomics consortium, TBSGC, hydrolase; 1.19A {Mycobacterium tuberculosis} PDB: 2o2i_A 2o2h_A Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>3fla_A RIFR; alpha-beta hydrolase thioesterase, hydrolase; HET: MSE; 1.80A {Amycolatopsis mediterranei} PDB: 3flb_A* Back     alignment and structure
>3bdv_A Uncharacterized protein DUF1234; DUF1234 family protein, alpha/beta-hydrolases fold, structur genomics; HET: MSE; 1.66A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>1isp_A Lipase; alpha/beta hydrolase fold, hydrolase; 1.30A {Bacillus subtilis} SCOP: c.69.1.18 PDB: 1i6w_A 1r4z_A* 1r50_A* 2qxu_A 2qxt_A 1t4m_A 1t2n_A 3d2a_A 3qzu_A 3d2b_A 3d2c_A 3qmm_A Back     alignment and structure
>1mj5_A 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; LINB, haloalkane dehalogenase, 1, 3, 4, 4-cyclohexadiene dehalogenase; 0.95A {Sphingomonas paucimobilis} SCOP: c.69.1.8 PDB: 1cv2_A 1d07_A 2bfn_A 1g42_A* 1g4h_A* 1g5f_A* 1iz7_A 1iz8_A* 1k5p_A 1k63_A 1k6e_A Back     alignment and structure
>1azw_A Proline iminopeptidase; aminopeptidase, serine protease, xanthomonas campestris; 2.70A {Xanthomonas citri} SCOP: c.69.1.7 Back     alignment and structure
>3ibt_A 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, oxidoreductase; 2.60A {Pseudomonas putida} Back     alignment and structure
>2qmq_A Protein NDRG2, protein NDR2; alpha/beta-hydrolases fold, NDR family, developmental protei differentiation, neurogenesis, phosphorylation; HET: 2PE; 1.70A {Mus musculus} PDB: 2xmq_A 2xmr_A 2xms_A Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>1ycd_A Hypothetical 27.3 kDa protein in AAP1-SMF2 intergenic region; esterase, lipase, serine hydrolase, structural genomics; HET: LI5; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3c8d_A Enterochelin esterase; alpha-beta-alpha sandwich, IROD, iron aquisition, structural genomics, PSI-2, protein structure initiative; HET: CIT; 1.80A {Shigella flexneri 2a str} SCOP: b.1.18.20 c.69.1.2 PDB: 2b20_A 3c87_A* 3c8h_A 3mga_A* Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>1m33_A BIOH protein; alpha-betta-alpha sandwich, structural genomics, PSI, protei structure initiative; HET: MSE 3OH; 1.70A {Escherichia coli} SCOP: c.69.1.26 Back     alignment and structure
>2q0x_A Protein DUF1749, uncharacterized protein; alpha/beta hydrolase fold, structural genomics, structural G of pathogenic protozoa consortium; 2.20A {Trypanosoma brucei} Back     alignment and structure
>1r3d_A Conserved hypothetical protein VC1974; structural genomics, hydrolase, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI; 1.90A {Vibrio cholerae} SCOP: c.69.1.35 Back     alignment and structure
>1pja_A Palmitoyl-protein thioesterase 2 precursor; hydrolase, glycoprotein, lysosome; HET: NAG; 2.70A {Homo sapiens} SCOP: c.69.1.13 Back     alignment and structure
>2gzs_A IROE protein; enterobactin, salmochelin, DFP, hydrolase, catalytic DYAD; HET: DFP; 1.40A {Escherichia coli} SCOP: c.69.1.38 PDB: 2gzr_A* Back     alignment and structure
>2psd_A Renilla-luciferin 2-monooxygenase; alpha/beta-hydrolase, luciferase, oxidoreductase; 1.40A {Renilla reniformis} PDB: 2pse_A 2psj_A* 2psh_A 2psf_A Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>3l80_A Putative uncharacterized protein SMU.1393C; alpha/beta hydrolase fold, carboxylesterase, Ser- hydrolase; 2.00A {Streptococcus mutans} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>3b12_A Fluoroacetate dehalogenase; dehalogease, hydrolase; 1.20A {Burkholderia SP} PDB: 1y37_A Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>2wj6_A 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxidoreductase, alpha/beta hydrolase; HET: ZZ8 SRT; 2.00A {Arthrobacter nitroguajacolicus} PDB: 2wj4_A* 2wj3_A* 2wm2_A* Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>1qe3_A PNB esterase, para-nitrobenzyl esterase; alpha-beta hydrolase directed evolution; 1.50A {Bacillus subtilis} SCOP: c.69.1.1 PDB: 1c7j_A 1c7i_A Back     alignment and structure
>3qmv_A Thioesterase, REDJ; alpha/beta hydrolase fold, hydrolase; 2.12A {Streptomyces coelicolor} PDB: 3qmw_A* Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>4i19_A Epoxide hydrolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.15A {Streptomyces carzinostaticus subsp} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>3qyj_A ALR0039 protein; alpha/beta fold, hydrolase; 1.78A {Nostoc SP} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>3c5v_A PME-1, protein phosphatase methylesterase 1; demethylase, PP2A, alternative splicing, hydrolase, phosphoprotein, serine esterase; 2.00A {Homo sapiens} PDB: 3c5w_P Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3gff_A IROE-like serine hydrolase; NP_718593.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; 2.12A {Shewanella oneidensis} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>3pic_A CIP2; alpha/beta hydrolase fold, glucuronoyl esterase, carbohydrat esterase family 15 (CE-15), N-linked glycosylation, secrete hydrolase; HET: NAG; 1.90A {Hypocrea jecorina} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>3fle_A SE_1780 protein; structural genomics, APC61035.1, PSI-2, protein structure in midwest center for structural genomics, MCSG; 2.01A {Staphylococcus epidermidis} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>4g4g_A 4-O-methyl-glucuronoyl methylesterase; alpha/beta hydrolase, 3-layer alpha/beta/alpha sandwich, ROS fold, glucuronoyl esterase; 1.55A {Myceliophthora thermophila} PDB: 4g4i_A 4g4j_A* Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>3lcr_A Tautomycetin biosynthetic PKS; alpha-beta hydrolase, thioesterase, polyketide synthase, phosphopantetheine, transferase, hydrolase; 2.00A {Streptomyces SP} Back     alignment and structure
>2d81_A PHB depolymerase; alpha/beta hydrolase fold, circular permutation, hydrolase; HET: NAG RB3; 1.66A {Penicillium funiculosum} SCOP: c.69.1.37 PDB: 2d80_A* Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>4fol_A FGH, S-formylglutathione hydrolase; D-type esterase, oxidation sensor motif, esterase activity activation, esterase activity inhibition; 2.07A {Saccharomyces cerevisiae} PDB: 1pv1_A 3c6b_A* 4flm_A* Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3ds8_A LIN2722 protein; unkonwn function, structural genomics, PSI, MCSG, P structure initiative; 1.80A {Listeria innocua} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3g02_A Epoxide hydrolase; alpha/beta hydrolase fold, enantioselective, mutant, directed evolution; 1.50A {Aspergillus niger} SCOP: c.69.1.11 PDB: 1qo7_A 3g0i_A* Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>1kez_A Erythronolide synthase; polyketide synthase, modular polyketide synthase, thioesterase, 6-DEB, TE, DEBS, alpha, beta-hydrolase; 2.80A {Saccharopolyspora erythraea} SCOP: c.69.1.22 PDB: 1mo2_A Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3lp5_A Putative cell surface hydrolase; structural genom PSI2, MCSG, protein structure initiative, midwest center FO structural genomics; 2.00A {Lactobacillus plantarum} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>1ukc_A ESTA, esterase; fungi, A/B hydrolase fold, acetylcholinesterase, H; HET: NAG MAN; 2.10A {Aspergillus niger} SCOP: c.69.1.17 Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>2k2q_B Surfactin synthetase thioesterase subunit; A/B-hydrolase, NRPS, non-ribosomal peptide synthetase, type II thioesterase, antibiotic biosynthesis; NMR {Bacillus subtilis} PDB: 2ron_A Back     alignment and structure
>3ils_A PKS, aflatoxin biosynthesis polyketide synthase; A/B hydrolase, thioesterase, norsolorinic acid, P polyketide, acyltransferase; 1.70A {Aspergillus parasiticus} Back     alignment and structure
>1tca_A Lipase; hydrolase(carboxylic esterase); HET: NAG; 1.55A {Candida antarctica} SCOP: c.69.1.17 PDB: 1lbs_A* 1lbt_A* 1tcb_A* 1tcc_A* Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>2h7c_A Liver carboxylesterase 1; enzyme, cholesteryl esterase, hydrolase; HET: NAG NDG SIA COA; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 2dqy_A* 2dr0_A* 2dqz_A* 1mx1_A* 1mx5_A* 1mx9_A* 4ab1_A* 1ya4_A* 1yah_A* 1yaj_A* 1ya8_A* 2hrr_A* 2hrq_A* 3k9b_A* 1k4y_A* Back     alignment and structure
>1thg_A Lipase; hydrolase(carboxylic esterase); HET: NAG NDG; 1.80A {Galactomyces geotrichum} SCOP: c.69.1.17 Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>1ei9_A Palmitoyl protein thioesterase 1; alpha/beta hydrolase, glycoprotein, hydrolase; HET: NDG NAG; 2.25A {Bos taurus} SCOP: c.69.1.13 PDB: 1eh5_A* 1exw_A* 3gro_A Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1llf_A Lipase 3; candida cylindracea cholesterol esterase, sterol ester acylh hydrolase; HET: NAG F23; 1.40A {Candida cylindracea} SCOP: c.69.1.17 PDB: 1cle_A* 1lpm_A* 1lpn_A* 1lpo_A* 1lpp_A* 1lps_A* 1crl_A* 1trh_A* 3rar_A* 1gz7_A* Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>2ogt_A Thermostable carboxylesterase EST50; alpha/beta hydrolase, hydrolase; 1.58A {Geobacillus stearothermophilus} PDB: 2ogs_A Back     alignment and structure
>2ha2_A ACHE, acetylcholinesterase; hydrolase fold, serine esterase, homod glycosylated protein, hydrolase; HET: NAG FUC SCK SCU P6G; 2.05A {Mus musculus} SCOP: c.69.1.1 PDB: 1j07_A* 1mah_A* 1j06_A* 1n5r_A* 2gyv_A* 2gyw_A* 2h9y_A* 2ha0_A* 2gyu_A* 2ha3_A* 2wls_A* 4a23_A* 2c0q_A* 2jey_A* 2jgm_A* 2whr_A* 2c0p_A* 1ku6_A* 1q84_A* 1q83_A* ... Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>1gpl_A RP2 lipase; serine esterase, hydrolase, lipid degradation, pancreas, glycoprotein, chimeric; 2.01A {Cavia porcellus} SCOP: b.12.1.2 c.69.1.19 PDB: 1lpb_B* 1lpa_B* 1n8s_A Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1p0i_A Cholinesterase; serine hydrolase, butyrate, hydrolase; HET: NAG FUC MES; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 1p0m_A* 1p0p_A* 1p0q_A* 1xlu_A* 1xlv_A* 1xlw_A* 2wsl_A* 2pm8_A* 3djy_A* 3dkk_A* 2wij_A* 2wif_A* 2wik_A* 2y1k_A* 2j4c_A* 2xmb_A* 2xmc_A* 2xmd_A* 2xmg_A* 2wig_A* ... Back     alignment and structure
>2fj0_A JuvenIle hormone esterase; manduca sexta, alpha-beta hydrolase; HET: TFC; 2.70A {Trichoplusia NI} Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>1jmk_C SRFTE, surfactin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha-beta hydrolase, cyclic peptide; 1.71A {Bacillus subtilis} SCOP: c.69.1.22 Back     alignment and structure
>1ea5_A ACHE, acetylcholinesterase; hydrolase, serine hydrolase, neurotransmitter cleavage, catalytic triad, alpha/beta hydrolase; HET: NAG; 1.80A {Torpedo californica} SCOP: c.69.1.1 PDB: 1ax9_A* 1amn_A* 1cfj_A* 1fss_A* 1gpk_A* 1gpn_A* 1oce_A* 1qid_A 1qie_A 1qif_A 1qig_A 1qih_A 1qii_A 1qij_A 1qik_A 1qim_A 1qti_A* 1vot_A* 1vxo_A* 1vxr_A* ... Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3icv_A Lipase B, CALB; circular permutation, cleavage on PAIR of basic residues, glycoprotein, hydrolase, lipid degradation, zymogen, disulf; HET: NAG BTB; 1.49A {Candida antarctica} PDB: 3icw_A* Back     alignment and structure
>2cb9_A Fengycin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha/beta- hydrolases, catalytic triade, hydrolase; 1.8A {Bacillus subtilis} PDB: 2cbg_A* Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1dx4_A ACHE, acetylcholinesterase; hydrolase, serine esterase, synapse, membrane, nerve, muscle neurotransmitter degradation, glycoprotein; HET: NAG MAN BMA 760; 2.70A {Drosophila melanogaster} SCOP: c.69.1.1 PDB: 1qo9_A* 1qon_A* Back     alignment and structure
>1ex9_A Lactonizing lipase; alpha-beta hydrolase fold, phosphonate inhibitor; HET: OCP; 2.54A {Pseudomonas aeruginosa} SCOP: c.69.1.18 Back     alignment and structure
>2bce_A Cholesterol esterase; hydrolase, serine esterase, lipase; 1.60A {Bos taurus} SCOP: c.69.1.1 PDB: 1akn_A* 1aql_A* 1f6w_A 1jmy_A Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>3tej_A Enterobactin synthase component F; nonribosomal peptide, thioesterase, carrier domain, ATP- BIN enterobactin biosynthesis, ION transport, iron; HET: UF0; 1.90A {Escherichia coli} PDB: 2roq_A Back     alignment and structure
>1ys1_X Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor hexylphosphonic acid (R) 2-methyl-3-phenylpropyl ester, hydrolase; HET: 2HR; 1.10A {Burkholderia cepacia} PDB: 1ys2_X* 4lip_D 1hqd_A 2lip_A 1oil_A* 3lip_A 2nw6_A 5lip_A* 1cvl_A 2es4_A 1tah_B 1qge_D 1qge_E Back     alignment and structure
>3bix_A Neuroligin-1, neuroligin I; esterase domain, alpha-beta hydrolase, cell adhesion, cell J glycoprotein, membrane, postsynaptic cell membrane; HET: NAG; 1.80A {Rattus norvegicus} PDB: 3biw_A* 3b3q_A* 3be8_A* 2wqz_A* 2xb6_A* 2vh8_A 3bl8_A* Back     alignment and structure
>1bu8_A Protein (pancreatic lipase related protein 2); hydrolase, lipid degradation; HET: NAG; 1.80A {Rattus norvegicus} SCOP: b.12.1.2 c.69.1.19 PDB: 2oxe_A* 2pvs_A 1eth_A* Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>2x5x_A PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE, hydrolase, biodegradation, catal; HET: PG4; 1.20A {Paucimonas lemoignei} PDB: 2vtv_A* 2x76_A Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1w52_X Pancreatic lipase related protein 2; detergent, cleaved flap; HET: DDQ; 2.99A {Equus caballus} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>2hfk_A Pikromycin, type I polyketide synthase pikaiv; alpha/beta hydrolase, thioesterase; HET: E4H; 1.79A {Streptomyces venezuelae} PDB: 2h7x_A* 2h7y_A* 2hfj_A* 1mna_A 1mn6_A 1mnq_A Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>3n2z_B Lysosomal Pro-X carboxypeptidase; alpha/beta hydrolase, PRCP, serine carboxypeptidase, hydrola; HET: NAG; 2.79A {Homo sapiens} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>2zyr_A Lipase, putative; fatty acid, hydrolase; HET: 1PE; 1.77A {Archaeoglobus fulgidus} PDB: 2zys_A* 2zyi_A* 2zyh_A* Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>1hpl_A Lipase; hydrolase(carboxylic esterase); 2.30A {Equus caballus} SCOP: b.12.1.2 c.69.1.19 Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>1rp1_A Pancreatic lipase related protein 1; hydrolase, lipid degradation; HET: NAG; 2.10A {Canis lupus familiaris} SCOP: b.12.1.2 c.69.1.19 PDB: 2ppl_A Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>3tjm_A Fatty acid synthase; thioesterase domain, fatty acid synthesis, hydrolase-hydrola inhibitor complex; HET: 7FA; 1.48A {Homo sapiens} PDB: 1xkt_A Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>2dst_A Hypothetical protein TTHA1544; conserved hypothetical protein, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} SCOP: c.69.1.39 Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>2hih_A Lipase 46 kDa form; A1 phospholipase, phospholipid binding, hydrolase; 2.86A {Staphylococcus hyicus} Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>2dsn_A Thermostable lipase; T1 lipase, hydrolase; 1.50A {Geobacillus zalihae} PDB: 3umj_A 2z5g_A 1ji3_A 3auk_A 2w22_A* 1ku0_A Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>1whs_A Serine carboxypeptidase II; HET: NAG FUC; 2.00A {Triticum aestivum} SCOP: c.69.1.5 PDB: 1bcs_A* 1bcr_A* 1wht_A* 3sc2_A* Back     alignment and structure
>4ebb_A Dipeptidyl peptidase 2; hydrolase; HET: MSE NAG; 2.00A {Homo sapiens} PDB: 3jyh_A* 3n0t_A* Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>1ivy_A Human protective protein; carboxypeptidase, serine carboxypeptidase, protective protei glycoprotein, zymogen; HET: NAG NDG; 2.20A {Homo sapiens} SCOP: c.69.1.5 Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>2px6_A Thioesterase domain; thioesaterse domain, orlistat, fatty acid synthase, drug complex, tetrahydrolipstatin, transferase; HET: DH9; 2.30A {Homo sapiens} Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>4az3_A Lysosomal protective protein 32 kDa chain; hydrolase, drug discovery, carboxypeptidase, cardiovascular; HET: NAG S35; 2.04A {Homo sapiens} PDB: 4az0_A* Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 826
d1xfda2258 c.69.1.24 (A:592-849) Dipeptidyl aminopeptidase-li 1e-20
d1vlqa_322 c.69.1.25 (A:) Acetyl xylan esterase TM0077 {Therm 4e-18
d2bgra2258 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26 8e-16
d1l7aa_318 c.69.1.25 (A:) Cephalosporin C deacetylase {Bacill 4e-15
d1qfma2280 c.69.1.4 (A:431-710) Prolyl oligopeptidase, C-term 1e-13
d2hu7a2260 c.69.1.33 (A:322-581) Acylamino-acid-releasing enz 2e-12
d2gzsa1265 c.69.1.38 (A:41-305) Enterobactin and salmochelin 2e-12
d2d81a1 318 c.69.1.37 (A:21-338) Polyhydroxybutyrate depolymer 2e-12
d1ufoa_238 c.69.1.27 (A:) Hypothetical protein TT1662 {Thermu 6e-11
d1thta_302 c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase 8e-11
d1lnsa3405 c.69.1.21 (A:146-550) X-Prolyl dipeptidyl aminopep 1e-10
d1jjia_311 c.69.1.2 (A:) Carboxylesterase {Archaeon Archaeogl 3e-10
d1sfra_288 c.69.1.3 (A:) Antigen 85a {Mycobacterium tuberculo 5e-10
d1lzla_317 c.69.1.2 (A:) Heroin esterase {Rhodococcus sp. [Ta 3e-08
d1vkha_263 c.69.1.32 (A:) Putative serine hydrolase Ydr428c { 9e-08
d1qlwa_318 c.69.1.15 (A:) A novel bacterial esterase {Alcalig 2e-07
d3c8da2246 c.69.1.2 (A:151-396) Enterochelin esterase, cataly 3e-07
d2b9va2385 c.69.1.21 (A:50-434) Alpha-amino acid ester hydrol 2e-06
d1jkma_358 c.69.1.2 (A:) Carboxylesterase {Bacillus subtilis, 2e-06
d1mpxa2381 c.69.1.21 (A:24-404) Alpha-amino acid ester hydrol 6e-06
d1u4na_308 c.69.1.2 (A:) Carboxylesterase {Alicyclobacillus a 1e-05
d1r88a_267 c.69.1.3 (A:) Antigen pt51/mpb51 {Mycobacterium tu 3e-05
d1tqha_242 c.69.1.29 (A:) Carboxylesterase Est {Bacillus stea 4e-05
d1tcaa_317 c.69.1.17 (A:) Triacylglycerol lipase {Yeast (Cand 4e-05
d1dqza_280 c.69.1.3 (A:) Antigen 85c {Mycobacterium tuberculo 7e-05
d1wb4a1273 c.69.1.2 (A:803-1075) Feruloyl esterase domain of 9e-05
d2h1ia1202 c.69.1.14 (A:1-202) Carboxylesterase {Bacillus cer 3e-04
d3b5ea1209 c.69.1.14 (A:7-215) Uncharacterized protein Mll837 3e-04
d2r8ba1203 c.69.1.14 (A:44-246) Uncharacterized protein Atu24 4e-04
d1jfra_260 c.69.1.16 (A:) Lipase {Streptomyces exfoliatus [Ta 6e-04
>d1xfda2 c.69.1.24 (A:592-849) Dipeptidyl aminopeptidase-like protein 6, DPP6, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 258 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: DPP6 catalytic domain-like
domain: Dipeptidyl aminopeptidase-like protein 6, DPP6, C-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 90.2 bits (222), Expect = 1e-20
 Identities = 32/237 (13%), Positives = 82/237 (34%), Gaps = 14/237 (5%)

Query: 593 PLIVVLHGGPHSVSLS---SYSKSLAFLSSVGYSLLIVNYRGSLGFGEEALQSLPGKVGS 649
           PL++V+ G P S S++     S     +SS G  ++  + RGS   G + L  +  ++G 
Sbjct: 32  PLLLVVDGTPGSQSVAEKFEVSWETVMVSSHGAVVVKCDGRGSGFQGTKLLHEVRRRLGL 91

Query: 650 QDVNDVLTAIDHVIDMGLANPSKVTVVGGSHGGFLTTHLIGQAPDKFVAAAARNPLCNLA 709
            +  D + A+  ++     + ++V V G  +GG+L+T+++    +            +  
Sbjct: 92  LEEKDQMEAVRTMLKEQYIDRTRVAVFGKDYGGYLSTYILPAKGENQGQTFTCGSALSPI 151

Query: 710 LMVGTTDIPDWCYVESYGSKGKDSFTESPSVEDLTRFHSKSPISHISKVKTPTIFLLGAQ 769
                                  ++  +     ++    +  +                 
Sbjct: 152 TDFKLYASAFSERYLGLHGLDNRAYEMTKVAHRVSALEEQQFLIIHPT-----------A 200

Query: 770 DLRVPVSNGLQYARALREKGVETKVIVFPNDVHGIERPQSDFESFLNIGLWFKKYCK 826
           D ++   +  +    L        + ++P++ H           + +I  +F +  +
Sbjct: 201 DEKIHFQHTAELITQLIRGKANYSLQIYPDESHYFTSSSLKQHLYRSIINFFVECFR 257
>d1vlqa_ c.69.1.25 (A:) Acetyl xylan esterase TM0077 {Thermotoga maritima [TaxId: 2336]} Length = 322 Back     information, alignment and structure
>d2bgra2 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Length = 258 Back     information, alignment and structure
>d1l7aa_ c.69.1.25 (A:) Cephalosporin C deacetylase {Bacillus subtilis [TaxId: 1423]} Length = 318 Back     information, alignment and structure
>d1qfma2 c.69.1.4 (A:431-710) Prolyl oligopeptidase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Length = 280 Back     information, alignment and structure
>d2hu7a2 c.69.1.33 (A:322-581) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix [TaxId: 56636]} Length = 260 Back     information, alignment and structure
>d2gzsa1 c.69.1.38 (A:41-305) Enterobactin and salmochelin hydrolase IroE {Escherichia coli [TaxId: 562]} Length = 265 Back     information, alignment and structure
>d2d81a1 c.69.1.37 (A:21-338) Polyhydroxybutyrate depolymerase {Penicillium funiculosum [TaxId: 28572]} Length = 318 Back     information, alignment and structure
>d1ufoa_ c.69.1.27 (A:) Hypothetical protein TT1662 {Thermus thermophilus [TaxId: 274]} Length = 238 Back     information, alignment and structure
>d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]} Length = 302 Back     information, alignment and structure
>d1lnsa3 c.69.1.21 (A:146-550) X-Prolyl dipeptidyl aminopeptidase PepX, middle domain {Lactococcus lactis [TaxId: 1358]} Length = 405 Back     information, alignment and structure
>d1jjia_ c.69.1.2 (A:) Carboxylesterase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 311 Back     information, alignment and structure
>d1sfra_ c.69.1.3 (A:) Antigen 85a {Mycobacterium tuberculosis [TaxId: 1773]} Length = 288 Back     information, alignment and structure
>d1lzla_ c.69.1.2 (A:) Heroin esterase {Rhodococcus sp. [TaxId: 1831]} Length = 317 Back     information, alignment and structure
>d1vkha_ c.69.1.32 (A:) Putative serine hydrolase Ydr428c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 263 Back     information, alignment and structure
>d1qlwa_ c.69.1.15 (A:) A novel bacterial esterase {Alcaligenes sp. [TaxId: 512]} Length = 318 Back     information, alignment and structure
>d3c8da2 c.69.1.2 (A:151-396) Enterochelin esterase, catalytic domain {Shigella flexneri 2a str. 2457T [TaxId: 198215]} Length = 246 Back     information, alignment and structure
>d2b9va2 c.69.1.21 (A:50-434) Alpha-amino acid ester hydrolase {Acetobacter pasteurianus [TaxId: 438]} Length = 385 Back     information, alignment and structure
>d1jkma_ c.69.1.2 (A:) Carboxylesterase {Bacillus subtilis, brefeldin A esterase [TaxId: 1423]} Length = 358 Back     information, alignment and structure
>d1mpxa2 c.69.1.21 (A:24-404) Alpha-amino acid ester hydrolase {Xanthomonas citri [TaxId: 346]} Length = 381 Back     information, alignment and structure
>d1u4na_ c.69.1.2 (A:) Carboxylesterase {Alicyclobacillus acidocaldarius [TaxId: 405212]} Length = 308 Back     information, alignment and structure
>d1r88a_ c.69.1.3 (A:) Antigen pt51/mpb51 {Mycobacterium tuberculosis [TaxId: 1773]} Length = 267 Back     information, alignment and structure
>d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]} Length = 242 Back     information, alignment and structure
>d1tcaa_ c.69.1.17 (A:) Triacylglycerol lipase {Yeast (Candida antarctica), form b [TaxId: 34362]} Length = 317 Back     information, alignment and structure
>d1dqza_ c.69.1.3 (A:) Antigen 85c {Mycobacterium tuberculosis [TaxId: 1773]} Length = 280 Back     information, alignment and structure
>d1wb4a1 c.69.1.2 (A:803-1075) Feruloyl esterase domain of the cellulosomal xylanase y {Clostridium thermocellum [TaxId: 1515]} Length = 273 Back     information, alignment and structure
>d2h1ia1 c.69.1.14 (A:1-202) Carboxylesterase {Bacillus cereus [TaxId: 1396]} Length = 202 Back     information, alignment and structure
>d3b5ea1 c.69.1.14 (A:7-215) Uncharacterized protein Mll8374 {Mesorhizobium loti [TaxId: 381]} Length = 209 Back     information, alignment and structure
>d2r8ba1 c.69.1.14 (A:44-246) Uncharacterized protein Atu2452 {Agrobacterium tumefaciens [TaxId: 358]} Length = 203 Back     information, alignment and structure
>d1jfra_ c.69.1.16 (A:) Lipase {Streptomyces exfoliatus [TaxId: 1905]} Length = 260 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query826
d2hu7a2260 Acylamino-acid-releasing enzyme, C-terminal donain 100.0
d1xfda2258 Dipeptidyl aminopeptidase-like protein 6, DPP6, C- 99.97
d2bgra2258 Dipeptidyl peptidase IV/CD26, C-terminal domain {P 99.97
d1qfma2280 Prolyl oligopeptidase, C-terminal domain {Pig (Sus 99.93
d1l7aa_318 Cephalosporin C deacetylase {Bacillus subtilis [Ta 99.92
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 99.91
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 99.91
d1vlqa_322 Acetyl xylan esterase TM0077 {Thermotoga maritima 99.9
d2jbwa1360 2,6-dihydropseudooxynicotine hydrolase {Arthrobact 99.9
d1jfra_260 Lipase {Streptomyces exfoliatus [TaxId: 1905]} 99.87
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.86
d2fuka1218 XC6422 protein {Xanthomonas campestris [TaxId: 339 99.85
d1thta_302 Myristoyl-ACP-specific thioesterase {Vibrio harvey 99.84
d1lzla_317 Heroin esterase {Rhodococcus sp. [TaxId: 1831]} 99.83
d1ufoa_238 Hypothetical protein TT1662 {Thermus thermophilus 99.83
d1dina_233 Dienelactone hydrolase {Pseudomonas sp., B13 [TaxI 99.82
d2pbla1261 Uncharacterized protein TM1040_2492 {Silicibacter 99.81
d2h1ia1202 Carboxylesterase {Bacillus cereus [TaxId: 1396]} 99.81
d1jkma_358 Carboxylesterase {Bacillus subtilis, brefeldin A e 99.8
d1lnsa3405 X-Prolyl dipeptidyl aminopeptidase PepX, middle do 99.8
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 99.8
d1u4na_308 Carboxylesterase {Alicyclobacillus acidocaldarius 99.79
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 99.79
d1q0ra_297 Aclacinomycin methylesterase RdmC {Streptomyces pu 99.79
d1imja_208 Ccg1/TafII250-interacting factor B (Cib) {Human (H 99.79
d1vkha_263 Putative serine hydrolase Ydr428c {Baker's yeast ( 99.79
d1jjia_311 Carboxylesterase {Archaeon Archaeoglobus fulgidus 99.79
d1mtza_290 Tricorn interacting factor F1 {Archaeon Thermoplas 99.78
d1ju3a2347 Bacterial cocaine esterase N-terminal domain {Rhod 99.78
d1c4xa_281 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 99.77
d1tqha_242 Carboxylesterase Est {Bacillus stearothermophilus 99.77
d1mpxa2381 Alpha-amino acid ester hydrolase {Xanthomonas citr 99.77
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.76
d1k8qa_377 Gastric lipase {Dog (Canis familiaris) [TaxId: 961 99.76
d1fj2a_229 Acyl protein thioesterase 1 {Human (Homo sapiens) 99.76
d2i3da1218 Hypothetical protein Atu1826 {Agrobacterium tumefa 99.76
d1a8qa_274 Bromoperoxidase A1 {Streptomyces aureofaciens [Tax 99.76
d3b5ea1209 Uncharacterized protein Mll8374 {Mesorhizobium lot 99.75
d1uk8a_271 Meta-cleavage product hydrolase CumD {Pseudomonas 99.74
d2rhwa1283 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 99.73
d1a88a_275 Chloroperoxidase L {Streptomyces lividans [TaxId: 99.73
d1j1ia_268 Meta cleavage compound hydrolase CarC {Janthinobac 99.73
d1zd3a2322 Mammalian epoxide hydrolase, C-terminal domain {Hu 99.73
d1va4a_271 Arylesterase {Pseudomonas fluorescens [TaxId: 294] 99.73
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 99.72
d1xkla_258 Salicylic acid-binding protein 2 (SABP2) {Common t 99.72
d1bn7a_291 Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1 99.72
d1a8sa_273 Chloroperoxidase F {Pseudomonas fluorescens [TaxId 99.72
d1brta_277 Bromoperoxidase A2 {Streptomyces aureofaciens [Tax 99.71
d2r8ba1203 Uncharacterized protein Atu2452 {Agrobacterium tum 99.71
d1uxoa_186 Hypothetical protein YdeN {Bacillus subtilis [TaxI 99.71
d1b6ga_310 Haloalkane dehalogenase {Xanthobacter autotrophicu 99.7
d2b9va2385 Alpha-amino acid ester hydrolase {Acetobacter past 99.69
d3c70a1256 Hydroxynitrile lyase {Rubber tree (Hevea brasilien 99.69
d1ehya_293 Bacterial epoxide hydrolase {Agrobacterium radioba 99.69
d2gzsa1265 Enterobactin and salmochelin hydrolase IroE {Esche 99.69
d1jjfa_255 Feruloyl esterase domain of the cellulosomal xylan 99.69
d3c8da2246 Enterochelin esterase, catalytic domain {Shigella 99.68
d1azwa_313 Proline iminopeptidase {Xanthomonas campestris, pv 99.68
d1m33a_256 Biotin biosynthesis protein BioH {Escherichia coli 99.68
d1hkha_279 Gamma-lactamase {Aureobacterium sp. [TaxId: 51671] 99.67
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 99.66
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.65
d1sfra_288 Antigen 85a {Mycobacterium tuberculosis [TaxId: 17 99.65
d1auoa_218 Carboxylesterase {Pseudomonas fluorescens [TaxId: 99.64
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.62
d1wm1a_313 Proline aminopeptidase {Serratia marcescens [TaxId 99.61
d1r3da_264 Hypothetical protein VC1974 {Vibrio cholerae [TaxI 99.57
d1mj5a_298 Haloalkane dehalogenase {Sphingomonas paucimobilis 99.53
d1qlwa_318 A novel bacterial esterase {Alcaligenes sp. [TaxId 99.52
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 99.52
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 99.48
d1wb4a1273 Feruloyl esterase domain of the cellulosomal xylan 99.46
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.43
d1dqza_280 Antigen 85c {Mycobacterium tuberculosis [TaxId: 17 99.42
d1r88a_267 Antigen pt51/mpb51 {Mycobacterium tuberculosis [Ta 99.42
d1pjaa_268 Palmitoyl protein thioesterase 2 {Human (Homo sapi 99.4
d1pv1a_299 Hypothetical esterase YJL068C {Baker's yeast (Sacc 99.39
d1qo7a_394 Bacterial epoxide hydrolase {Aspergillus niger [Ta 99.38
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.37
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.33
d1ispa_179 Lipase A {Bacillus subtilis [TaxId: 1423]} 99.31
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 99.31
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 99.3
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.3
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 99.27
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.27
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 99.26
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 99.25
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.24
d2b61a1357 Homoserine O-acetyltransferase {Haemophilus influe 99.23
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.21
d2pl5a1362 Homoserine O-acetyltransferase {Leptospira interro 99.21
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 99.19
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.18
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.16
d1jmkc_230 Surfactin synthetase, SrfA {Bacillus subtilis [Tax 99.14
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 99.13
d2d81a1 318 Polyhydroxybutyrate depolymerase {Penicillium funi 99.13
d2h7xa1283 Picromycin polyketide synthase {Streptomyces venez 99.1
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.08
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 99.07
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.07
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.07
d1tbga_340 beta1-subunit of the signal-transducing G protein 99.06
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.04
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 99.04
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.03
d2vata1376 Acetyl-CoA:deacetylcephalosporin C acetyltransfera 99.03
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.03
d1tcaa_317 Triacylglycerol lipase {Yeast (Candida antarctica) 99.02
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 98.96
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 98.94
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 98.94
d1qfma1430 Prolyl oligopeptidase, N-terminal domain {Pig (Sus 98.91
d2h7ca1 532 Mammalian carboxylesterase (liver carboxylesterase 98.9
d1tbga_340 beta1-subunit of the signal-transducing G protein 98.9
d1cvla_319 Lipase {Chromobacterium viscosum [TaxId: 42739]} 98.86
d1qe3a_ 483 Thermophilic para-nitrobenzyl esterase (PNB estera 98.81
d1thga_ 544 Type-B carboxylesterase/lipase {Fungus (Geotrichum 98.81
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 98.79
d1ex9a_285 Lipase {Pseudomonas aeruginosa [TaxId: 287]} 98.79
d1xkta_286 Fatty acid synthase {Human (Homo sapiens) [TaxId: 98.79
d1llfa_ 534 Type-B carboxylesterase/lipase {Candida cylindrace 98.78
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 98.77
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 98.74
d1ukca_ 517 Esterase EstA {Aspergillus niger [TaxId: 5061]} 98.71
d2hu7a1313 Acylamino-acid-releasing enzyme, N-terminal donain 98.7
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 98.7
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 98.67
d2ha2a1 542 Acetylcholinesterase {Mouse (Mus musculus) [TaxId: 98.64
d1ea5a_ 532 Acetylcholinesterase {Pacific electric ray (Torped 98.64
d2bcea_ 579 Bile-salt activated lipase (cholesterol esterase) 98.62
d1dx4a_ 571 Acetylcholinesterase {Fruit fly (Drosophila melano 98.62
d1p0ia_ 526 Butyryl cholinesterase {Human (Homo sapiens) [TaxI 98.6
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 98.59
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 98.58
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 98.57
d1mo2a_255 Erythromycin polyketide synthase {Saccharopolyspor 98.56
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 98.47
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 98.47
d2dsta1122 Hypothetical protein TTHA1544 {Thermus thermophilu 98.44
d1qfma1430 Prolyl oligopeptidase, N-terminal domain {Pig (Sus 98.41
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 98.34
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 98.25
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 98.25
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 98.2
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 98.19
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 98.18
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 98.15
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 98.13
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 98.09
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 97.98
d1rp1a2337 Pancreatic lipase, N-terminal domain {Dog (Canis f 97.97
d1ei9a_279 Palmitoyl protein thioesterase 1 {Cow (Bos taurus) 97.95
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 97.92
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 97.86
d1bu8a2338 Pancreatic lipase, N-terminal domain {Rat (Rattus 97.85
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 97.8
g1wht.1 409 Serine carboxypeptidase II {Wheat (Triticum vulgar 97.8
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 97.67
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 97.65
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 97.57
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 97.54
d1ac5a_ 483 Serine carboxypeptidase II {Baker's yeast (Sacchar 97.47
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 97.39
d1wpxa1 421 Serine carboxypeptidase II {Baker's yeast (Sacchar 97.28
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 97.18
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 97.11
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 96.94
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 96.9
d2hu7a1313 Acylamino-acid-releasing enzyme, N-terminal donain 96.84
g1gxs.1 425 Hydroxynitrile lyase {Sorghum (Sorghum bicolor) [T 96.74
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 96.71
d1ivya_ 452 Human 'protective protein', HPP {Human (Homo sapie 96.67
d1ku0a_ 388 Lipase L1 {Bacillus stearothermophilus [TaxId: 142 96.66
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 95.58
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 94.17
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 90.88
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 90.73
d1lgya_265 Triacylglycerol lipase {Rhizopus niveus [TaxId: 48 87.96
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 87.6
d1uwca_261 Feruloyl esterase A {Aspergillus niger [TaxId: 506 87.16
d3tgla_265 Triacylglycerol lipase {Rhizomucor miehei [TaxId: 86.25
d1tiba_269 Triacylglycerol lipase {Thermomyces lanuginosus, f 85.41
d1tiaa_271 Triacylglycerol lipase {Penicillium camembertii [T 85.33
d1cexa_197 Cutinase {Fungus (Fusarium solani), subsp. pisi [T 85.0
d1crua_450 Soluble quinoprotein glucose dehydrogenase {Acinet 83.6
>d2hu7a2 c.69.1.33 (A:322-581) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Acylamino-acid-releasing enzyme, C-terminal donain
domain: Acylamino-acid-releasing enzyme, C-terminal donain
species: Aeropyrum pernix [TaxId: 56636]

Probab=100.00  E-value=3.9e-32  Score=279.30  Aligned_cols=244  Identities=23%  Similarity=0.360  Sum_probs=209.3

Q ss_pred             eeccCCCeeEEEEEEecCCCCCCCCCcEEEEEcCCCCCCCCccchHHHHHHHHCCcEEEEECCCCCCCCchhhhhcCCCC
Q 003363          567 NLTKGAQKPFEAIFVSSSHKKDCSCDPLIVVLHGGPHSVSLSSYSKSLAFLSSVGYSLLIVNYRGSLGFGEEALQSLPGK  646 (826)
Q Consensus       567 ~~~~~~g~~l~~~~~~P~~~~~~~~~P~vv~~HGg~~~~~~~~~~~~~~~la~~G~~Vl~~d~rG~~g~G~~~~~~~~~~  646 (826)
                      .+.+.||.+++++++.|++  ..++.|+||++|||++......|...++.|+++||+|+++|+|+.+++|.++.......
T Consensus        16 ~~~s~dG~~i~~~l~~p~~--~~~~~Pviv~~HGG~~~~~~~~~~~~~~~la~~G~~v~~~d~r~~~~~g~~~~~~~~~~   93 (260)
T d2hu7a2          16 WVESFDGSRVPTYVLESGR--APTPGPTVVLVHGGPFAEDSDSWDTFAASLAAAGFHVVMPNYRGSTGYGEEWRLKIIGD   93 (260)
T ss_dssp             EEECTTSCEEEEEEEEETT--SCSSEEEEEEECSSSSCCCCSSCCHHHHHHHHHTCEEEEECCTTCSSSCHHHHHTTTTC
T ss_pred             EEECCCCCEEEEEEEeCCC--CCCCceEEEEECCCCccCCCccccHHHHHHHhhccccccceeeeccccccccccccccc
Confidence            4567788999999999975  55788999999998887767778888999999999999999999999999998888888


Q ss_pred             CCcchHHHHHHHHHHHHHcCCCCCCcEEEEEecchHHHHHHHHHhCCCceeEEEecCCccchhhhccCCCCCCchhhhhc
Q 003363          647 VGSQDVNDVLTAIDHVIDMGLANPSKVTVVGGSHGGFLTTHLIGQAPDKFVAAAARNPLCNLALMVGTTDIPDWCYVESY  726 (826)
Q Consensus       647 ~~~~~~~D~~~~i~~l~~~~~~d~~rv~l~G~S~GG~~a~~~a~~~p~~~~a~v~~~p~~~~~~~~~~~~~~~~~~~~~~  726 (826)
                      ++..+++|+.++++++.++.  +.++++|+|+|+||++++.++..+|+.+++++..+|+.++..+..........+....
T Consensus        94 ~~~~~~~D~~~~~~~l~~~~--~~~~~~i~g~s~gg~~~~~~~~~~~~~~~a~i~~~~~~~~~~~~~~~~~~~~~~~~~~  171 (260)
T d2hu7a2          94 PCGGELEDVSAAARWARESG--LASELYIMGYSYGGYMTLCALTMKPGLFKAGVAGASVVDWEEMYELSDAAFRNFIEQL  171 (260)
T ss_dssp             TTTHHHHHHHHHHHHHHHTT--CEEEEEEEEETHHHHHHHHHHHHSTTSSSEEEEESCCCCHHHHHHTCCHHHHHHHHHH
T ss_pred             cchhhhhhhccccccccccc--ccceeeccccccccccccchhccCCcccccccccccchhhhhhhcccccccccccccc
Confidence            88888999999999999874  6789999999999999999999999999999999999987766543322111111110


Q ss_pred             cCcCCccCCCCCChhhHHHHhhcCcccccCCCCCcEEEEEeCCCCCCCcHHHHHHHHHHHhCCCCEEEEEeCCCCCCCCC
Q 003363          727 GSKGKDSFTESPSVEDLTRFHSKSPISHISKVKTPTIFLLGAQDLRVPVSNGLQYARALREKGVETKVIVFPNDVHGIER  806 (826)
Q Consensus       727 ~~~~~~~~~~~~~~~~~~~~~~~sp~~~~~~i~~PvLii~G~~D~~vp~~~~~~~~~~l~~~g~~~~~~~~p~~~H~~~~  806 (826)
                                  .....+.+...+|...++++++|+|++||+.|..||+.++.+++++|+++|+++++++||+++|++..
T Consensus       172 ------------~~~~~~~~~~~~~~~~~~~~~~P~liihG~~D~~vp~~~~~~~~~~l~~~~~~~~~~~~~g~~H~~~~  239 (260)
T d2hu7a2         172 ------------TGGSREIMRSRSPINHVDRIKEPLALIHPQNDSRTPLKPLLRLMGELLARGKTFEAHIIPDAGHAINT  239 (260)
T ss_dssp             ------------HCSCHHHHHHTCGGGCGGGCCSCEEEEEETTCSSSCSHHHHHHHHHHHHTTCCEEEEEETTCCSSCCB
T ss_pred             ------------cccccccccccchhhcccccCCCceeeecccCceecHHHHHHHHHHHHHCCCCeEEEEECcCCCCCCC
Confidence                        01234567788999999999999999999999999999999999999999999999999999999988


Q ss_pred             CCCHHHHHHHHHHHHHHHcC
Q 003363          807 PQSDFESFLNIGLWFKKYCK  826 (826)
Q Consensus       807 ~~~~~~~~~~i~~w~~~~l~  826 (826)
                      .++..+++..+++||.+|||
T Consensus       240 ~e~~~~~~~~~~~fl~~hl~  259 (260)
T d2hu7a2         240 MEDAVKILLPAVFFLATQRE  259 (260)
T ss_dssp             HHHHHHHHHHHHHHHHHHHH
T ss_pred             hHhHHHHHHHHHHHHHHHhc
Confidence            78888899999999999985
>d1xfda2 c.69.1.24 (A:592-849) Dipeptidyl aminopeptidase-like protein 6, DPP6, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bgra2 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1qfma2 c.69.1.4 (A:431-710) Prolyl oligopeptidase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1l7aa_ c.69.1.25 (A:) Cephalosporin C deacetylase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vlqa_ c.69.1.25 (A:) Acetyl xylan esterase TM0077 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2jbwa1 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine hydrolase {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1jfra_ c.69.1.16 (A:) Lipase {Streptomyces exfoliatus [TaxId: 1905]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2fuka1 c.69.1.36 (A:3-220) XC6422 protein {Xanthomonas campestris [TaxId: 339]} Back     information, alignment and structure
>d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]} Back     information, alignment and structure
>d1lzla_ c.69.1.2 (A:) Heroin esterase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d1ufoa_ c.69.1.27 (A:) Hypothetical protein TT1662 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1dina_ c.69.1.9 (A:) Dienelactone hydrolase {Pseudomonas sp., B13 [TaxId: 306]} Back     information, alignment and structure
>d2pbla1 c.69.1.2 (A:1-261) Uncharacterized protein TM1040_2492 {Silicibacter sp. tm1040 [TaxId: 292414]} Back     information, alignment and structure
>d2h1ia1 c.69.1.14 (A:1-202) Carboxylesterase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1jkma_ c.69.1.2 (A:) Carboxylesterase {Bacillus subtilis, brefeldin A esterase [TaxId: 1423]} Back     information, alignment and structure
>d1lnsa3 c.69.1.21 (A:146-550) X-Prolyl dipeptidyl aminopeptidase PepX, middle domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u4na_ c.69.1.2 (A:) Carboxylesterase {Alicyclobacillus acidocaldarius [TaxId: 405212]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vkha_ c.69.1.32 (A:) Putative serine hydrolase Ydr428c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jjia_ c.69.1.2 (A:) Carboxylesterase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1ju3a2 c.69.1.21 (A:5-351) Bacterial cocaine esterase N-terminal domain {Rhodococcus sp. mb1 [TaxId: 51612]} Back     information, alignment and structure
>d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]} Back     information, alignment and structure
>d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1mpxa2 c.69.1.21 (A:24-404) Alpha-amino acid ester hydrolase {Xanthomonas citri [TaxId: 346]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1fj2a_ c.69.1.14 (A:) Acyl protein thioesterase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i3da1 c.69.1.36 (A:2-219) Hypothetical protein Atu1826 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d3b5ea1 c.69.1.14 (A:7-215) Uncharacterized protein Mll8374 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d2rhwa1 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]} Back     information, alignment and structure
>d1a88a_ c.69.1.12 (A:) Chloroperoxidase L {Streptomyces lividans [TaxId: 1916]} Back     information, alignment and structure
>d1j1ia_ c.69.1.10 (A:) Meta cleavage compound hydrolase CarC {Janthinobacterium sp. J3 [TaxId: 213804]} Back     information, alignment and structure
>d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1va4a_ c.69.1.12 (A:) Arylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1xkla_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1bn7a_ c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d1a8sa_ c.69.1.12 (A:) Chloroperoxidase F {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d2r8ba1 c.69.1.14 (A:44-246) Uncharacterized protein Atu2452 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1uxoa_ c.69.1.31 (A:) Hypothetical protein YdeN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]} Back     information, alignment and structure
>d2b9va2 c.69.1.21 (A:50-434) Alpha-amino acid ester hydrolase {Acetobacter pasteurianus [TaxId: 438]} Back     information, alignment and structure
>d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]} Back     information, alignment and structure
>d1ehya_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]} Back     information, alignment and structure
>d2gzsa1 c.69.1.38 (A:41-305) Enterobactin and salmochelin hydrolase IroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jjfa_ c.69.1.2 (A:) Feruloyl esterase domain of the cellulosomal xylanase z {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d3c8da2 c.69.1.2 (A:151-396) Enterochelin esterase, catalytic domain {Shigella flexneri 2a str. 2457T [TaxId: 198215]} Back     information, alignment and structure
>d1azwa_ c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas campestris, pv. citri [TaxId: 339]} Back     information, alignment and structure
>d1m33a_ c.69.1.26 (A:) Biotin biosynthesis protein BioH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hkha_ c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1sfra_ c.69.1.3 (A:) Antigen 85a {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1auoa_ c.69.1.14 (A:) Carboxylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1wm1a_ c.69.1.7 (A:) Proline aminopeptidase {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1r3da_ c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1mj5a_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]} Back     information, alignment and structure
>d1qlwa_ c.69.1.15 (A:) A novel bacterial esterase {Alcaligenes sp. [TaxId: 512]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wb4a1 c.69.1.2 (A:803-1075) Feruloyl esterase domain of the cellulosomal xylanase y {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1dqza_ c.69.1.3 (A:) Antigen 85c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1r88a_ c.69.1.3 (A:) Antigen pt51/mpb51 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1pjaa_ c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pv1a_ c.69.1.34 (A:) Hypothetical esterase YJL068C {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qo7a_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1ispa_ c.69.1.18 (A:) Lipase A {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2b61a1 c.69.1.40 (A:2-358) Homoserine O-acetyltransferase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2pl5a1 c.69.1.40 (A:5-366) Homoserine O-acetyltransferase {Leptospira interrogans [TaxId: 173]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jmkc_ c.69.1.22 (C:) Surfactin synthetase, SrfA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2d81a1 c.69.1.37 (A:21-338) Polyhydroxybutyrate depolymerase {Penicillium funiculosum [TaxId: 28572]} Back     information, alignment and structure
>d2h7xa1 c.69.1.22 (A:9-291) Picromycin polyketide synthase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2vata1 c.69.1.40 (A:7-382) Acetyl-CoA:deacetylcephalosporin C acetyltransferase CefG {Acremonium chrysogenum [TaxId: 5044]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1tcaa_ c.69.1.17 (A:) Triacylglycerol lipase {Yeast (Candida antarctica), form b [TaxId: 34362]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2h7ca1 c.69.1.1 (A:1021-1553) Mammalian carboxylesterase (liver carboxylesterase I) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1cvla_ c.69.1.18 (A:) Lipase {Chromobacterium viscosum [TaxId: 42739]} Back     information, alignment and structure
>d1qe3a_ c.69.1.1 (A:) Thermophilic para-nitrobenzyl esterase (PNB esterase) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1thga_ c.69.1.17 (A:) Type-B carboxylesterase/lipase {Fungus (Geotrichum candidum), ATCC 34614 [TaxId: 27317]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1ex9a_ c.69.1.18 (A:) Lipase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1xkta_ c.69.1.22 (A:) Fatty acid synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1llfa_ c.69.1.17 (A:) Type-B carboxylesterase/lipase {Candida cylindracea, cholesterol esterase [TaxId: 44322]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ukca_ c.69.1.17 (A:) Esterase EstA {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d2hu7a1 b.69.7.2 (A:9-321) Acylamino-acid-releasing enzyme, N-terminal donain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d2ha2a1 c.69.1.1 (A:1-542) Acetylcholinesterase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ea5a_ c.69.1.1 (A:) Acetylcholinesterase {Pacific electric ray (Torpedo californica) [TaxId: 7787]} Back     information, alignment and structure
>d2bcea_ c.69.1.1 (A:) Bile-salt activated lipase (cholesterol esterase) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1dx4a_ c.69.1.1 (A:) Acetylcholinesterase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1p0ia_ c.69.1.1 (A:) Butyryl cholinesterase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mo2a_ c.69.1.22 (A:) Erythromycin polyketide synthase {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d2dsta1 c.69.1.39 (A:2-123) Hypothetical protein TTHA1544 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1rp1a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1ei9a_ c.69.1.13 (A:) Palmitoyl protein thioesterase 1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bu8a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ac5a_ c.69.1.5 (A:) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae), kex1(delta)p [TaxId: 4932]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wpxa1 c.69.1.5 (A:1-421) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hu7a1 b.69.7.2 (A:9-321) Acylamino-acid-releasing enzyme, N-terminal donain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ivya_ c.69.1.5 (A:) Human 'protective protein', HPP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ku0a_ c.69.1.18 (A:) Lipase L1 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1lgya_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizopus niveus [TaxId: 4844]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1uwca_ c.69.1.17 (A:) Feruloyl esterase A {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d3tgla_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizomucor miehei [TaxId: 4839]} Back     information, alignment and structure
>d1tiba_ c.69.1.17 (A:) Triacylglycerol lipase {Thermomyces lanuginosus, formerly Humicola lanuginosa [TaxId: 5541]} Back     information, alignment and structure
>d1tiaa_ c.69.1.17 (A:) Triacylglycerol lipase {Penicillium camembertii [TaxId: 5075]} Back     information, alignment and structure
>d1cexa_ c.69.1.30 (A:) Cutinase {Fungus (Fusarium solani), subsp. pisi [TaxId: 169388]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure