Citrus Sinensis ID: 003400


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820---
MKQFFDHSSGPPKIPQLNIPKEVGGGSCGRIAGSDSYLASDDASLFSSSLPVLPHEKLNLNAMGLGRQSVDDISSGLSKVHHGVASDDPLEGVMNPAIGNSLPDDEDELLAGIMDDFDLRGLPSSLEDLEDYDIFGSGGGMELEGEPQESLSMSMSKISISDSASGNGLLHYSVPNGAGTVAGEHPYGEHPSRTLFVRNINSNVEDSELRALFEQYGDIRTLYTACKHRGFVMISYYDIRAARTAMRALQNKPLRRRKLDIHFSIPKDNPSDKDLNQGTLVVFNLDPSVSNEDLRQIFGAYGEVKEIRETPHKRHHKFIEFYDVRAAEAALKSLNRSDIAGKRIKLEPSRPGGARRNLMLQLNQELEQDESRILQHQVGSPITNSPPGNWVQFSSPIEHNPLQTISKSPNFRNMSPTTSNHMPGLASILHPQVSTLEKIAPIGKDQGRGSLMEHALTNTISANGASFQQSNSFSEPKIGLYRGTVSSFGPSPSNGSGVETLSGPQFLWGSPSRYSEHSSSPAWQTSSMGHPFSSNGKIHGLPYSGRQGSFLGSSQHHHVGSAPSGVPLERRFGFLPESPETSFMNPVAFCGMGIGQNDGSFMVNMGSRASVNPGITVPRNLSDNGSSFRVMSSPRLSPVFLGNGPYPGLTPANIEGLYERGRSRRIENNNGNQLDSKKQFQLELEKIRSGEDTRTTLMIKNIPNKYTSKMLLAAIDENHKGTYDFLYLPIDFKNKCNVGYAFINMLSPLHIIPFYEAFNGKKWEKFNSEKVASLAYARIQGRAALVAHFQNSSLMNEDKRCRPILFHSEGPEAGDQVMQLTFP
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEccccccccHHHHHHHHcccccEEEEEEccccccEEEEEEccHHHHHHHHHHHcccccccEEEEEEEccccccccccccccEEEEEEcccccccHHHHHHHHcccccEEEcccccccccEEEEEEccHHHHHHHHHHHccccccccEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHcHHHHHcccccccHHHHHcccccHHHHHHHHHHHHcccccccEEEEccccccccccEEEEEEccccccHHHHHHHHccccccccccccEEEEEEHHHHcHHHHHHHHccccccccccccccEEEccccccccccccccccc
cccccccccccccccccccccccccccccccccccccccccHHHHHHHccccccEEEEEEccccccccccccEEEcccccccHHHHHHccHHHcccccHEccccccHHHHHcccccEEEccccccccHHHHHHHccccccEEEEEccccccccEEEEEEcccHHHHccHHHcccccEccccccccccccccccEEEEEcccccccHHHHHHHHHHcccEEEEEEEcccccEEEEEcccHHHHHHHHHHHccccccccEEEEEEccccccccHcccccEEEEEEcccccccHHHHHHHHcccccEEEEEEcccccccEEEEcccHHHHHHHHHHHcccHccccEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHcccccccccccccccccccEEEEcHHHHHcccccccEEEEEcccccHHHHHHHHHHHHHccccEEEEEEEcccccccccEEEEEEcccHHHHHHHHHHHcccccEcccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccEEEccccccccccEEEcccc
mkqffdhssgppkipqlnipkevgggscgriagsdsylasddaslfssslpvlpheklnlnamglgrqsvddissglskvhhgvasddplegvmnpaignslpddeDELLAGimddfdlrglpssledledydifgsgggmelegepqeslsmsmskisisdsasgngllhysvpngagtvagehpygehpsrtLFVRNINSNVEDSELRALFEQYGDIRTLYTACKHRGFVMISYYDIRAARTAMRALQnkplrrrkldihfsipkdnpsdkdlnqgtlvvfnldpsvsnedLRQIFGAYGevkeiretphkrhhkFIEFYDVRAAEAALKSLnrsdiagkriklepsrpggarRNLMLQLNQELEQDESRILqhqvgspitnsppgnwvqfsspiehnplqtiskspnfrnmspttsnhmpglasilhpqvstlekiapigkdqgrgslMEHALTntisangasfqqsnsfsepkiglyrgtvssfgpspsngsgvetlsgpqflwgspsrysehssspawqtssmghpfssngkihglpysgrqgsflgssqhhhvgsapsgvplerrfgflpespetsfmnpvafcgmgigqndgsfmvnmgsrasvnpgitvprnlsdngssfrvmssprlspvflgngpypgltpanieGLYERGrsrriennngnqldsKKQFQLELEKIrsgedtrtTLMIKNIPNKYTSKMLLAAIDEnhkgtydflylpidfknkcnVGYAFINmlsplhiipfyeafngkkwekfNSEKVASLAYARIQGRAALVAHFqnsslmnedkrcrpilfhsegpeagdqVMQLTFP
mkqffdhssgppkipqlniPKEVGGGSCGRIAGSDSYLASDDASLFSSSLPVLPHEKLNLNAMGLGRQSVDDISSGLSKVHHGVASDDPLEGVMNPAIGNSLPDDEDELLAGIMDDFDLRGLPSSLEDLEDYDIFGSGGGMELEGEPQESLSMSMSKISISDSASGNGLLHYSVPNGAGTVAGEHPYGEHPSRTLFVRNINSNVEDSELRALFEQYGDIRTLYTACKHRGFVMISYYDIRAARTAMRalqnkplrrrKLDIhfsipkdnpsdkdlnQGTLVVFNldpsvsneDLRQIFGAYGEvkeiretphkrhhKFIEFYDVRAAEAALKslnrsdiagkriklepsrpggarrNLMLQLNQELEQDESRILQHQVGSPITNSPPGNWVQFSSPIEHNPLQTISKSPNFRNMSPTTSNHMPGLASILHPQVSTLEKIAPIGKDQGRGSLMEHALTNTISANGASFQQSNSFSEPKIGLYRGTVSSFGPSPSNGSGVETLSGPQFLWGSPSRYSEHSSSPAWQTSSMGHPFSSNGKIHGLPYSGRQGSFLGSSQHHHVGSAPSGVPLERRFGFLPESPETSFMNPVAFCGMGIGQNDGSFMVNMGSRASVNPGITVPRNLSDNGSSFRVMSSPRLSPVFLGNGPYPGLTPANIEGLYERGRSRriennngnqldskkqFQLELEkirsgedtrttlmiknipnkYTSKMLLAAIDENHKGTYDFLYLPIDFKNKCNVGYAFINMLSPLHIIPFYEAFNGKKWEKFNSEKVASLAYARIQGRAALVAHFQNSSLMNEDKRCRPILFhsegpeagdqVMQLTFP
MKQFFDHSSGPPKIPQLNIPKEVGGGSCGRIagsdsylasddaslfssslPVLPHEKLNLNAMGLGRQSVDDISSGLSKVHHGVASDDPLEGVMNPAIGNSLPDDEDELLAGIMDDFDLRGLPSSLEDLEDYDIFGSGGGMELEGEPQEslsmsmskisisdsasGNGLLHYSVPNGAGTVAGEHPYGEHPSRTLFVRNINSNVEDSELRALFEQYGDIRTLYTACKHRGFVMISYYDIRAARTAMRALQNKPLRRRKLDIHFSIPKDNPSDKDLNQGTLVVFNLDPSVSNEDLRQIFGAYGEVKEIRETPHKRHHKFIEFYDVRAAEAALKSLNRSDIAGKRIKLEPSRPGGARRNLMlqlnqeleqdeSRILQHQVGSPITNSPPGNWVQFSSPIEHNPLQTISKSPNFRNMSPTTSNHMPGLASILHPQVSTLEKIAPIGKDQGRGSLMEHALTNTISANGASFQQSNSFSEPKIGLYRGTVssfgpspsngsgVETLSGPQFLWGspsrysehsssPAWQTSSMGHPFSSNGKIHGLPYSGRQGSFLGSSQHHHVGSAPSGVPLERRFGFLPESPETSFMNPVAFCGMGIGQNDGSFMVNMGSRASVNPGITVPRNLSDNGSSFRVMSSPRLSPVFLGNGPYPGLTPANIEGLYERGRSRRIENNNGNQLDSKKQFQLELEKIRSGEDTRTTLMIKNIPNKYTSKMLLAAIDENHKGTYDFLYLPIDFKNKCNVGYAFINMLSPLHIIPFYEAFNGKKWEKFNSEKVASLAYARIQGRAALVAHFQNSSLMNEDKRCRPILFHSEGPEAGDQVMQLTFP
************************************************************************************************************LLAGIMDDFDLRGL********DYDIF**********************************LHYSV******************RTLFVRNINSNVEDSELRALFEQYGDIRTLYTACKHRGFVMISYYDIRAARTAMRALQNK*LR*RKLDIHF*************QGTLVVFNLDPSVSNEDLRQIFGAYGEVKEIRETPHKRHHKFIEFYDVRAAEAALK**********************************************************************************************************************************************************************************************************************************************************FMNPVAFCGMGIGQNDGSFMVN**********************************VFLGNGPYPGLT***I****************************************TTLMIKNIPNKYTSKMLLAAIDENHKGTYDFLYLPIDFKNKCNVGYAFINMLSPLHIIPFYEAFNGKKWEKFNSEKVASLAYARIQGRAALVAHFQNSSL******CRPILF*****************
***************************************SDDASLFSSSLPVLPHEKLN*************************************AIGNSLPDDEDELLAGIMDDFDLRGLPSSLEDLEDYDIFGSGGGMELEGEPQES***************************************H**RTLFVRNINSNVEDSELRALFEQYGDIRTLYTACKHRGFVMISYYDIRAARTAMRALQNKPLRRRKLDI******************LVVFNLDPSVSNEDLRQIFGAYGEVKEIRETPHKRHHKFIEFYDVRAAEAALKSLNRSDIAGKRIKLEPSRPG*************************************WVQFSSPI*******************************************************************************************************************************************************************************************************************************************************************************************QLELEKIRSGEDTRTTLMIKNIPNKYTSKMLLAAIDENHKGTYDFLYLPIDFKNKCNVGYAFINMLSPLHIIPFYEAFNGKKWEKFNSEKVASLAYARIQGRAALVAHFQNSSLMNEDKRCRPILFHSEGP************
**********PPKIPQLNIPKEVGGGSCGRIAGSDSYLASDDASLFSSSLPVLPHEKLNLNAMGLGRQSVDDISSGLSKVHHGVASDDPLEGVMNPAIGNSLPDDEDELLAGIMDDFDLRGLPSSLEDLEDYDIFGSGGGMEL**********SMSKISISDSASGNGLLHYSVPNGAGTVAGEHPYGEHPSRTLFVRNINSNVEDSELRALFEQYGDIRTLYTACKHRGFVMISYYDIRAARTAMRALQNKPLRRRKLDIHFSIPKDNPSDKDLNQGTLVVFNLDPSVSNEDLRQIFGAYGEVKEIRETPHKRHHKFIEFYDVRAAEAALKSLNRSDIAGKRIKLEPSRPGGARRNLMLQLNQELEQDESRILQHQVGSPITNSPPGNWVQFSSPIEHNPLQTISKSPNFRNMSPTTSNHMPGLASILHPQVSTLEKIAPIGKDQGRGSLMEHALTNTISANGASFQQSNSFSEPKIGLYRGTVSSFGPSPSNGSGVETLSGPQFLWGS*******************HPFSSNGKIHGLPYSGRQGSFLG************GVPLERRFGFLPESPETSFMNPVAFCGMGIGQNDGSFMVNMGSRASVNPGITVPRNLSDNGSSFRVMSSPRLSPVFLGNGPYPGLTPANIEGLYERGRSRRIENNNGNQLDSKKQFQLELEKIRSGEDTRTTLMIKNIPNKYTSKMLLAAIDENHKGTYDFLYLPIDFKNKCNVGYAFINMLSPLHIIPFYEAFNGKKWEKFNSEKVASLAYARIQGRAALVAHFQNSSLMNEDKRCRPILFHSEGPEAGDQVMQLTFP
**************************SCGRIAGSDSYLASDDASLFSSSLPVLPHEKLNLNAMGLGRQSVDDISSGLSKVHHGVASDDPLEGVMNPAIGNSLPDDEDELLAGIMDDFDLRGLPSSLEDLEDYDIFGSGGGMELEGEPQESLSMSMSKISISDSASGNGLLHYSVPNGAGTVAGEHPYGEHPSRTLFVRNINSNVEDSELRALFEQYGDIRTLYTACKHRGFVMISYYDIRAARTAMRALQNKPLRRRKLDIHFSIPKDNPSDKDLNQGTLVVFNLDPSVSNEDLRQIFGAYGEVKEIRETPHKRHHKFIEFYDVRAAEAALKSLNRSDIAGKRIKLEPSRPGGARRNLMLQLNQELEQDESRILQHQVGSPITNSPPGNWVQFSSPIEHNPLQTISKSPNFRNMSPTTSNHMPGLASILHPQVSTLEKIAPI*****************************SFSEPKIGLYRGTVSSFGPSPSNGSGVETLSGPQFLWGSPSRYSEHSSSPAWQTSSMGHPFSSNGKIHGLPYSGRQGSFLGSSQHHHVGSAPSGVPLERRFGFLPESPETSFMNPVAFCGMGIGQNDGSFMVNMGSRASVNPGITVPRNLSDNGSSFRVMSSPRLSPVFLGNGPYPGLTPANIEGLYERGRSR*********LDSKKQFQLELEKIRSGEDTRTTLMIKNIPNKYTSKMLLAAIDENHKGTYDFLYLPIDFKNKCNVGYAFINMLSPLHIIPFYEAFNGKKWEKFNSEKVASLAYARIQGRAALVAHFQNSSLMNEDKRCRPILFHSEGPEAGDQVMQ**F*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKQFFDHSSGPPKIPQLNIPKEVGGGSCGRIAGSDSYLASDDASLFSSSLPVLPHEKLNLNAMGLGRQSVDDISSGLSKVHHGVASDDPLEGVMNPAIGNSLPDDEDELLAGIMDDFDLRGLPSSLEDLEDYDIFGSGGGMELEGEPQESLSMSMSKISISDSASGNGLLHYSVPNGAGTVAGEHPYGEHPSRTLFVRNINSNVEDSELRALFEQYGDIRTLYTACKHRGFVMISYYDIRAARTAMRALQNKPLRRRKLDIHFSIPKDNPSDKDLNQGTLVVFNLDPSVSNEDLRQIFGAYGEVKEIRETPHKRHHKFIEFYDVRAAEAALKSLNRSDIAGKRIKLEPSRPGGARRNLMLQLNQELEQDESRILQHQVGSPITNSPPGNWVQFSSPIEHNPLQTISKSPNFRNMSPTTSNHMPGLASILHPQVSTLEKIAPIGKDQGRGSLMEHALTNTISANGASFQQSNSFSEPKIGLYRGTVSSFGPSPSNGSGVETLSGPQFLWGSPSRYSEHSSSPAWQTSSMGHPFSSNGKIHGLPYSGRQGSFLGSSQHHHVGSAPSGVPLERRFGFLPESPETSFMNPVAFCGMGIGQNDGSFMVNMGSRASVNPGITVPRNLSDNGSSFRVMSSPRLSPVFLGNGPYPGLTPANIEGLYERGRSRRIENNNGNQLDSKKQFQLELEKIRSGEDTRTTLMIKNIPNKYTSKMLLAAIDENHKGTYDFLYLPIDFKNKCNVGYAFINMLSPLHIIPFYEAFNGKKWEKFNSEKVASLAYARIQGRAALVAHFQNSSLMNEDKRCRPILFHSEGPEAGDQVMQLTFP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query823 2.2.26 [Sep-21-2011]
Q6ZI17848 Protein MEI2-like 2 OS=Or yes no 0.911 0.884 0.620 0.0
Q8VWF5800 Protein MEI2-like 5 OS=Ar yes no 0.930 0.957 0.619 0.0
Q9SVV9759 Protein MEI2-like 3 OS=Ar no no 0.871 0.944 0.577 0.0
Q6EQX3811 Protein MEI2-like 5 OS=Or no no 0.930 0.944 0.510 0.0
Q9SJG8843 Protein MEI2-like 2 OS=Ar no no 0.900 0.879 0.486 0.0
Q75M35955 Protein MEI2-like 3 OS=Or no no 0.844 0.727 0.414 1e-134
Q64M781001 Protein MEI2-like 4 OS=Or no no 0.402 0.330 0.540 1e-79
Q9LYN7907 Protein MEI2-like 4 OS=Ar no no 0.309 0.281 0.569 5e-72
Q8W4I9915 Protein MEI2-like 1 OS=Ar no no 0.291 0.262 0.494 1e-58
P08965750 Meiosis protein mei2 OS=S yes no 0.168 0.185 0.535 5e-37
>sp|Q6ZI17|OML2_ORYSJ Protein MEI2-like 2 OS=Oryza sativa subsp. japonica GN=ML2 PE=2 SV=1 Back     alignment and function desciption
 Score =  928 bits (2398), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 487/785 (62%), Positives = 578/785 (73%), Gaps = 35/785 (4%)

Query: 42  DASLFSSSLPVLPHEKLNLNAMGLGRQSVDDISSGLSKVHHGVASDDPLEGVMNPAIGNS 101
           +ASLFS+SLPVLPHEK+N      G   +DD S+ L ++       D         I + 
Sbjct: 47  NASLFSTSLPVLPHEKINFLDSARGTPLMDDASAKLKELDDDPEGKDYKFDFDLRQIDDL 106

Query: 102 LPDDEDELLAGIMDDFDLRGLPSSLEDLEDYDIFGSGGGMELEGEPQESLSMSMSKISIS 161
           LP+ ED+L AGI ++ +  G  +S+E+LE++D+FGSGGGMEL+ +P ES++  +   SI+
Sbjct: 107 LPN-EDDLFAGITNEIEPAGQTNSMEELEEFDVFGSGGGMELDTDPVESITAGLGNTSIA 165

Query: 162 DSASGNGLLHYSVPNGAGTVAGEHPYGEHPSRTLFVRNINSNVEDSELRALFEQYGDIRT 221
           D   GNG+ H+   N A TVAGEHPYGEHPSRTLFVRNINSNV+D+ELR+LFEQYGDIRT
Sbjct: 166 DGLRGNGVNHFGPSNSASTVAGEHPYGEHPSRTLFVRNINSNVDDTELRSLFEQYGDIRT 225

Query: 222 LYTACKHRGFVMISYYDIRAARTAMRALQNKPLRRRKLDIHFSIPKDNPSDKDLNQGTLV 281
           LYTA KHRGFVMISY+DIRAAR AMR LQNKPLRRRKLDIHFSIPK+NPSDKDLNQGTLV
Sbjct: 226 LYTATKHRGFVMISYFDIRAARGAMRGLQNKPLRRRKLDIHFSIPKENPSDKDLNQGTLV 285

Query: 282 VFNLDPSVSNEDLRQIFGAYGEVKEIRETPHKRHHKFIEFYDVRAAEAALKSLNRSDIAG 341
           +FNLDPSVSNE++RQIFG YGEVKEIRETP+K+HHKFIEFYDVRAAEAAL+SLN+S+IAG
Sbjct: 286 IFNLDPSVSNEEVRQIFGTYGEVKEIRETPNKKHHKFIEFYDVRAAEAALRSLNKSEIAG 345

Query: 342 KRIKLEPSRPGGARRNLMLQLNQELEQDESRILQ-HQVGSPITNSPPGNWVQFSSPIEHN 400
           KRIKLEPSRPGG RRNLM QL  +++QDE R  +   VGSPI +SPPG W Q+SSP ++N
Sbjct: 346 KRIKLEPSRPGGTRRNLMQQLGHDIDQDEPRSYRIPHVGSPIASSPPGAWAQYSSPTDNN 405

Query: 401 PLQTISKSPNFRNMSPTTSNHMPGLASILHPQVSTLEKIAPIGKDQGRGSLMEHALTNTI 460
            LQ  + SP    MSP       G+   L   +S   KIAPIGKD    S  +   +N  
Sbjct: 406 LLQAFNASPTGNGMSPI------GMPPSL---ISNAVKIAPIGKDS-NWSKYDKVFSNNN 455

Query: 461 SANGASFQQSNSFSEPKIGLYRGTVSSFGPSPSNGSGVETLSGPQFLWGSPSRYSEHSSS 520
             +GA+FQ S+S+ + K             S    S   TL+GP+FLWGSP  YSEH+ S
Sbjct: 456 QPHGAAFQHSHSYQDHK-------------SEHMSSSPGTLTGPEFLWGSPKPYSEHAQS 502

Query: 521 PAWQTSSMGHPFSSNGKI--HGLPYSGRQGSFLGSS---QHHHVGSAPSGVPLERRFGFL 575
           P W+  ++GH   SN +    GL Y GRQ S  GS     HHHVGSAPSG P E  FGFL
Sbjct: 503 PIWRPPAIGHAIPSNTRSQGQGLLYGGRQASLFGSQDQLHHHHVGSAPSGAPFESHFGFL 562

Query: 576 PESPETSFMNPVAF---CGMGIGQNDGSFMVNMGSRASVNPGITVPRNLSDNG-SSFRVM 631
           PESPETS+MN V F     +G G+N    M+NM +RASVNP   +  N+SDN  SSFR +
Sbjct: 563 PESPETSYMNQVRFGNIGNIGSGRNGTGLMLNMAARASVNPVSALSGNMSDNNSSSFRPI 622

Query: 632 SSPRLSPVFLGNGPYPGLTPANIEGLYERGRSRRIENNNGNQLDSKKQFQLELEKIRSGE 691
            SPRL   F GN  Y G     ++   ERGR+RR++++   Q DSKKQ+QL+LEKIR G+
Sbjct: 623 LSPRLGQSFYGNPTYQGPGSFGLDNSIERGRNRRVDSSVF-QADSKKQYQLDLEKIRKGD 681

Query: 692 DTRTTLMIKNIPNKYTSKMLLAAIDENHKGTYDFLYLPIDFKNKCNVGYAFINMLSPLHI 751
           DTRTTLMIKNIPNKYTSKMLLAAIDE HKGTYDF YLPIDFKNKCNVGYAFINM+SP+HI
Sbjct: 682 DTRTTLMIKNIPNKYTSKMLLAAIDEFHKGTYDFFYLPIDFKNKCNVGYAFINMISPVHI 741

Query: 752 IPFYEAFNGKKWEKFNSEKVASLAYARIQGRAALVAHFQNSSLMNEDKRCRPILFHSEGP 811
           + FY+AFNGKKWEKFNSEKVASLAYARIQGR AL++HFQNSSLMNEDKRCRPILFHS GP
Sbjct: 742 VSFYQAFNGKKWEKFNSEKVASLAYARIQGRTALISHFQNSSLMNEDKRCRPILFHSNGP 801

Query: 812 EAGDQ 816
           +AG+Q
Sbjct: 802 DAGNQ 806




Probable RNA-binding protein that may play a role in growth regulation.
Oryza sativa subsp. japonica (taxid: 39947)
>sp|Q8VWF5|AML5_ARATH Protein MEI2-like 5 OS=Arabidopsis thaliana GN=ML5 PE=1 SV=1 Back     alignment and function description
>sp|Q9SVV9|AML3_ARATH Protein MEI2-like 3 OS=Arabidopsis thaliana GN=ML3 PE=2 SV=2 Back     alignment and function description
>sp|Q6EQX3|OML5_ORYSJ Protein MEI2-like 5 OS=Oryza sativa subsp. japonica GN=ML5 PE=2 SV=1 Back     alignment and function description
>sp|Q9SJG8|AML2_ARATH Protein MEI2-like 2 OS=Arabidopsis thaliana GN=ML2 PE=2 SV=2 Back     alignment and function description
>sp|Q75M35|OML3_ORYSJ Protein MEI2-like 3 OS=Oryza sativa subsp. japonica GN=ML3 PE=2 SV=2 Back     alignment and function description
>sp|Q64M78|OML4_ORYSJ Protein MEI2-like 4 OS=Oryza sativa subsp. japonica GN=ML4 PE=2 SV=1 Back     alignment and function description
>sp|Q9LYN7|AML4_ARATH Protein MEI2-like 4 OS=Arabidopsis thaliana GN=ML4 PE=1 SV=1 Back     alignment and function description
>sp|Q8W4I9|AML1_ARATH Protein MEI2-like 1 OS=Arabidopsis thaliana GN=ML1 PE=1 SV=1 Back     alignment and function description
>sp|P08965|MEI2_SCHPO Meiosis protein mei2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mei2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query823
47834701858 AML1 [Citrus unshiu] 0.995 0.954 0.991 0.0
225463378860 PREDICTED: protein MEI2-like 2-like [Vit 0.981 0.939 0.776 0.0
356556525862 PREDICTED: protein MEI2-like 2-like [Gly 0.990 0.945 0.762 0.0
356530557862 PREDICTED: protein MEI2-like 2-like [Gly 0.990 0.945 0.753 0.0
359485142842 PREDICTED: protein MEI2-like 2-like [Vit 0.970 0.948 0.726 0.0
357450609865 Polyadenylate-binding protein [Medicago 0.995 0.946 0.716 0.0
297740630787 unnamed protein product [Vitis vinifera] 0.867 0.907 0.695 0.0
356567420857 PREDICTED: protein MEI2-like 2-like [Gly 0.976 0.938 0.692 0.0
357450611764 Polyadenylate-binding protein [Medicago 0.872 0.939 0.742 0.0
449444985846 PREDICTED: protein MEI2-like 2-like [Cuc 0.978 0.951 0.682 0.0
>gi|47834701|gb|AAT39004.1| AML1 [Citrus unshiu] Back     alignment and taxonomy information
 Score = 1669 bits (4323), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 812/819 (99%), Positives = 817/819 (99%)

Query: 1   MKQFFDHSSGPPKIPQLNIPKEVGGGSCGRIAGSDSYLASDDASLFSSSLPVLPHEKLNL 60
           MKQFFDHSSGPPKIPQLNIPKEVGGGSCGRIAGSDSYLASDDASLFSSSLPVLPHEKLNL
Sbjct: 1   MKQFFDHSSGPPKIPQLNIPKEVGGGSCGRIAGSDSYLASDDASLFSSSLPVLPHEKLNL 60

Query: 61  NAMGLGRQSVDDISSGLSKVHHGVASDDPLEGVMNPAIGNSLPDDEDELLAGIMDDFDLR 120
           NAMGLGRQSVD+ISSGLSKVHHGV+SDDPLEG+MNPAIGNSLPDDEDELLAGIMDDFDLR
Sbjct: 61  NAMGLGRQSVDNISSGLSKVHHGVSSDDPLEGIMNPAIGNSLPDDEDELLAGIMDDFDLR 120

Query: 121 GLPSSLEDLEDYDIFGSGGGMELEGEPQESLSMSMSKISISDSASGNGLLHYSVPNGAGT 180
           GLPSSLEDLEDYDIFGSGGGMELEGEPQESLSMSMSKISISDSASGNGLLHYSVPNGAGT
Sbjct: 121 GLPSSLEDLEDYDIFGSGGGMELEGEPQESLSMSMSKISISDSASGNGLLHYSVPNGAGT 180

Query: 181 VAGEHPYGEHPSRTLFVRNINSNVEDSELRALFEQYGDIRTLYTACKHRGFVMISYYDIR 240
           VAGEHPYGEHPSRTLFVRNINSNVEDSELRALFEQYGDIRTLYTACKHRGFVMISYYDIR
Sbjct: 181 VAGEHPYGEHPSRTLFVRNINSNVEDSELRALFEQYGDIRTLYTACKHRGFVMISYYDIR 240

Query: 241 AARTAMRALQNKPLRRRKLDIHFSIPKDNPSDKDLNQGTLVVFNLDPSVSNEDLRQIFGA 300
           AARTAMRALQNKPLRRRKLDIHFSIPKDNPSDKDLNQGTLVVFNLDPSVSNEDLRQIFGA
Sbjct: 241 AARTAMRALQNKPLRRRKLDIHFSIPKDNPSDKDLNQGTLVVFNLDPSVSNEDLRQIFGA 300

Query: 301 YGEVKEIRETPHKRHHKFIEFYDVRAAEAALKSLNRSDIAGKRIKLEPSRPGGARRNLML 360
           YGEVKEIRETPHKRHHKFIEFYDVRAAEAALKSLNRSDIAGKRIKLEPSRPGGARRNLML
Sbjct: 301 YGEVKEIRETPHKRHHKFIEFYDVRAAEAALKSLNRSDIAGKRIKLEPSRPGGARRNLML 360

Query: 361 QLNQELEQDESRILQHQVGSPITNSPPGNWVQFSSPIEHNPLQTISKSPNFRNMSPTTSN 420
           QLNQELEQDESRILQHQVGSPITNSPPGNWVQFSSPIEHNPLQTISKSPNFRNMSPTTSN
Sbjct: 361 QLNQELEQDESRILQHQVGSPITNSPPGNWVQFSSPIEHNPLQTISKSPNFRNMSPTTSN 420

Query: 421 HMPGLASILHPQVSTLEKIAPIGKDQGRGSLMEHALTNTISANGASFQQSNSFSEPKIGL 480
           HMPGLASILHPQVSTLEKIAPIGKDQGRGSLMEHALTNTISANGASFQQSNSFSEPKIGL
Sbjct: 421 HMPGLASILHPQVSTLEKIAPIGKDQGRGSLMEHALTNTISANGASFQQSNSFSEPKIGL 480

Query: 481 YRGTVSSFGPSPSNGSGVETLSGPQFLWGSPSRYSEHSSSPAWQTSSMGHPFSSNGKIHG 540
           YRGTVSSFGPSPSNGSGVETLSGPQFLWGSPSRYSEHSSSPAWQTSSMGHPFSSNGKIHG
Sbjct: 481 YRGTVSSFGPSPSNGSGVETLSGPQFLWGSPSRYSEHSSSPAWQTSSMGHPFSSNGKIHG 540

Query: 541 LPYSGRQGSFLGSSQHHHVGSAPSGVPLERRFGFLPESPETSFMNPVAFCGMGIGQNDGS 600
           LPYSGRQGSFLGSSQHHH+GSAPSGVPLERRFGFLPESPETSFMNPVAFCGMGIGQNDGS
Sbjct: 541 LPYSGRQGSFLGSSQHHHIGSAPSGVPLERRFGFLPESPETSFMNPVAFCGMGIGQNDGS 600

Query: 601 FMVNMGSRASVNPGITVPRNLSDNGSSFRVMSSPRLSPVFLGNGPYPGLTPANIEGLYER 660
           FMVNMGSRASVNPGITVPRNLSDNGSSFRVMSSPRLSPVFLGNGPYPGLTPAN EGLYER
Sbjct: 601 FMVNMGSRASVNPGITVPRNLSDNGSSFRVMSSPRLSPVFLGNGPYPGLTPANSEGLYER 660

Query: 661 GRSRRIENNNGNQLDSKKQFQLELEKIRSGEDTRTTLMIKNIPNKYTSKMLLAAIDENHK 720
           GRSRRIENNNGNQ+DSKKQFQLELEKIRSGEDTRTTLMIKNIPNKYTSKMLLAAIDENHK
Sbjct: 661 GRSRRIENNNGNQIDSKKQFQLELEKIRSGEDTRTTLMIKNIPNKYTSKMLLAAIDENHK 720

Query: 721 GTYDFLYLPIDFKNKCNVGYAFINMLSPLHIIPFYEAFNGKKWEKFNSEKVASLAYARIQ 780
           GTYDFLYLPIDFKNKCNVGYAFINMLSPLHIIPFYEAFNGKKWEKFNSEKVASLAYARIQ
Sbjct: 721 GTYDFLYLPIDFKNKCNVGYAFINMLSPLHIIPFYEAFNGKKWEKFNSEKVASLAYARIQ 780

Query: 781 GRAALVAHFQNSSLMNEDKRCRPILFHSEGPEAGDQVMQ 819
           GRAALVAHFQNSSLMNEDKRCRPILFHSEGPEAGDQV Q
Sbjct: 781 GRAALVAHFQNSSLMNEDKRCRPILFHSEGPEAGDQVTQ 819




Source: Citrus unshiu

Species: Citrus unshiu

Genus: Citrus

Family: Rutaceae

Order: Sapindales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225463378|ref|XP_002271605.1| PREDICTED: protein MEI2-like 2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|356556525|ref|XP_003546575.1| PREDICTED: protein MEI2-like 2-like [Glycine max] Back     alignment and taxonomy information
>gi|356530557|ref|XP_003533847.1| PREDICTED: protein MEI2-like 2-like [Glycine max] Back     alignment and taxonomy information
>gi|359485142|ref|XP_002279792.2| PREDICTED: protein MEI2-like 2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|357450609|ref|XP_003595581.1| Polyadenylate-binding protein [Medicago truncatula] gi|47834691|gb|AAT38999.1| AML5 [Medicago truncatula] gi|87241360|gb|ABD33218.1| RNA-binding region RNP-1 (RNA recognition motif); RNA recognition motif 2 [Medicago truncatula] gi|355484629|gb|AES65832.1| Polyadenylate-binding protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|297740630|emb|CBI30812.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356567420|ref|XP_003551918.1| PREDICTED: protein MEI2-like 2-like [Glycine max] Back     alignment and taxonomy information
>gi|357450611|ref|XP_003595582.1| Polyadenylate-binding protein [Medicago truncatula] gi|355484630|gb|AES65833.1| Polyadenylate-binding protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|449444985|ref|XP_004140254.1| PREDICTED: protein MEI2-like 2-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query823
TAIR|locus:2013583800 ML5 "MEI2-like protein 5" [Ara 0.770 0.792 0.514 1.7e-162
TAIR|locus:2156166915 ML1 "MEI2-like protein 1" [Ara 0.312 0.280 0.566 4.5e-139
TAIR|locus:2182885907 ML4 "MEI2-like 4" [Arabidopsis 0.313 0.284 0.566 9.3e-131
TAIR|locus:2117706759 ML3 "MEI2-like 3" [Arabidopsis 0.726 0.787 0.457 7.8e-126
TAIR|locus:2045605843 ML2 "MEI2-like 2" [Arabidopsis 0.686 0.670 0.448 7.7e-119
TAIR|locus:2090350615 TEL1 "terminal EAR1-like 1" [A 0.113 0.151 0.526 6.9e-52
TAIR|locus:2008530527 TEL2 "terminal EAR1-like 2" [A 0.139 0.218 0.446 6.1e-45
POMBASE|SPAC27D7.03c750 mei2 "RNA-binding protein invo 0.168 0.185 0.535 1.9e-39
DICTYBASE|DDB_G02792551698 DDB_G0279255 [Dictyostelium di 0.123 0.060 0.470 3.2e-34
GENEDB_PFALCIPARUM|PFF1125c427 PFF1125c "RNA-binding protein 0.138 0.266 0.495 3.4e-25
TAIR|locus:2013583 ML5 "MEI2-like protein 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1582 (562.0 bits), Expect = 1.7e-162, P = 1.7e-162
 Identities = 348/676 (51%), Positives = 429/676 (63%)

Query:    17 LNIPKEVGGGSCGRIXXXXXXXX-XXXXXXXXXXXPVLPHEKLNLNAMGLGRQSVDDISS 75
             ++IP E   G+ G +                    PV P  KL L+    G   +DD  +
Sbjct:     1 MDIPHEAEAGAWGILPGFGRHHHPSSDATLFSSSLPVFPRGKLQLSDNRDGFSLIDD--T 58

Query:    76 GLSKVHHGVASDDPLEGVMNPAIGNSLPDDEDELLAGIMDDFDLRGLPSSLEDLEDYDIF 135
              +S+ +    S D  E   + +IGN LPD+ED LL G+MDD DL  LP    D +DYD+F
Sbjct:    59 AVSRTNKFNESADDFE---SHSIGNLLPDEED-LLTGMMDDLDLGELP----DADDYDLF 110

Query:   136 GSGGGMELEGEPQEXXXXXXXXXXXXXXXXGNGLLHYSVPNGAGTVAGEHPYGEHPSRTL 195
             GSGGGMEL+ + ++                GN +  +++PNGAGTVAGEHPYGEHPSRTL
Sbjct:   111 GSGGGMELDADFRDNLSMSGPPRLSLSSLGGNAIPQFNIPNGAGTVAGEHPYGEHPSRTL 170

Query:   196 FVRNINSNVEDSELRALFEQYGDIRTLYTACKHRGFVMISYYDIRAARTAMRALQNKPLR 255
             FVRNINSNVEDSEL ALFEQYGDIRTLYT CKHRGFVMISYYDIR+AR AMR+LQNKPLR
Sbjct:   171 FVRNINSNVEDSELTALFEQYGDIRTLYTTCKHRGFVMISYYDIRSARMAMRSLQNKPLR 230

Query:   256 RRKLDIHFSIPKDNPSDKDLNQGTLVVFNLDPSVSNEDLRQIFGAYGEVKEIRETPHKRH 315
             RRKLDIHFSIPKDNPS+KD+NQGTLVVFNLDPS+SN+DL  IFGA+GE+KEIRETPHKRH
Sbjct:   231 RRKLDIHFSIPKDNPSEKDMNQGTLVVFNLDPSISNDDLHGIFGAHGEIKEIRETPHKRH 290

Query:   316 HKFIEFYDVRAAEAALKSLNRSDIAGKRIKLEPSRPGGARRNLMXXXXXXXXXXXSRILQ 375
             HKF+EFYDVR AEAALK+LNR +IAGKRIK+EPSRPGGARR+LM              L 
Sbjct:   291 HKFVEFYDVRGAEAALKALNRCEIAGKRIKVEPSRPGGARRSLMLQLNQDLENDDLHYLP 350

Query:   376 HQVGSPITNSPP--GNWVQFSSPIEHNPLQTI-SKSPNFRNMSPTTSNHMPGLASILHPQ 432
               +GSP+ NSPP  GNW   +SP+E +PLQ++ S+SP F  +SPT + H+ GLAS L+ Q
Sbjct:   351 -MIGSPMANSPPMQGNW-PLNSPVEGSPLQSVLSRSPVF-GLSPTRNGHLSGLASALNSQ 407

Query:   433 VSTLEKIAPIGKDQGRGSLMEHALTNTISANGASFQQSNS-FSEPKI-GLYRGTVXXXXX 490
               +  K+APIG+ Q             I +NG  FQQS+  F EPK+   Y G +     
Sbjct:   408 GPS-SKLAPIGRGQ-------------IGSNG--FQQSSHLFQEPKMDNKYTGNLSPSGP 451

Query:   491 XXXXXXXVETLSGPQFLWGXXXXXXXXXXXPAWQTSSMGHPFSSNGKIHGLPYSGRQGSF 550
                    +ETLSG +FLWG             W TSS G+P  S      +P+  +  + 
Sbjct:   452 LISNGGGIETLSGSEFLWGSPNARSEPSSSSVWSTSSTGNPLFSTRVDRSVPFPHQHQNQ 511

Query:   551 LGSSQHHHVGSAPSGVPLERRFGFLPESPETS-FMNPVAFCGM-GIGQNDGSFMVNMGSR 608
               S  H HVGSAPSGVPLE+ FGF+PES + + FMN V   GM G+G N GSF   M + 
Sbjct:   512 SRSHHHFHVGSAPSGVPLEKHFGFVPESSKDALFMNTVGLQGMSGMGLNGGSFSSKMANN 571

Query:   609 ASVNPGITVPRNLSDNGSSFRVMSSPRLSPVFLGNGPYPGLTPANIEGLYERGRSRRIEN 668
               +N G ++  N     SS+R+MSSPR SP+FL +G  PG   +  + LYE GR RR+EN
Sbjct:   572 GIINSG-SMAEN---GFSSYRMMSSPRFSPMFLSSGLNPGRFASGFDSLYENGRPRRVEN 627

Query:   669 NNGNQLDSKK-QFQLE 683
             N+      K+ Q  LE
Sbjct:   628 NSNQVESRKQFQLDLE 643


GO:0000166 "nucleotide binding" evidence=IEA
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0003723 "RNA binding" evidence=ISS
GO:0005634 "nucleus" evidence=ISM
GO:0045836 "positive regulation of meiosis" evidence=IMP
GO:0045927 "positive regulation of growth" evidence=IMP
GO:0006635 "fatty acid beta-oxidation" evidence=RCA
GO:0016558 "protein import into peroxisome matrix" evidence=RCA
TAIR|locus:2156166 ML1 "MEI2-like protein 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2182885 ML4 "MEI2-like 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2117706 ML3 "MEI2-like 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2045605 ML2 "MEI2-like 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2090350 TEL1 "terminal EAR1-like 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2008530 TEL2 "terminal EAR1-like 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
POMBASE|SPAC27D7.03c mei2 "RNA-binding protein involved in meiosis Mei2" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0279255 DDB_G0279255 [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
GENEDB_PFALCIPARUM|PFF1125c PFF1125c "RNA-binding protein mei2 homologue, putative" [Plasmodium falciparum (taxid:5833)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8VWF5AML5_ARATHNo assigned EC number0.61990.93070.9575yesno
Q6ZI17OML2_ORYSJNo assigned EC number0.62030.91130.8844yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query823
pfam0405997 pfam04059, RRM_2, RNA recognition motif 2 6e-65
cd1253186 cd12531, RRM3_MEI2_like, RNA recognition motif 3 i 9e-63
cd1252477 cd12524, RRM1_MEI2_like, RNA recognition motif 1 i 2e-49
cd1252971 cd12529, RRM2_MEI2_like, RNA recognition motif 2 i 6e-44
cd1227786 cd12277, RRM3_MEI2_EAR1_like, RNA recognition moti 4e-43
cd12530101 cd12530, RRM3_EAR1_like, RNA recognition motif 3 i 3e-38
cd1253290 cd12532, RRM3_MEI2_fungi, RNA recognition motif 3 6e-37
cd1227671 cd12276, RRM2_MEI2_EAR1_like, RNA recognition moti 9e-32
cd1252771 cd12527, RRM2_EAR1_like, RNA recognition motif 2 i 3e-31
cd1227571 cd12275, RRM1_MEI2_EAR1_like, RNA recognition moti 2e-28
smart0036073 smart00360, RRM, RNA recognition motif 9e-16
cd0059072 cd00590, RRM_SF, RNA recognition motif (RRM) super 2e-15
pfam0007670 pfam00076, RRM_1, RNA recognition motif 9e-14
cd1252477 cd12524, RRM1_MEI2_like, RNA recognition motif 1 i 4e-12
cd1227671 cd12276, RRM2_MEI2_EAR1_like, RNA recognition moti 4e-12
smart0036073 smart00360, RRM, RNA recognition motif 5e-12
cd1224678 cd12246, RRM1_U1A_like, RNA recognition motif 1 in 8e-12
cd0059072 cd00590, RRM_SF, RNA recognition motif (RRM) super 2e-11
cd1239978 cd12399, RRM_HP0827_like, RNA recognition motif in 2e-11
cd1238280 cd12382, RRM_RBMX_like, RNA recognition motif in h 9e-11
cd1222474 cd12224, RRM_RBM22, RNA recognition motif (RRM) fo 1e-10
pfam1389356 pfam13893, RRM_5, RNA recognition motif 5e-10
cd1231284 cd12312, RRM_SRSF10_SRSF12, RNA recognition motif 9e-10
cd1237373 cd12373, RRM_SRSF3_like, RNA recognition motif in 9e-10
pfam1425969 pfam14259, RRM_6, RNA recognition motif (a 1e-09
pfam0007670 pfam00076, RRM_1, RNA recognition motif 2e-09
cd1232076 cd12320, RRM6_RBM19_RRM5_MRD1, RNA recognition mot 2e-09
cd1245480 cd12454, RRM2_RIM4_like, RNA recognition motif 2 i 2e-09
pfam1389356 pfam13893, RRM_5, RNA recognition motif 3e-09
cd1234672 cd12346, RRM3_NGR1_NAM8_like, RNA recognition moti 6e-09
cd1231284 cd12312, RRM_SRSF10_SRSF12, RNA recognition motif 1e-08
TIGR01628562 TIGR01628, PABP-1234, polyadenylate binding protei 1e-08
TIGR01622457 TIGR01622, SF-CC1, splicing factor, CC1-like famil 2e-08
cd1252671 cd12526, RRM1_EAR1_like, RNA recognition motif 1 i 2e-08
TIGR01628562 TIGR01628, PABP-1234, polyadenylate binding protei 3e-08
cd1252572 cd12525, RRM1_MEI2_fungi, RNA recognition motif 1 3e-08
cd1241476 cd12414, RRM2_RBM28_like, RNA recognition motif 2 3e-08
cd1236573 cd12365, RRM_RNPS1, RNA recognition motif in RNA-b 4e-08
cd1229878 cd12298, RRM3_Prp24, RNA recognition motif 3 in fu 5e-08
cd1231882 cd12318, RRM5_RBM19_like, RNA recognition motif 5 5e-08
cd1261474 cd12614, RRM1_PUB1, RNA recognition motif 1 in yea 6e-08
cd1226085 cd12260, RRM2_SREK1, RNA recognition motif 2 in sp 6e-08
cd1239875 cd12398, RRM_CSTF2_RNA15_like, RNA recognition mot 9e-08
cd1229878 cd12298, RRM3_Prp24, RNA recognition motif 3 in fu 1e-07
cd1241379 cd12413, RRM1_RBM28_like, RNA recognition motif 1 1e-07
cd1256476 cd12564, RRM1_RBM19, RNA recognition motif 1 in RN 1e-07
cd1235272 cd12352, RRM1_TIA1_like, RNA recognition motif 1 i 1e-07
cd1224678 cd12246, RRM1_U1A_like, RNA recognition motif 1 in 2e-07
cd1222678 cd12226, RRM_NOL8, RNA recognition motif in nucleo 2e-07
cd1239378 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc 2e-07
cd1229778 cd12297, RRM2_Prp24, RNA recognition motif 2 in fu 2e-07
cd1252971 cd12529, RRM2_MEI2_like, RNA recognition motif 2 i 3e-07
cd1235473 cd12354, RRM3_TIA1_like, RNA recognition motif 2 i 3e-07
cd1228473 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 3e-07
cd1235074 cd12350, RRM3_SHARP, RNA recognition motif 3 in SM 3e-07
COG0724306 COG0724, COG0724, RNA-binding proteins (RRM domain 3e-07
pfam1425969 pfam14259, RRM_6, RNA recognition motif (a 4e-07
cd1223370 cd12233, RRM_Srp1p_AtRSp31_like, RNA recognition m 6e-07
cd1241379 cd12413, RRM1_RBM28_like, RNA recognition motif 1 7e-07
cd1233770 cd12337, RRM1_SRSF4_like, RNA recognition motif 1 7e-07
TIGR01649481 TIGR01649, hnRNP-L_PTB, hnRNP-L/PTB/hephaestus spl 8e-07
cd1223793 cd12237, RRM_snRNP35, RNA recognition motif found 8e-07
cd1232076 cd12320, RRM6_RBM19_RRM5_MRD1, RNA recognition mot 9e-07
cd1231173 cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in 9e-07
TIGR01628562 TIGR01628, PABP-1234, polyadenylate binding protei 1e-06
cd1237577 cd12375, RRM1_Hu_like, RNA recognition motif 1 in 1e-06
cd1237880 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in 1e-06
cd1236378 cd12363, RRM_TRA2, RNA recognition motif in transf 1e-06
cd1255984 cd12559, RRM_SRSF10, RNA recognition motif in seri 1e-06
COG0724306 COG0724, COG0724, RNA-binding proteins (RRM domain 2e-06
cd1264981 cd12649, RRM1_SXL, RNA recognition motif 1 in Dros 2e-06
cd1256084 cd12560, RRM_SRSF12, RNA recognition motif in seri 2e-06
cd1222577 cd12225, RRM1_2_CID8_like, RNA recognition motif 1 2e-06
cd1257076 cd12570, RRM5_MRD1, RNA recognition motif 5 in yea 2e-06
cd1242285 cd12422, RRM2_PTBP1_hnRNPL_like, RNA recognition m 2e-06
cd1240877 cd12408, RRM_eIF3G_like, RNA recognition motif in 2e-06
cd1237373 cd12373, RRM_SRSF3_like, RNA recognition motif in 3e-06
cd1255984 cd12559, RRM_SRSF10, RNA recognition motif in seri 3e-06
cd1225172 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 3e-06
cd1240572 cd12405, RRM3_NCL, RNA recognition motif 3 in vert 3e-06
cd1222777 cd12227, RRM_SCAF4_SCAF8, RNA recognition motif in 3e-06
TIGR01645612 TIGR01645, half-pint, poly-U binding splicing fact 3e-06
cd1224177 cd12241, RRM_SF3B14, RNA recognition motif found i 3e-06
cd1259670 cd12596, RRM1_SRSF6, RNA recognition motif 1 in ve 4e-06
cd1236177 cd12361, RRM1_2_CELF1-6_like, RNA recognition moti 4e-06
cd1234366 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 5e-06
cd1223873 cd12238, RRM1_RBM40_like, RNA recognition motif 1 5e-06
cd1238280 cd12382, RRM_RBMX_like, RNA recognition motif in h 6e-06
cd12302110 cd12302, RRM_scSet1p_like, RNA recognition motif i 6e-06
cd1237177 cd12371, RRM2_PUF60, RNA recognition motif 2 in (U 6e-06
cd1231173 cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in 7e-06
cd1231072 cd12310, RRM3_Spen, RNA recognition motif 3 in the 7e-06
cd1223691 cd12236, RRM_snRNP70, RNA recognition motif in U1 7e-06
cd1231384 cd12313, RRM1_RRM2_RBM5_like, RNA recognition moti 8e-06
cd1233271 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 9e-06
cd1235580 cd12355, RRM_RBM18, RNA recognition motif in eukar 9e-06
cd1256084 cd12560, RRM_SRSF12, RNA recognition motif in seri 1e-05
cd1225172 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 1e-05
cd1239281 cd12392, RRM2_SART3, RNA recognition motif 2 in sq 1e-05
cd1259570 cd12595, RRM1_SRSF5, RNA recognition motif 1 in ve 1e-05
cd1247678 cd12476, RRM1_SNF, RNA recognition motif 1 found i 1e-05
cd1244873 cd12448, RRM2_gar2, RNA recognition motif 2 in yea 1e-05
cd1239875 cd12398, RRM_CSTF2_RNA15_like, RNA recognition mot 2e-05
cd1234366 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 2e-05
cd1231674 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition mot 2e-05
cd1241582 cd12415, RRM3_RBM28_like, RNA recognition motif 3 2e-05
cd1236273 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in 2e-05
cd1252771 cd12527, RRM2_EAR1_like, RNA recognition motif 2 i 3e-05
cd1227571 cd12275, RRM1_MEI2_EAR1_like, RNA recognition moti 3e-05
cd1235074 cd12350, RRM3_SHARP, RNA recognition motif 3 in SM 3e-05
cd1223691 cd12236, RRM_snRNP70, RNA recognition motif in U1 3e-05
cd1231674 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition mot 3e-05
cd1234168 cd12341, RRM_hnRNPC_like, RNA recognition motif in 3e-05
cd1239172 cd12391, RRM1_SART3, RNA recognition motif 1 in sq 3e-05
cd1238080 cd12380, RRM3_I_PABPs, RNA recognition motif 3 fou 3e-05
cd1224177 cd12241, RRM_SF3B14, RNA recognition motif found i 4e-05
cd1234773 cd12347, RRM_PPIE, RNA recognition motif in cyclop 4e-05
cd1258871 cd12588, RRM1_p54nrb, RNA recognition motif 1 in v 4e-05
cd1229080 cd12290, RRM1_LARP7, RNA recognition motif 1 in La 4e-05
cd1222474 cd12224, RRM_RBM22, RNA recognition motif (RRM) fo 5e-05
cd1234773 cd12347, RRM_PPIE, RNA recognition motif in cyclop 5e-05
cd1261574 cd12615, RRM1_TIA1, RNA recognition motif 1 in nuc 5e-05
cd1247789 cd12477, RRM1_U1A, RNA recognition motif 1 found i 5e-05
cd1222384 cd12223, RRM_SR140, RNA recognition motif (RRM) in 5e-05
cd1230979 cd12309, RRM2_Spen, RNA recognition motif 2 in the 5e-05
cd1242374 cd12423, RRM3_PTBP1_like, RNA recognition motif 3 6e-05
cd1228893 cd12288, RRM_La_like_plant, RNA recognition motif 7e-05
cd1224772 cd12247, RRM2_U1A_like, RNA recognition motif 2 in 8e-05
cd1222777 cd12227, RRM_SCAF4_SCAF8, RNA recognition motif in 9e-05
cd1241582 cd12415, RRM3_RBM28_like, RNA recognition motif 3 9e-05
cd1223982 cd12239, RRM2_RBM40_like, RNA recognition motif 2 9e-05
cd1241774 cd12417, RRM_SAFB_like, RNA recognition motif in t 9e-05
cd1233872 cd12338, RRM1_SRSF1_like, RNA recognition motif 1 9e-05
cd1256679 cd12566, RRM2_MRD1, RNA recognition motif 2 in yea 9e-05
cd1234672 cd12346, RRM3_NGR1_NAM8_like, RNA recognition moti 1e-04
cd1223583 cd12235, RRM_PPIL4, RNA recognition motif in pepti 1e-04
cd1244776 cd12447, RRM1_gar2, RNA recognition motif 1 in yea 1e-04
cd1239092 cd12390, RRM3_RAVER, RNA recognition motif 3 in ri 1e-04
cd1252279 cd12522, RRM4_MRN1, RNA recognition motif 4 of RNA 1e-04
cd1267479 cd12674, RRM1_Nop4p, RNA recognition motif 1 in ye 1e-04
cd1267479 cd12674, RRM1_Nop4p, RNA recognition motif 1 in ye 1e-04
cd1261681 cd12616, RRM1_TIAR, RNA recognition motif 1 in nuc 1e-04
cd1256576 cd12565, RRM1_MRD1, RNA recognition motif 1 in yea 1e-04
cd1231072 cd12310, RRM3_Spen, RNA recognition motif 3 in the 2e-04
cd1238080 cd12380, RRM3_I_PABPs, RNA recognition motif 3 fou 2e-04
cd1224772 cd12247, RRM2_U1A_like, RNA recognition motif 2 in 2e-04
cd1256679 cd12566, RRM2_MRD1, RNA recognition motif 2 in yea 2e-04
cd1255277 cd12552, RRM_Nop15p, RNA recognition motif in yeas 2e-04
cd1277183 cd12771, RRM1_HuB, RNA recognition motif 1 in vert 2e-04
cd1235873 cd12358, RRM1_VICKZ, RNA recognition motif 1 in th 2e-04
cd1227371 cd12273, RRM1_NEFsp, RNA recognition motif 1 in ve 2e-04
cd1247891 cd12478, RRM1_U2B, RNA recognition motif 1 in U2 s 2e-04
cd1231882 cd12318, RRM5_RBM19_like, RNA recognition motif 5 3e-04
cd1257076 cd12570, RRM5_MRD1, RNA recognition motif 5 in yea 3e-04
cd1242471 cd12424, RRM3_hnRNPL_like, RNA recognition motif 1 3e-04
TIGR01659346 TIGR01659, sex-lethal, sex-lethal family splicing 3e-04
cd1264581 cd12645, RRM_SRSF3, RNA recognition motif in verte 3e-04
cd1259972 cd12599, RRM1_SF2_plant_like, RNA recognition moti 3e-04
cd1258771 cd12587, RRM1_PSF, RNA recognition motif 1 in vert 3e-04
cd1249572 cd12495, RRM3_hnRNPQ, RNA recognition motif 3 in v 3e-04
cd1232488 cd12324, RRM_RBM8, RNA recognition motif in RNA-bi 3e-04
cd1240877 cd12408, RRM_eIF3G_like, RNA recognition motif in 4e-04
cd1237778 cd12377, RRM3_Hu, RNA recognition motif 3 in the H 4e-04
cd1241875 cd12418, RRM_Aly_REF_like, RNA recognition motif i 4e-04
cd1234168 cd12341, RRM_hnRNPC_like, RNA recognition motif in 5e-04
cd1234271 cd12342, RRM_Nab3p, RNA recognition motif in yeast 5e-04
cd1269593 cd12695, RRM3_PTBP1, RNA recognition motif 3 in ve 5e-04
cd1269776 cd12697, RRM3_ROD1, RNA recognition motif 3 in ver 6e-04
cd1223289 cd12232, RRM3_U2AF65, RNA recognition motif 3 foun 6e-04
cd1263287 cd12632, RRM1_CELF3_4_5_6, RNA recognition motif 1 6e-04
cd1239773 cd12397, RRM2_Nop13p_fungi, RNA recognition motif 6e-04
cd1265078 cd12650, RRM1_Hu, RNA recognition motif 1 in the H 6e-04
cd1260371 cd12603, RRM_hnRNPC, RNA recognition motif in vert 6e-04
cd1230673 cd12306, RRM_II_PABPs, RNA recognition motif in ty 6e-04
cd1259773 cd12597, RRM1_SRSF1, RNA recognition motif 1 in se 7e-04
cd1260968 cd12609, RRM2_CoAA, RNA recognition motif 2 in ver 7e-04
cd1267583 cd12675, RRM2_Nop4p, RNA recognition motif 2 in ye 7e-04
cd1224579 cd12245, RRM_scw1_like, RNA recognition motif in y 7e-04
cd1223793 cd12237, RRM_snRNP35, RNA recognition motif found 8e-04
cd1233271 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 8e-04
cd1230979 cd12309, RRM2_Spen, RNA recognition motif 2 in the 8e-04
cd1229971 cd12299, RRM4_Prp24, RNA recognition motif 4 in fu 8e-04
cd1235375 cd12353, RRM2_TIA1_like, RNA recognition motif 2 i 8e-04
cd1235177 cd12351, RRM4_SHARP, RNA recognition motif 4 in SM 8e-04
cd1277083 cd12770, RRM1_HuD, RNA recognition motif 1 in vert 8e-04
TIGR01648578 TIGR01648, hnRNP-R-Q, heterogeneous nuclear ribonu 9e-04
cd1238476 cd12384, RRM_RBM24_RBM38_like, RNA recognition mot 9e-04
cd1239978 cd12399, RRM_HP0827_like, RNA recognition motif in 0.001
cd1245077 cd12450, RRM1_NUCLs, RNA recognition motif 1 found 0.001
cd1260869 cd12608, RRM1_CoAA, RNA recognition motif 1 in ver 0.001
cd1225689 cd12256, RRM2_LKAP, RNA recognition motif 2 in Lim 0.001
cd1268169 cd12681, RRM_SKAR, RNA recognition motif in S6K1 A 0.001
cd1240776 cd12407, RRM_FOX1_like, RNA recognition motif in v 0.001
cd1229671 cd12296, RRM1_Prp24, RNA recognition motif 1 in fu 0.001
cd1240477 cd12404, RRM2_NCL, RNA recognition motif 2 in vert 0.001
cd1260667 cd12606, RRM1_RBM4, RNA recognition motif 1 in ver 0.001
cd1241280 cd12412, RRM_DAZL_BOULE, RNA recognition motif in 0.001
cd1245179 cd12451, RRM2_NUCLs, RNA recognition motif 2 in nu 0.001
cd1258671 cd12586, RRM1_PSP1, RNA recognition motif 1 in ver 0.001
TIGR01622457 TIGR01622, SF-CC1, splicing factor, CC1-like famil 0.002
cd1237577 cd12375, RRM1_Hu_like, RNA recognition motif 1 in 0.002
cd1239281 cd12392, RRM2_SART3, RNA recognition motif 2 in sq 0.002
cd1238476 cd12384, RRM_RBM24_RBM38_like, RNA recognition mot 0.002
PLN03134144 PLN03134, PLN03134, glycine-rich RNA-binding prote 0.002
cd1262073 cd12620, RRM3_TIAR, RNA recognition motif 3 in nuc 0.002
cd1259474 cd12594, RRM1_SRSF4, RNA recognition motif 1 in ve 0.002
cd1222981 cd12229, RRM_G3BP, RNA recognition motif (RRM) in 0.002
cd1241980 cd12419, RRM_Ssp2_like, RNA recognition motif in y 0.002
cd1223472 cd12234, RRM1_AtRSp31_like, RNA recognition motif 0.002
cd1257179 cd12571, RRM6_RBM19, RNA recognition motif 6 in RN 0.002
cd12696107 cd12696, RRM3_PTBP2, RNA recognition motif 3 in ve 0.002
cd1246670 cd12466, RRM2_AtRSp31_like, RNA recognition motif 0.002
cd1235473 cd12354, RRM3_TIA1_like, RNA recognition motif 2 i 0.003
cd1235375 cd12353, RRM2_TIA1_like, RNA recognition motif 2 i 0.003
cd1264677 cd12646, RRM_SRSF7, RNA recognition motif in verte 0.003
cd1226586 cd12265, RRM_SLT11, RNA recognition motif of pre-m 0.003
cd1234875 cd12348, RRM1_SHARP, RNA recognition motif 1 in SM 0.003
cd1233474 cd12334, RRM1_SF3B4, RNA recognition motif 1 in sp 0.003
cd1232271 cd12322, RRM2_TDP43, RNA recognition motif 2 in TA 0.003
cd1224978 cd12249, RRM1_hnRNPR_like, RNA recognition motif 1 0.003
cd1267175 cd12671, RRM_CSTF2_CSTF2T, RNA recognition motif i 0.003
cd1233380 cd12333, RRM2_p54nrb_like, RNA recognition motif 2 0.003
cd1239491 cd12394, RRM1_RBM34, RNA recognition motif 1 in RN 0.003
cd1245480 cd12454, RRM2_RIM4_like, RNA recognition motif 2 i 0.004
cd1236177 cd12361, RRM1_2_CELF1-6_like, RNA recognition moti 0.004
cd1264581 cd12645, RRM_SRSF3, RNA recognition motif in verte 0.004
cd1260869 cd12608, RRM1_CoAA, RNA recognition motif 1 in ver 0.004
cd1264677 cd12646, RRM_SRSF7, RNA recognition motif in verte 0.004
cd1276981 cd12769, RRM1_HuR, RNA recognition motif 1 in vert 0.004
cd1238977 cd12389, RRM2_RAVER, RNA recognition motif 2 in ri 0.004
cd1242174 cd12421, RRM1_PTBP1_hnRNPL_like, RNA recognition m 0.004
cd1234481 cd12344, RRM1_SECp43_like, RNA recognition motif 1 0.004
>gnl|CDD|112856 pfam04059, RRM_2, RNA recognition motif 2 Back     alignment and domain information
 Score =  211 bits (538), Expect = 6e-65
 Identities = 85/97 (87%), Positives = 90/97 (92%)

Query: 694 RTTLMIKNIPNKYTSKMLLAAIDENHKGTYDFLYLPIDFKNKCNVGYAFINMLSPLHIIP 753
           RTTLMIKNIPNKYT KMLLAAIDE +KGTYDFLYLPIDFKNKCNVGYAFINM+ P  IIP
Sbjct: 1   RTTLMIKNIPNKYTQKMLLAAIDEKNKGTYDFLYLPIDFKNKCNVGYAFINMIEPQSIIP 60

Query: 754 FYEAFNGKKWEKFNSEKVASLAYARIQGRAALVAHFQ 790
           F +AFNGKKWEKFNSEKVASLAYARIQG+ AL+AHFQ
Sbjct: 61  FGKAFNGKKWEKFNSEKVASLAYARIQGKDALIAHFQ 97


Length = 97

>gnl|CDD|240975 cd12531, RRM3_MEI2_like, RNA recognition motif 3 in plant Mei2-like proteins Back     alignment and domain information
>gnl|CDD|240968 cd12524, RRM1_MEI2_like, RNA recognition motif 1 in plant Mei2-like proteins Back     alignment and domain information
>gnl|CDD|240973 cd12529, RRM2_MEI2_like, RNA recognition motif 2 in plant Mei2-like proteins Back     alignment and domain information
>gnl|CDD|240723 cd12277, RRM3_MEI2_EAR1_like, RNA recognition motif 3 in Mei2-like proteins and terminal EAR1-like proteins Back     alignment and domain information
>gnl|CDD|240974 cd12530, RRM3_EAR1_like, RNA recognition motif 3 in terminal EAR1-like proteins Back     alignment and domain information
>gnl|CDD|240976 cd12532, RRM3_MEI2_fungi, RNA recognition motif 3 in fungal Mei2-like proteins Back     alignment and domain information
>gnl|CDD|240722 cd12276, RRM2_MEI2_EAR1_like, RNA recognition motif 2 in Mei2-like proteins and terminal EAR1-like proteins Back     alignment and domain information
>gnl|CDD|240971 cd12527, RRM2_EAR1_like, RNA recognition motif 2 in terminal EAR1-like proteins Back     alignment and domain information
>gnl|CDD|240721 cd12275, RRM1_MEI2_EAR1_like, RNA recognition motif 1 in Mei2-like proteins and terminal EAR1-like proteins Back     alignment and domain information
>gnl|CDD|214636 smart00360, RRM, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily Back     alignment and domain information
>gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240968 cd12524, RRM1_MEI2_like, RNA recognition motif 1 in plant Mei2-like proteins Back     alignment and domain information
>gnl|CDD|240722 cd12276, RRM2_MEI2_EAR1_like, RNA recognition motif 2 in Mei2-like proteins and terminal EAR1-like proteins Back     alignment and domain information
>gnl|CDD|214636 smart00360, RRM, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240692 cd12246, RRM1_U1A_like, RNA recognition motif 1 in the U1A/U2B"/SNF protein family Back     alignment and domain information
>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily Back     alignment and domain information
>gnl|CDD|240845 cd12399, RRM_HP0827_like, RNA recognition motif in Helicobacter pylori HP0827 protein and similar proteins Back     alignment and domain information
>gnl|CDD|240828 cd12382, RRM_RBMX_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein G (hnRNP G), Y chromosome RNA recognition motif 1 (hRBMY), testis-specific heterogeneous nuclear ribonucleoprotein G-T (hnRNP G-T) and similar proteins Back     alignment and domain information
>gnl|CDD|240670 cd12224, RRM_RBM22, RNA recognition motif (RRM) found in Pre-mRNA-splicing factor RBM22 and similar proteins Back     alignment and domain information
>gnl|CDD|206064 pfam13893, RRM_5, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240758 cd12312, RRM_SRSF10_SRSF12, RNA recognition motif in serine/arginine-rich splicing factor SRSF10, SRSF12 and similar proteins Back     alignment and domain information
>gnl|CDD|240819 cd12373, RRM_SRSF3_like, RNA recognition motif in serine/arginine-rich splicing factor 3 (SRSF3) and similar proteins Back     alignment and domain information
>gnl|CDD|222631 pfam14259, RRM_6, RNA recognition motif (a Back     alignment and domain information
>gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240766 cd12320, RRM6_RBM19_RRM5_MRD1, RNA recognition motif 6 in RNA-binding protein 19 (RBM19 or RBD-1) and RNA recognition motif 5 in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|240900 cd12454, RRM2_RIM4_like, RNA recognition motif 2 in yeast meiotic activator RIM4 and similar proteins Back     alignment and domain information
>gnl|CDD|206064 pfam13893, RRM_5, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240792 cd12346, RRM3_NGR1_NAM8_like, RNA recognition motif 3 in yeast negative growth regulatory protein NGR1 (RBP1), yeast protein NAM8 and similar proteins Back     alignment and domain information
>gnl|CDD|240758 cd12312, RRM_SRSF10_SRSF12, RNA recognition motif in serine/arginine-rich splicing factor SRSF10, SRSF12 and similar proteins Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family Back     alignment and domain information
>gnl|CDD|240970 cd12526, RRM1_EAR1_like, RNA recognition motif 1 in terminal EAR1-like proteins Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|240969 cd12525, RRM1_MEI2_fungi, RNA recognition motif 1 in fungal Mei2-like proteins Back     alignment and domain information
>gnl|CDD|240860 cd12414, RRM2_RBM28_like, RNA recognition motif 2 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240811 cd12365, RRM_RNPS1, RNA recognition motif in RNA-binding protein with serine-rich domain 1 (RNPS1) and similar proteins Back     alignment and domain information
>gnl|CDD|240744 cd12298, RRM3_Prp24, RNA recognition motif 3 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|240764 cd12318, RRM5_RBM19_like, RNA recognition motif 5 in RNA-binding protein 19 (RBM19 or RBD-1) and similar proteins Back     alignment and domain information
>gnl|CDD|241058 cd12614, RRM1_PUB1, RNA recognition motif 1 in yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 and similar proteins Back     alignment and domain information
>gnl|CDD|240706 cd12260, RRM2_SREK1, RNA recognition motif 2 in splicing regulatory glutamine/lysine-rich protein 1 (SREK1) and similar proteins Back     alignment and domain information
>gnl|CDD|240844 cd12398, RRM_CSTF2_RNA15_like, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), yeast ortholog mRNA 3'-end-processing protein RNA15 and similar proteins Back     alignment and domain information
>gnl|CDD|240744 cd12298, RRM3_Prp24, RNA recognition motif 3 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|240859 cd12413, RRM1_RBM28_like, RNA recognition motif 1 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|241008 cd12564, RRM1_RBM19, RNA recognition motif 1 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|240798 cd12352, RRM1_TIA1_like, RNA recognition motif 1 in granule-associated RNA binding proteins p40-TIA-1 and TIAR Back     alignment and domain information
>gnl|CDD|240692 cd12246, RRM1_U1A_like, RNA recognition motif 1 in the U1A/U2B"/SNF protein family Back     alignment and domain information
>gnl|CDD|240672 cd12226, RRM_NOL8, RNA recognition motif in nucleolar protein 8 (NOL8) and similar proteins Back     alignment and domain information
>gnl|CDD|240839 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc finger CCHC-type and RNA-binding motif-containing protein 1 (ZCRB1) and similar proteins Back     alignment and domain information
>gnl|CDD|240743 cd12297, RRM2_Prp24, RNA recognition motif 2 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|240973 cd12529, RRM2_MEI2_like, RNA recognition motif 2 in plant Mei2-like proteins Back     alignment and domain information
>gnl|CDD|240800 cd12354, RRM3_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins (p40-TIA-1 and TIAR), and yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 Back     alignment and domain information
>gnl|CDD|240730 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 in vertebrate RNA-binding protein RBM23, RBM39 and similar proteins Back     alignment and domain information
>gnl|CDD|240796 cd12350, RRM3_SHARP, RNA recognition motif 3 in SMART/HDAC1-associated repressor protein (SHARP) and similar proteins Back     alignment and domain information
>gnl|CDD|223796 COG0724, COG0724, RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>gnl|CDD|222631 pfam14259, RRM_6, RNA recognition motif (a Back     alignment and domain information
>gnl|CDD|240679 cd12233, RRM_Srp1p_AtRSp31_like, RNA recognition motif found in fission yeast pre-mRNA-splicing factor Srp1p, Arabidopsis thaliana arginine/serine-rich-splicing factor RSp31 and similar proteins Back     alignment and domain information
>gnl|CDD|240859 cd12413, RRM1_RBM28_like, RNA recognition motif 1 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240783 cd12337, RRM1_SRSF4_like, RNA recognition motif 1 in serine/arginine-rich splicing factor 4 (SRSF4) and similar proteins Back     alignment and domain information
>gnl|CDD|233508 TIGR01649, hnRNP-L_PTB, hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>gnl|CDD|240683 cd12237, RRM_snRNP35, RNA recognition motif found in U11/U12 small nuclear ribonucleoprotein 35 kDa protein (U11/U12-35K) and similar proteins Back     alignment and domain information
>gnl|CDD|240766 cd12320, RRM6_RBM19_RRM5_MRD1, RNA recognition motif 6 in RNA-binding protein 19 (RBM19 or RBD-1) and RNA recognition motif 5 in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|240757 cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in serine/arginine-rich splicing factor SRSF2, SRSF8 and similar proteins Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|240821 cd12375, RRM1_Hu_like, RNA recognition motif 1 in the Hu proteins family, Drosophila sex-lethal (SXL), and similar proteins Back     alignment and domain information
>gnl|CDD|240824 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240809 cd12363, RRM_TRA2, RNA recognition motif in transformer-2 protein homolog TRA2-alpha, TRA2-beta and similar proteins Back     alignment and domain information
>gnl|CDD|241003 cd12559, RRM_SRSF10, RNA recognition motif in serine/arginine-rich splicing factor 10 (SRSF10) and similar proteins Back     alignment and domain information
>gnl|CDD|223796 COG0724, COG0724, RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>gnl|CDD|241093 cd12649, RRM1_SXL, RNA recognition motif 1 in Drosophila sex-lethal (SXL) and similar proteins Back     alignment and domain information
>gnl|CDD|241004 cd12560, RRM_SRSF12, RNA recognition motif in serine/arginine-rich splicing factor 12 (SRSF12) and similar proteins Back     alignment and domain information
>gnl|CDD|240671 cd12225, RRM1_2_CID8_like, RNA recognition motif 1 and 2 (RRM1, RRM2) in Arabidopsis thaliana CTC-interacting domain protein CID8, CID9, CID10, CID11, CID12, CID 13 and similar proteins Back     alignment and domain information
>gnl|CDD|241014 cd12570, RRM5_MRD1, RNA recognition motif 5 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240868 cd12422, RRM2_PTBP1_hnRNPL_like, RNA recognition motif in polypyrimidine tract-binding protein 1 (PTB or hnRNP I), heterogeneous nuclear ribonucleoprotein L (hnRNP-L), and similar proteins Back     alignment and domain information
>gnl|CDD|240854 cd12408, RRM_eIF3G_like, RNA recognition motif in eukaryotic translation initiation factor 3 subunit G (eIF-3G) and similar proteins Back     alignment and domain information
>gnl|CDD|240819 cd12373, RRM_SRSF3_like, RNA recognition motif in serine/arginine-rich splicing factor 3 (SRSF3) and similar proteins Back     alignment and domain information
>gnl|CDD|241003 cd12559, RRM_SRSF10, RNA recognition motif in serine/arginine-rich splicing factor 10 (SRSF10) and similar proteins Back     alignment and domain information
>gnl|CDD|240697 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 in heterogeneous nuclear ribonucleoprotein R (hnRNP R) and similar proteins Back     alignment and domain information
>gnl|CDD|240851 cd12405, RRM3_NCL, RNA recognition motif 3 in vertebrate nucleolin Back     alignment and domain information
>gnl|CDD|240673 cd12227, RRM_SCAF4_SCAF8, RNA recognition motif in SR-related and CTD-associated factor 4 (SCAF4), SR-related and CTD-associated factor 8 (SCAF8) and similar proteins Back     alignment and domain information
>gnl|CDD|130706 TIGR01645, half-pint, poly-U binding splicing factor, half-pint family Back     alignment and domain information
>gnl|CDD|240687 cd12241, RRM_SF3B14, RNA recognition motif found in pre-mRNA branch site protein p14 (SF3B14) and similar proteins Back     alignment and domain information
>gnl|CDD|241040 cd12596, RRM1_SRSF6, RNA recognition motif 1 in vertebrate serine/arginine-rich splicing factor 6 (SRSF6) Back     alignment and domain information
>gnl|CDD|240807 cd12361, RRM1_2_CELF1-6_like, RNA recognition motif 1 and 2 in CELF/Bruno-like family of RNA binding proteins and plant flowering time control protein FCA Back     alignment and domain information
>gnl|CDD|240789 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 and 2 in RRM-containing coactivator activator/modulator (CoAA) and similar proteins Back     alignment and domain information
>gnl|CDD|240684 cd12238, RRM1_RBM40_like, RNA recognition motif 1 in RNA-binding protein 40 (RBM40) and similar proteins Back     alignment and domain information
>gnl|CDD|240828 cd12382, RRM_RBMX_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein G (hnRNP G), Y chromosome RNA recognition motif 1 (hRBMY), testis-specific heterogeneous nuclear ribonucleoprotein G-T (hnRNP G-T) and similar proteins Back     alignment and domain information
>gnl|CDD|240748 cd12302, RRM_scSet1p_like, RNA recognition motif in budding yeast Saccharomyces cerevisiae SET domain-containing protein 1 (scSet1p) and similar proteins Back     alignment and domain information
>gnl|CDD|240817 cd12371, RRM2_PUF60, RNA recognition motif 2 in (U)-binding-splicing factor PUF60 and similar proteins Back     alignment and domain information
>gnl|CDD|240757 cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in serine/arginine-rich splicing factor SRSF2, SRSF8 and similar proteins Back     alignment and domain information
>gnl|CDD|240756 cd12310, RRM3_Spen, RNA recognition motif 3 in the Spen (split end) protein family Back     alignment and domain information
>gnl|CDD|240682 cd12236, RRM_snRNP70, RNA recognition motif in U1 small nuclear ribonucleoprotein 70 kDa (U1-70K) and similar proteins Back     alignment and domain information
>gnl|CDD|240759 cd12313, RRM1_RRM2_RBM5_like, RNA recognition motif 1 and 2 in RNA-binding protein 5 (RBM5) and similar proteins Back     alignment and domain information
>gnl|CDD|240778 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 in the p54nrb/PSF/PSP1 family Back     alignment and domain information
>gnl|CDD|240801 cd12355, RRM_RBM18, RNA recognition motif in eukaryotic RNA-binding protein 18 and similar proteins Back     alignment and domain information
>gnl|CDD|241004 cd12560, RRM_SRSF12, RNA recognition motif in serine/arginine-rich splicing factor 12 (SRSF12) and similar proteins Back     alignment and domain information
>gnl|CDD|240697 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 in heterogeneous nuclear ribonucleoprotein R (hnRNP R) and similar proteins Back     alignment and domain information
>gnl|CDD|240838 cd12392, RRM2_SART3, RNA recognition motif 2 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins Back     alignment and domain information
>gnl|CDD|241039 cd12595, RRM1_SRSF5, RNA recognition motif 1 in vertebrate serine/arginine-rich splicing factor 5 (SRSF5) Back     alignment and domain information
>gnl|CDD|240920 cd12476, RRM1_SNF, RNA recognition motif 1 found in Drosophila melanogaster sex determination protein SNF and similar proteins Back     alignment and domain information
>gnl|CDD|240894 cd12448, RRM2_gar2, RNA recognition motif 2 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|240844 cd12398, RRM_CSTF2_RNA15_like, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), yeast ortholog mRNA 3'-end-processing protein RNA15 and similar proteins Back     alignment and domain information
>gnl|CDD|240789 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 and 2 in RRM-containing coactivator activator/modulator (CoAA) and similar proteins Back     alignment and domain information
>gnl|CDD|240762 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and RNA recognition motif 2 found in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|240861 cd12415, RRM3_RBM28_like, RNA recognition motif 3 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240808 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in CELF/Bruno-like family of RNA binding proteins CELF1, CELF2, CELF3, CELF4, CELF5, CELF6 and similar proteins Back     alignment and domain information
>gnl|CDD|240971 cd12527, RRM2_EAR1_like, RNA recognition motif 2 in terminal EAR1-like proteins Back     alignment and domain information
>gnl|CDD|240721 cd12275, RRM1_MEI2_EAR1_like, RNA recognition motif 1 in Mei2-like proteins and terminal EAR1-like proteins Back     alignment and domain information
>gnl|CDD|240796 cd12350, RRM3_SHARP, RNA recognition motif 3 in SMART/HDAC1-associated repressor protein (SHARP) and similar proteins Back     alignment and domain information
>gnl|CDD|240682 cd12236, RRM_snRNP70, RNA recognition motif in U1 small nuclear ribonucleoprotein 70 kDa (U1-70K) and similar proteins Back     alignment and domain information
>gnl|CDD|240762 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and RNA recognition motif 2 found in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|240787 cd12341, RRM_hnRNPC_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein C (hnRNP C)-related proteins Back     alignment and domain information
>gnl|CDD|240837 cd12391, RRM1_SART3, RNA recognition motif 1 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins Back     alignment and domain information
>gnl|CDD|240826 cd12380, RRM3_I_PABPs, RNA recognition motif 3 found in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240687 cd12241, RRM_SF3B14, RNA recognition motif found in pre-mRNA branch site protein p14 (SF3B14) and similar proteins Back     alignment and domain information
>gnl|CDD|240793 cd12347, RRM_PPIE, RNA recognition motif in cyclophilin-33 (Cyp33) and similar proteins Back     alignment and domain information
>gnl|CDD|241032 cd12588, RRM1_p54nrb, RNA recognition motif 1 in vertebrate 54 kDa nuclear RNA- and DNA-binding protein (p54nrb) Back     alignment and domain information
>gnl|CDD|240736 cd12290, RRM1_LARP7, RNA recognition motif 1 in La-related protein 7 (LARP7) and similar proteins Back     alignment and domain information
>gnl|CDD|240670 cd12224, RRM_RBM22, RNA recognition motif (RRM) found in Pre-mRNA-splicing factor RBM22 and similar proteins Back     alignment and domain information
>gnl|CDD|240793 cd12347, RRM_PPIE, RNA recognition motif in cyclophilin-33 (Cyp33) and similar proteins Back     alignment and domain information
>gnl|CDD|241059 cd12615, RRM1_TIA1, RNA recognition motif 1 in nucleolysin TIA-1 isoform p40 (p40-TIA-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240921 cd12477, RRM1_U1A, RNA recognition motif 1 found in vertebrate U1 small nuclear ribonucleoprotein A (U1A) Back     alignment and domain information
>gnl|CDD|240669 cd12223, RRM_SR140, RNA recognition motif (RRM) in U2-associated protein SR140 and similar proteins Back     alignment and domain information
>gnl|CDD|240755 cd12309, RRM2_Spen, RNA recognition motif 2 in the Spen (split end) protein family Back     alignment and domain information
>gnl|CDD|240869 cd12423, RRM3_PTBP1_like, RNA recognition motif 3 in polypyrimidine tract-binding protein 1 (PTB or hnRNP I) and similar proteins Back     alignment and domain information
>gnl|CDD|240734 cd12288, RRM_La_like_plant, RNA recognition motif in plant proteins related to the La autoantigen Back     alignment and domain information
>gnl|CDD|240693 cd12247, RRM2_U1A_like, RNA recognition motif 2 in the U1A/U2B"/SNF protein family Back     alignment and domain information
>gnl|CDD|240673 cd12227, RRM_SCAF4_SCAF8, RNA recognition motif in SR-related and CTD-associated factor 4 (SCAF4), SR-related and CTD-associated factor 8 (SCAF8) and similar proteins Back     alignment and domain information
>gnl|CDD|240861 cd12415, RRM3_RBM28_like, RNA recognition motif 3 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240685 cd12239, RRM2_RBM40_like, RNA recognition motif 2 in RNA-binding protein 40 (RBM40) and similar proteins Back     alignment and domain information
>gnl|CDD|240863 cd12417, RRM_SAFB_like, RNA recognition motif in the scaffold attachment factor (SAFB) family Back     alignment and domain information
>gnl|CDD|240784 cd12338, RRM1_SRSF1_like, RNA recognition motif 1 in serine/arginine-rich splicing factor 1 (SRSF1) and similar proteins Back     alignment and domain information
>gnl|CDD|241010 cd12566, RRM2_MRD1, RNA recognition motif 2 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240792 cd12346, RRM3_NGR1_NAM8_like, RNA recognition motif 3 in yeast negative growth regulatory protein NGR1 (RBP1), yeast protein NAM8 and similar proteins Back     alignment and domain information
>gnl|CDD|240681 cd12235, RRM_PPIL4, RNA recognition motif in peptidyl-prolyl cis-trans isomerase-like 4 (PPIase) and similar proteins Back     alignment and domain information
>gnl|CDD|240893 cd12447, RRM1_gar2, RNA recognition motif 1 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|240836 cd12390, RRM3_RAVER, RNA recognition motif 3 in ribonucleoprotein PTB-binding raver-1, raver-2 and similar proteins Back     alignment and domain information
>gnl|CDD|240966 cd12522, RRM4_MRN1, RNA recognition motif 4 of RNA-binding protein MRN1 and similar proteins Back     alignment and domain information
>gnl|CDD|241118 cd12674, RRM1_Nop4p, RNA recognition motif 1 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|241118 cd12674, RRM1_Nop4p, RNA recognition motif 1 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|241060 cd12616, RRM1_TIAR, RNA recognition motif 1 in nucleolysin TIAR and similar proteins Back     alignment and domain information
>gnl|CDD|241009 cd12565, RRM1_MRD1, RNA recognition motif 1 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240756 cd12310, RRM3_Spen, RNA recognition motif 3 in the Spen (split end) protein family Back     alignment and domain information
>gnl|CDD|240826 cd12380, RRM3_I_PABPs, RNA recognition motif 3 found in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240693 cd12247, RRM2_U1A_like, RNA recognition motif 2 in the U1A/U2B"/SNF protein family Back     alignment and domain information
>gnl|CDD|241010 cd12566, RRM2_MRD1, RNA recognition motif 2 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240996 cd12552, RRM_Nop15p, RNA recognition motif in yeast ribosome biogenesis protein 15 (Nop15p) and similar proteins Back     alignment and domain information
>gnl|CDD|241215 cd12771, RRM1_HuB, RNA recognition motif 1 in vertebrate Hu-antigen B (HuB) Back     alignment and domain information
>gnl|CDD|240804 cd12358, RRM1_VICKZ, RNA recognition motif 1 in the VICKZ family proteins Back     alignment and domain information
>gnl|CDD|240719 cd12273, RRM1_NEFsp, RNA recognition motif 1 in vertebrate putative RNA exonuclease NEF-sp Back     alignment and domain information
>gnl|CDD|240922 cd12478, RRM1_U2B, RNA recognition motif 1 in U2 small nuclear ribonucleoprotein B" (U2B") and similar proteins Back     alignment and domain information
>gnl|CDD|240764 cd12318, RRM5_RBM19_like, RNA recognition motif 5 in RNA-binding protein 19 (RBM19 or RBD-1) and similar proteins Back     alignment and domain information
>gnl|CDD|241014 cd12570, RRM5_MRD1, RNA recognition motif 5 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240870 cd12424, RRM3_hnRNPL_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein L (hnRNP-L) and similar proteins Back     alignment and domain information
>gnl|CDD|233515 TIGR01659, sex-lethal, sex-lethal family splicing factor Back     alignment and domain information
>gnl|CDD|241089 cd12645, RRM_SRSF3, RNA recognition motif in vertebrate serine/arginine-rich splicing factor 3 (SRSF3) Back     alignment and domain information
>gnl|CDD|241043 cd12599, RRM1_SF2_plant_like, RNA recognition motif 1 in plant pre-mRNA-splicing factor SF2 and similar proteins Back     alignment and domain information
>gnl|CDD|241031 cd12587, RRM1_PSF, RNA recognition motif 1 in vertebrate polypyrimidine tract-binding protein (PTB)-associated-splicing factor (PSF) Back     alignment and domain information
>gnl|CDD|240939 cd12495, RRM3_hnRNPQ, RNA recognition motif 3 in vertebrate heterogeneous nuclear ribonucleoprotein Q (hnRNP Q) Back     alignment and domain information
>gnl|CDD|240770 cd12324, RRM_RBM8, RNA recognition motif in RNA-binding protein RBM8A, RBM8B nd similar proteins Back     alignment and domain information
>gnl|CDD|240854 cd12408, RRM_eIF3G_like, RNA recognition motif in eukaryotic translation initiation factor 3 subunit G (eIF-3G) and similar proteins Back     alignment and domain information
>gnl|CDD|240823 cd12377, RRM3_Hu, RNA recognition motif 3 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|240864 cd12418, RRM_Aly_REF_like, RNA recognition motif in the Aly/REF family Back     alignment and domain information
>gnl|CDD|240787 cd12341, RRM_hnRNPC_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein C (hnRNP C)-related proteins Back     alignment and domain information
>gnl|CDD|240788 cd12342, RRM_Nab3p, RNA recognition motif in yeast nuclear polyadenylated RNA-binding protein 3 (Nab3p) and similar proteins Back     alignment and domain information
>gnl|CDD|241139 cd12695, RRM3_PTBP1, RNA recognition motif 3 in vertebrate polypyrimidine tract-binding protein 1 (PTB) Back     alignment and domain information
>gnl|CDD|241141 cd12697, RRM3_ROD1, RNA recognition motif 3 in vertebrate regulator of differentiation 1 (Rod1) Back     alignment and domain information
>gnl|CDD|240678 cd12232, RRM3_U2AF65, RNA recognition motif 3 found in U2 large nuclear ribonucleoprotein auxiliary factor U2AF 65 kDa subunit (U2AF65) and similar proteins Back     alignment and domain information
>gnl|CDD|241076 cd12632, RRM1_CELF3_4_5_6, RNA recognition motif 1 in CUGBP Elav-like family member CELF-3, CELF-4, CELF-5, CELF-6 and similar proteins Back     alignment and domain information
>gnl|CDD|240843 cd12397, RRM2_Nop13p_fungi, RNA recognition motif 2 in yeast nucleolar protein 13 (Nop13p) and similar proteins Back     alignment and domain information
>gnl|CDD|241094 cd12650, RRM1_Hu, RNA recognition motif 1 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|241047 cd12603, RRM_hnRNPC, RNA recognition motif in vertebrate heterogeneous nuclear ribonucleoprotein C1/C2 (hnRNP C1/C2) Back     alignment and domain information
>gnl|CDD|240752 cd12306, RRM_II_PABPs, RNA recognition motif in type II polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|241041 cd12597, RRM1_SRSF1, RNA recognition motif 1 in serine/arginine-rich splicing factor 1 (SRSF1) and similar proteins Back     alignment and domain information
>gnl|CDD|241053 cd12609, RRM2_CoAA, RNA recognition motif 2 in vertebrate RRM-containing coactivator activator/modulator (CoAA) Back     alignment and domain information
>gnl|CDD|241119 cd12675, RRM2_Nop4p, RNA recognition motif 2 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|240691 cd12245, RRM_scw1_like, RNA recognition motif in yeast cell wall integrity protein scw1 and similar proteins Back     alignment and domain information
>gnl|CDD|240683 cd12237, RRM_snRNP35, RNA recognition motif found in U11/U12 small nuclear ribonucleoprotein 35 kDa protein (U11/U12-35K) and similar proteins Back     alignment and domain information
>gnl|CDD|240778 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 in the p54nrb/PSF/PSP1 family Back     alignment and domain information
>gnl|CDD|240755 cd12309, RRM2_Spen, RNA recognition motif 2 in the Spen (split end) protein family Back     alignment and domain information
>gnl|CDD|240745 cd12299, RRM4_Prp24, RNA recognition motif 4 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|240799 cd12353, RRM2_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins p40-TIA-1 and TIAR Back     alignment and domain information
>gnl|CDD|240797 cd12351, RRM4_SHARP, RNA recognition motif 4 in SMART/HDAC1-associated repressor protein (SHARP) and similar proteins Back     alignment and domain information
>gnl|CDD|241214 cd12770, RRM1_HuD, RNA recognition motif 1 in vertebrate Hu-antigen D (HuD) Back     alignment and domain information
>gnl|CDD|233507 TIGR01648, hnRNP-R-Q, heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>gnl|CDD|240830 cd12384, RRM_RBM24_RBM38_like, RNA recognition motif in eukaryotic RNA-binding protein RBM24, RBM38 and similar proteins Back     alignment and domain information
>gnl|CDD|240845 cd12399, RRM_HP0827_like, RNA recognition motif in Helicobacter pylori HP0827 protein and similar proteins Back     alignment and domain information
>gnl|CDD|240896 cd12450, RRM1_NUCLs, RNA recognition motif 1 found in nucleolin-like proteins mainly from plants Back     alignment and domain information
>gnl|CDD|241052 cd12608, RRM1_CoAA, RNA recognition motif 1 in vertebrate RRM-containing coactivator activator/modulator (CoAA) Back     alignment and domain information
>gnl|CDD|240702 cd12256, RRM2_LKAP, RNA recognition motif 2 in Limkain-b1 (LKAP) and similar proteins Back     alignment and domain information
>gnl|CDD|241125 cd12681, RRM_SKAR, RNA recognition motif in S6K1 Aly/REF-like target (SKAR) and similar proteins Back     alignment and domain information
>gnl|CDD|240853 cd12407, RRM_FOX1_like, RNA recognition motif in vertebrate RNA binding protein fox-1 homologs and similar proteins Back     alignment and domain information
>gnl|CDD|240742 cd12296, RRM1_Prp24, RNA recognition motif 1 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|240850 cd12404, RRM2_NCL, RNA recognition motif 2 in vertebrate nucleolin Back     alignment and domain information
>gnl|CDD|241050 cd12606, RRM1_RBM4, RNA recognition motif 1 in vertebrate RNA-binding protein 4 (RBM4) Back     alignment and domain information
>gnl|CDD|240858 cd12412, RRM_DAZL_BOULE, RNA recognition motif in AZoospermia (DAZ) autosomal homologs, DAZL (DAZ-like) and BOULE Back     alignment and domain information
>gnl|CDD|240897 cd12451, RRM2_NUCLs, RNA recognition motif 2 in nucleolin-like proteins mainly from plants Back     alignment and domain information
>gnl|CDD|241030 cd12586, RRM1_PSP1, RNA recognition motif 1 in vertebrate paraspeckle protein 1 (PSP1) Back     alignment and domain information
>gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family Back     alignment and domain information
>gnl|CDD|240821 cd12375, RRM1_Hu_like, RNA recognition motif 1 in the Hu proteins family, Drosophila sex-lethal (SXL), and similar proteins Back     alignment and domain information
>gnl|CDD|240838 cd12392, RRM2_SART3, RNA recognition motif 2 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins Back     alignment and domain information
>gnl|CDD|240830 cd12384, RRM_RBM24_RBM38_like, RNA recognition motif in eukaryotic RNA-binding protein RBM24, RBM38 and similar proteins Back     alignment and domain information
>gnl|CDD|178680 PLN03134, PLN03134, glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>gnl|CDD|241064 cd12620, RRM3_TIAR, RNA recognition motif 3 in nucleolysin TIAR and similar proteins Back     alignment and domain information
>gnl|CDD|241038 cd12594, RRM1_SRSF4, RNA recognition motif 1 in vertebrate serine/arginine-rich splicing factor 4 (SRSF4) Back     alignment and domain information
>gnl|CDD|240675 cd12229, RRM_G3BP, RNA recognition motif (RRM) in ras GTPase-activating protein-binding protein G3BP1, G3BP2 and similar proteins Back     alignment and domain information
>gnl|CDD|240865 cd12419, RRM_Ssp2_like, RNA recognition motif in yeast sporulation-specific protein 2 (Ssp2) and similar protein Back     alignment and domain information
>gnl|CDD|240680 cd12234, RRM1_AtRSp31_like, RNA recognition motif in Arabidopsis thaliana arginine/serine-rich-splicing factor RSp31 and similar proteins from plants Back     alignment and domain information
>gnl|CDD|241015 cd12571, RRM6_RBM19, RNA recognition motif 6 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|241140 cd12696, RRM3_PTBP2, RNA recognition motif 3 in vertebrate polypyrimidine tract-binding protein 2 (PTBP2) Back     alignment and domain information
>gnl|CDD|240912 cd12466, RRM2_AtRSp31_like, RNA recognition motif 2 in Arabidopsis thaliana arginine/serine-rich-splicing factor RSp31 and similar proteins from plants Back     alignment and domain information
>gnl|CDD|240800 cd12354, RRM3_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins (p40-TIA-1 and TIAR), and yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 Back     alignment and domain information
>gnl|CDD|240799 cd12353, RRM2_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins p40-TIA-1 and TIAR Back     alignment and domain information
>gnl|CDD|241090 cd12646, RRM_SRSF7, RNA recognition motif in vertebrate serine/arginine-rich splicing factor 7 (SRSF7) Back     alignment and domain information
>gnl|CDD|240711 cd12265, RRM_SLT11, RNA recognition motif of pre-mRNA-splicing factor SLT11 and similar proteins Back     alignment and domain information
>gnl|CDD|240794 cd12348, RRM1_SHARP, RNA recognition motif 1 in SMART/HDAC1-associated repressor protein (SHARP) and similar proteins Back     alignment and domain information
>gnl|CDD|240780 cd12334, RRM1_SF3B4, RNA recognition motif 1 in splicing factor 3B subunit 4 (SF3B4) and similar proteins Back     alignment and domain information
>gnl|CDD|240768 cd12322, RRM2_TDP43, RNA recognition motif 2 in TAR DNA-binding protein 43 (TDP-43) and similar proteins Back     alignment and domain information
>gnl|CDD|240695 cd12249, RRM1_hnRNPR_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein R (hnRNP R) and similar proteins Back     alignment and domain information
>gnl|CDD|241115 cd12671, RRM_CSTF2_CSTF2T, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), cleavage stimulation factor subunit 2 tau variant (CSTF2T) and similar proteins Back     alignment and domain information
>gnl|CDD|240779 cd12333, RRM2_p54nrb_like, RNA recognition motif 2 in the p54nrb/PSF/PSP1 family Back     alignment and domain information
>gnl|CDD|240840 cd12394, RRM1_RBM34, RNA recognition motif 1 in RNA-binding protein 34 (RBM34) and similar proteins Back     alignment and domain information
>gnl|CDD|240900 cd12454, RRM2_RIM4_like, RNA recognition motif 2 in yeast meiotic activator RIM4 and similar proteins Back     alignment and domain information
>gnl|CDD|240807 cd12361, RRM1_2_CELF1-6_like, RNA recognition motif 1 and 2 in CELF/Bruno-like family of RNA binding proteins and plant flowering time control protein FCA Back     alignment and domain information
>gnl|CDD|241089 cd12645, RRM_SRSF3, RNA recognition motif in vertebrate serine/arginine-rich splicing factor 3 (SRSF3) Back     alignment and domain information
>gnl|CDD|241052 cd12608, RRM1_CoAA, RNA recognition motif 1 in vertebrate RRM-containing coactivator activator/modulator (CoAA) Back     alignment and domain information
>gnl|CDD|241090 cd12646, RRM_SRSF7, RNA recognition motif in vertebrate serine/arginine-rich splicing factor 7 (SRSF7) Back     alignment and domain information
>gnl|CDD|241213 cd12769, RRM1_HuR, RNA recognition motif 1 in vertebrate Hu-antigen R (HuR) Back     alignment and domain information
>gnl|CDD|240835 cd12389, RRM2_RAVER, RNA recognition motif 2 in ribonucleoprotein PTB-binding raver-1, raver-2 and similar proteins Back     alignment and domain information
>gnl|CDD|240867 cd12421, RRM1_PTBP1_hnRNPL_like, RNA recognition motif in polypyrimidine tract-binding protein 1 (PTB or hnRNP I), heterogeneous nuclear ribonucleoprotein L (hnRNP-L), and similar proteins Back     alignment and domain information
>gnl|CDD|240790 cd12344, RRM1_SECp43_like, RNA recognition motif 1 in tRNA selenocysteine-associated protein 1 (SECp43) and similar proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 823
KOG4660549 consensus Protein Mei2, essential for commitment t 100.0
PF0405997 RRM_2: RNA recognition motif 2; InterPro: IPR00720 100.0
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 99.98
KOG0117506 consensus Heterogeneous nuclear ribonucleoprotein 99.97
TIGR01628562 PABP-1234 polyadenylate binding protein, human typ 99.97
TIGR01628562 PABP-1234 polyadenylate binding protein, human typ 99.97
KOG0145360 consensus RNA-binding protein ELAV/HU (RRM superfa 99.96
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 99.96
TIGR01648578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 99.96
TIGR01649481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 99.95
KOG0148321 consensus Apoptosis-promoting RNA-binding protein 99.95
KOG0145360 consensus RNA-binding protein ELAV/HU (RRM superfa 99.95
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 99.95
TIGR01649481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 99.94
KOG0110725 consensus RNA-binding protein (RRM superfamily) [G 99.94
TIGR01622457 SF-CC1 splicing factor, CC1-like family. A homolog 99.93
TIGR01642509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 99.93
TIGR01645612 half-pint poly-U binding splicing factor, half-pin 99.92
KOG0144510 consensus RNA-binding protein CUGBP1/BRUNO (RRM su 99.92
KOG0127678 consensus Nucleolar protein fibrillarin NOP77 (RRM 99.9
TIGR01622457 SF-CC1 splicing factor, CC1-like family. A homolog 99.9
KOG0144510 consensus RNA-binding protein CUGBP1/BRUNO (RRM su 99.9
TIGR01648578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 99.88
TIGR01645612 half-pint poly-U binding splicing factor, half-pin 99.88
TIGR01642509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 99.87
KOG0117506 consensus Heterogeneous nuclear ribonucleoprotein 99.86
KOG0123369 consensus Polyadenylate-binding protein (RRM super 99.85
KOG0131203 consensus Splicing factor 3b, subunit 4 [RNA proce 99.85
KOG0109346 consensus RNA-binding protein LARK, contains RRM a 99.83
KOG0123369 consensus Polyadenylate-binding protein (RRM super 99.83
KOG0127678 consensus Nucleolar protein fibrillarin NOP77 (RRM 99.82
KOG0110725 consensus RNA-binding protein (RRM superfamily) [G 99.8
KOG0148321 consensus Apoptosis-promoting RNA-binding protein 99.76
KOG0124544 consensus Polypyrimidine tract-binding protein PUF 99.74
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 99.74
KOG4206221 consensus Spliceosomal protein snRNP-U1A/U2B [RNA 99.73
KOG0146371 consensus RNA-binding protein ETR-3 (RRM superfami 99.72
KOG0147549 consensus Transcriptional coactivator CAPER (RRM s 99.7
KOG4212608 consensus RNA-binding protein hnRNP-M [RNA process 99.67
KOG0124544 consensus Polypyrimidine tract-binding protein PUF 99.65
KOG1190492 consensus Polypyrimidine tract-binding protein [RN 99.64
KOG0105241 consensus Alternative splicing factor ASF/SF2 (RRM 99.63
KOG0147549 consensus Transcriptional coactivator CAPER (RRM s 99.62
KOG4205311 consensus RNA-binding protein musashi/mRNA cleavag 99.59
KOG1190492 consensus Polypyrimidine tract-binding protein [RN 99.49
KOG0109346 consensus RNA-binding protein LARK, contains RRM a 99.47
KOG1457284 consensus RNA binding protein (contains RRM repeat 99.46
KOG0106216 consensus Alternative splicing factor SRp55/B52/SR 99.45
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 99.42
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 99.41
KOG1456494 consensus Heterogeneous nuclear ribonucleoprotein 99.36
KOG1548382 consensus Transcription elongation factor TAT-SF1 99.35
KOG4212608 consensus RNA-binding protein hnRNP-M [RNA process 99.31
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 99.28
KOG0107195 consensus Alternative splicing factor SRp20/9G8 (R 99.26
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 99.25
KOG0107195 consensus Alternative splicing factor SRp20/9G8 (R 99.23
KOG0120500 consensus Splicing factor U2AF, large subunit (RRM 99.21
KOG4205311 consensus RNA-binding protein musashi/mRNA cleavag 99.19
COG0724306 RNA-binding proteins (RRM domain) [General functio 99.17
KOG0131203 consensus Splicing factor 3b, subunit 4 [RNA proce 99.16
KOG4211510 consensus Splicing factor hnRNP-F and related RNA- 99.16
KOG0125376 consensus Ataxin 2-binding protein (RRM superfamil 99.16
KOG0122270 consensus Translation initiation factor 3, subunit 99.13
KOG4660549 consensus Protein Mei2, essential for commitment t 99.13
KOG0122270 consensus Translation initiation factor 3, subunit 99.13
KOG1456494 consensus Heterogeneous nuclear ribonucleoprotein 99.12
KOG0121153 consensus Nuclear cap-binding protein complex, sub 99.12
KOG0114124 consensus Predicted RNA-binding protein (RRM super 99.12
PLN03120260 nucleic acid binding protein; Provisional 99.12
KOG0114124 consensus Predicted RNA-binding protein (RRM super 99.12
KOG0121153 consensus Nuclear cap-binding protein complex, sub 99.1
PLN03120260 nucleic acid binding protein; Provisional 99.08
smart0036272 RRM_2 RNA recognition motif. 99.07
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 99.06
KOG0125376 consensus Ataxin 2-binding protein (RRM superfamil 99.05
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 99.04
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 99.03
KOG1365508 consensus RNA-binding protein Fusilli, contains RR 99.0
smart0036272 RRM_2 RNA recognition motif. 99.0
PLN03213 759 repressor of silencing 3; Provisional 98.99
KOG0113335 consensus U1 small nuclear ribonucleoprotein (RRM 98.98
KOG0105241 consensus Alternative splicing factor ASF/SF2 (RRM 98.97
KOG4207256 consensus Predicted splicing factor, SR protein su 98.97
KOG0149247 consensus Predicted RNA-binding protein SEB4 (RRM 98.97
KOG4207256 consensus Predicted splicing factor, SR protein su 98.95
KOG4211510 consensus Splicing factor hnRNP-F and related RNA- 98.92
cd0059074 RRM RRM (RNA recognition motif), also known as RBD 98.92
PLN03121243 nucleic acid binding protein; Provisional 98.91
PLN03213 759 repressor of silencing 3; Provisional 98.9
smart0036071 RRM RNA recognition motif. 98.9
KOG0111298 consensus Cyclophilin-type peptidyl-prolyl cis-tra 98.89
KOG0113335 consensus U1 small nuclear ribonucleoprotein (RRM 98.88
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 98.87
cd0059074 RRM RRM (RNA recognition motif), also known as RBD 98.86
PLN03121243 nucleic acid binding protein; Provisional 98.86
KOG0149247 consensus Predicted RNA-binding protein SEB4 (RRM 98.85
smart0036071 RRM RNA recognition motif. 98.84
KOG0130170 consensus RNA-binding protein RBM8/Tsunagi (RRM su 98.83
KOG0111298 consensus Cyclophilin-type peptidyl-prolyl cis-tra 98.83
COG0724306 RNA-binding proteins (RRM domain) [General functio 98.8
KOG0129520 consensus Predicted RNA-binding protein (RRM super 98.77
KOG0112975 consensus Large RNA-binding protein (RRM superfami 98.75
KOG0108435 consensus mRNA cleavage and polyadenylation factor 98.74
KOG0146371 consensus RNA-binding protein ETR-3 (RRM superfami 98.7
KOG0108435 consensus mRNA cleavage and polyadenylation factor 98.69
KOG0126219 consensus Predicted RNA-binding protein (RRM super 98.68
KOG4206221 consensus Spliceosomal protein snRNP-U1A/U2B [RNA 98.68
smart0036170 RRM_1 RNA recognition motif. 98.65
KOG0130170 consensus RNA-binding protein RBM8/Tsunagi (RRM su 98.63
KOG0126219 consensus Predicted RNA-binding protein (RRM super 98.63
KOG0120500 consensus Splicing factor U2AF, large subunit (RRM 98.62
KOG0132894 consensus RNA polymerase II C-terminal domain-bind 98.6
KOG0132894 consensus RNA polymerase II C-terminal domain-bind 98.53
smart0036170 RRM_1 RNA recognition motif. 98.46
KOG0153377 consensus Predicted RNA-binding protein (RRM super 98.44
KOG4454267 consensus RNA binding protein (RRM superfamily) [G 98.41
KOG0128881 consensus RNA-binding protein SART3 (RRM superfami 98.38
KOG0153377 consensus Predicted RNA-binding protein (RRM super 98.37
KOG0415479 consensus Predicted peptidyl prolyl cis-trans isom 98.32
KOG4210285 consensus Nuclear localization sequence binding pr 98.26
KOG0226290 consensus RNA-binding proteins [General function p 98.21
KOG0415479 consensus Predicted peptidyl prolyl cis-trans isom 98.19
KOG0106216 consensus Alternative splicing factor SRp55/B52/SR 98.18
KOG1548382 consensus Transcription elongation factor TAT-SF1 98.16
KOG4208214 consensus Nucleolar RNA-binding protein NIFK [Gene 98.15
KOG4208214 consensus Nucleolar RNA-binding protein NIFK [Gene 98.1
KOG1457284 consensus RNA binding protein (contains RRM repeat 98.02
KOG0129520 consensus Predicted RNA-binding protein (RRM super 97.99
KOG4661940 consensus Hsp27-ERE-TATA-binding protein/Scaffold 97.98
KOG2193584 consensus IGF-II mRNA-binding protein IMP, contain 97.98
KOG4661940 consensus Hsp27-ERE-TATA-binding protein/Scaffold 97.94
PF03467176 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 97.9
KOG0112975 consensus Large RNA-binding protein (RRM superfami 97.86
KOG0533243 consensus RRM motif-containing protein [RNA proces 97.86
KOG0533243 consensus RRM motif-containing protein [RNA proces 97.84
KOG0151877 consensus Predicted splicing regulator, contains R 97.82
KOG0151 877 consensus Predicted splicing regulator, contains R 97.79
KOG0116419 consensus RasGAP SH3 binding protein rasputin, con 97.71
KOG1365508 consensus RNA-binding protein Fusilli, contains RR 97.68
PF1160890 Limkain-b1: Limkain b1; InterPro: IPR024582 This e 97.67
PF0405997 RRM_2: RNA recognition motif 2; InterPro: IPR00720 97.66
PF1160890 Limkain-b1: Limkain b1; InterPro: IPR024582 This e 97.64
KOG0116419 consensus RasGAP SH3 binding protein rasputin, con 97.63
KOG4209231 consensus Splicing factor RNPS1, SR protein superf 97.56
KOG4676479 consensus Splicing factor, arginine/serine-rich [R 97.49
KOG4307944 consensus RNA binding protein RBM12/SWAN [General 97.37
KOG4454267 consensus RNA binding protein (RRM superfamily) [G 97.25
KOG4209231 consensus Splicing factor RNPS1, SR protein superf 97.2
KOG0226290 consensus RNA-binding proteins [General function p 97.18
PF08777105 RRM_3: RNA binding motif; InterPro: IPR014886 This 97.15
KOG4210285 consensus Nuclear localization sequence binding pr 97.03
COG5175480 MOT2 Transcriptional repressor [Transcription] 96.79
KOG0128881 consensus RNA-binding protein SART3 (RRM superfami 96.78
KOG2193584 consensus IGF-II mRNA-binding protein IMP, contain 96.42
PF1460553 Nup35_RRM_2: Nup53/35/40-type RNA recognition moti 96.38
COG5175480 MOT2 Transcriptional repressor [Transcription] 96.36
KOG1855484 consensus Predicted RNA-binding protein [General f 96.23
KOG0115275 consensus RNA-binding protein p54nrb (RRM superfam 96.21
PF1460553 Nup35_RRM_2: Nup53/35/40-type RNA recognition moti 96.21
PF08777105 RRM_3: RNA binding motif; InterPro: IPR014886 This 96.19
KOG1995351 consensus Conserved Zn-finger protein [General fun 96.14
KOG3152278 consensus TBP-binding protein, activator of basal 95.95
PF05172100 Nup35_RRM: Nup53/35/40-type RNA recognition motif; 95.93
KOG1855484 consensus Predicted RNA-binding protein [General f 95.93
KOG1295 376 consensus Nonsense-mediated decay protein Upf3 [RN 95.83
KOG1995351 consensus Conserved Zn-finger protein [General fun 95.66
KOG2314698 consensus Translation initiation factor 3, subunit 95.53
KOG3152278 consensus TBP-binding protein, activator of basal 95.49
KOG4307944 consensus RNA binding protein RBM12/SWAN [General 95.38
PF05172100 Nup35_RRM: Nup53/35/40-type RNA recognition motif; 94.89
PF07576110 BRAP2: BRCA1-associated protein 2; InterPro: IPR01 94.8
PF08952146 DUF1866: Domain of unknown function (DUF1866) ; In 94.75
KOG2202260 consensus U2 snRNP splicing factor, small subunit, 94.74
KOG0804 493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 94.34
KOG1996378 consensus mRNA splicing factor [RNA processing and 94.3
KOG2314698 consensus Translation initiation factor 3, subunit 94.24
KOG2202260 consensus U2 snRNP splicing factor, small subunit, 93.65
PF15023166 DUF4523: Protein of unknown function (DUF4523) 92.83
KOG4849498 consensus mRNA cleavage factor I subunit/CPSF subu 91.95
PF15023166 DUF4523: Protein of unknown function (DUF4523) 91.82
KOG2416718 consensus Acinus (induces apoptotic chromatin cond 91.68
KOG1996378 consensus mRNA splicing factor [RNA processing and 91.55
KOG2135526 consensus Proteins containing the RNA recognition 91.45
PF0867587 RNA_bind: RNA binding domain; InterPro: IPR014789 91.11
KOG2591684 consensus c-Mpl binding protein, contains La domai 91.02
PF0867587 RNA_bind: RNA binding domain; InterPro: IPR014789 90.93
KOG2591684 consensus c-Mpl binding protein, contains La domai 90.62
PF04847184 Calcipressin: Calcipressin; InterPro: IPR006931 Ca 89.3
PF1030962 DUF2414: Protein of unknown function (DUF2414); In 89.15
PF03467176 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 89.08
KOG4849498 consensus mRNA cleavage factor I subunit/CPSF subu 89.01
KOG2416718 consensus Acinus (induces apoptotic chromatin cond 88.77
PF08952146 DUF1866: Domain of unknown function (DUF1866) ; In 88.68
KOG4676479 consensus Splicing factor, arginine/serine-rich [R 88.28
PF1030962 DUF2414: Protein of unknown function (DUF2414); In 87.97
KOG4285350 consensus Mitotic phosphoprotein [Cell cycle contr 86.14
KOG2068327 consensus MOT2 transcription factor [Transcription 83.62
KOG2068327 consensus MOT2 transcription factor [Transcription 82.41
>KOG4660 consensus Protein Mei2, essential for commitment to meiosis, and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
Probab=100.00  E-value=1.4e-74  Score=637.33  Aligned_cols=495  Identities=53%  Similarity=0.807  Sum_probs=374.6

Q ss_pred             HHHHhhcCCCcEEEeccCccCcccceeEeeecCccccccccccccCCCCccccCCCCCCCCCCcEEEEcCCCCCCCHHHH
Q 003400          130 EDYDIFGSGGGMELEGEPQESLSMSMSKISISDSASGNGLLHYSVPNGAGTVAGEHPYGEHPSRTLFVRNINSNVEDSEL  209 (823)
Q Consensus       130 el~dlFs~~G~v~V~~d~~es~~~g~~~v~~~e~~~a~~~~~~~l~n~~~~~~~~~~~~e~~srtLfV~NLP~~vteeeL  209 (823)
                      +++++|...|++++..+.......   +              -...+..+.+..++|..+  +++ +|         .+|
T Consensus         2 ~d~~lf~~~G~~el~~~~~~~~~~---~--------------~~~~n~~~~~~~~~P~~~--s~~-~~---------~~l   52 (549)
T KOG4660|consen    2 EDCDLFSSGGGMELDADSFDNLSV---R--------------NSDRNSAGFVFPEHPPGE--SRT-FV---------SEL   52 (549)
T ss_pred             CccccccCCCCCCcccccccchhh---c--------------ccccCCCccccCCCCCCC--CCC-Ch---------hhH
Confidence            457889999999776664433221   1              122255667788888877  666 77         788


Q ss_pred             HHHhhcCCCEEEEEeCCCcccEEEEEeCCHHHHHHHHHHhcCCccccccccccccCCCCCCCCCCCCccceeeecCCCCC
Q 003400          210 RALFEQYGDIRTLYTACKHRGFVMISYYDIRAARTAMRALQNKPLRRRKLDIHFSIPKDNPSDKDLNQGTLVVFNLDPSV  289 (823)
Q Consensus       210 r~lFs~fG~I~~v~~~~ksrG~AFV~F~~~e~A~~Ai~~Lng~~l~gr~L~V~~a~pk~~~~~~~~~~~tLfV~NLp~~v  289 (823)
                      ..+|+.|                                       ++++.      .+.+.+++.++++|+|.|||.++
T Consensus        53 ~a~f~~~---------------------------------------~~p~~------~~np~~~~~~~~~L~v~nl~~~V   87 (549)
T KOG4660|consen   53 SALFEPF---------------------------------------NKPLR------PDNPSEKDMNQGTLVVFNLPRSV   87 (549)
T ss_pred             Hhhhhcc---------------------------------------CCCCC------cCCCCcccCccceEEEEecCCcC
Confidence            8899888                                       11111      15566677889999999999999


Q ss_pred             CHHHHHHHhcccCceEEEEeCCCcccEEEEEEcCHHHHHHHHHHhCCCccCCceEEEEecCCCcccchhhhccccccCHH
Q 003400          290 SNEDLRQIFGAYGEVKEIRETPHKRHHKFIEFYDVRAAEAALKSLNRSDIAGKRIKLEPSRPGGARRNLMLQLNQELEQD  369 (823)
Q Consensus       290 teedL~~~Fs~fG~I~~iri~~~srG~aFVeF~d~e~A~kAl~~LnG~~i~Gr~I~V~~s~~~~~r~~~~~ql~~~~~~~  369 (823)
                      ++++|+++|+.||+|+.|+.+...+|..||+|+|+.+|++|+++||+.+|.|++|+    ++++.++..+-+..      
T Consensus        88 sn~~L~~~f~~yGeir~ir~t~~~~~~~~v~FyDvR~A~~Alk~l~~~~~~~~~~k----~~~~~~~~~~~~~~------  157 (549)
T KOG4660|consen   88 SNDTLLRIFGAYGEIREIRETPNKRGIVFVEFYDVRDAERALKALNRREIAGKRIK----RPGGARRAMGLQSG------  157 (549)
T ss_pred             CHHHHHHHHHhhcchhhhhcccccCceEEEEEeehHhHHHHHHHHHHHHhhhhhhc----CCCcccccchhccc------
Confidence            99999999999999999999999999999999999999999999999999999998    77777776665554      


Q ss_pred             HHHHHHhhcCCCCCCCCCCCCccCCCCCCCCccccccCCCCCCCCCCCcCCCCCCCcccCCCCCCcccccccCCCCcCcc
Q 003400          370 ESRILQHQVGSPITNSPPGNWVQFSSPIEHNPLQTISKSPNFRNMSPTTSNHMPGLASILHPQVSTLEKIAPIGKDQGRG  449 (823)
Q Consensus       370 ~l~~~f~~~GsP~a~spP~~~~~~~~p~~~~~~q~~~~~p~~~~~sP~~~~~~~g~~s~~p~~~s~~~~~~~~~~~~~~~  449 (823)
                        ..+..++++|.++++|+.|.+               .+.++.++|......       +...++ +-....+...+.-
T Consensus       158 --~~~~~~~~~p~a~s~pgg~~~---------------~~~~g~l~P~~s~~~-------~~~~~~-~~~~~~~~~~~~~  212 (549)
T KOG4660|consen  158 --TSFLNHFGSPLANSPPGGWPR---------------GQLFGMLSPTRSSIL-------LEHISS-VDGSSPGRETPLL  212 (549)
T ss_pred             --chhhhhccchhhcCCCCCCcC---------------Ccceeeeccchhhhh-------hhcchh-ccCccccccccch
Confidence              567789999999999999951               123444666544322       222111 1111111233333


Q ss_pred             cchhhhcccccccCCCcccccCCCCCCCCCccCCcccCCCCCCCCCCCCccCCCCcccCCCCCCCCCCCCCCcccCCCCC
Q 003400          450 SLMEHALTNTISANGASFQQSNSFSEPKIGLYRGTVSSFGPSPSNGSGVETLSGPQFLWGSPSRYSEHSSSPAWQTSSMG  529 (823)
Q Consensus       450 ~~~~~~~~~~~~~~~~~~~~~~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~w~~~~~~~~~~~~~~w~~~~~~  529 (823)
                      .|  |.|.+      ....-+|+++++..          |..+++..++.+++++--+|                     
T Consensus       213 ~h--q~~~~------~~~~~s~a~~~~~~----------G~~~s~~~~v~t~S~~~g~~---------------------  253 (549)
T KOG4660|consen  213 NH--QRFVE------FADNRSYAFSEPRG----------GFLISNSSGVITFSGPGGVW---------------------  253 (549)
T ss_pred             hh--hhhhh------hccccchhhcccCC----------ceecCCCCceEEecCCCccc---------------------
Confidence            33  33332      11224567777632          66667777888888874444                     


Q ss_pred             CCCCCCCccCCCCCCCCCCCCCCCccccCcCCCCCCCccccccCCCCCCCCCcCCCCccccCCCCCCCCCccccccCCCc
Q 003400          530 HPFSSNGKIHGLPYSGRQGSFLGSSQHHHVGSAPSGVPLERRFGFLPESPETSFMNPVAFCGMGIGQNDGSFMVNMGSRA  609 (823)
Q Consensus       530 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~gsap~~~~~~~~~~~~~~s~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~  609 (823)
                      +++...         ......+..+++||||+||+                  ..+....+++++.+.++++.++.+.  
T Consensus       254 n~~~~~---------r~~~~~~~~~~~~hi~~~Ps------------------~~~l~~~~~~~f~~~s~~~~~~~~~--  304 (549)
T KOG4660|consen  254 NPFPSR---------RQRQNSSSSHYEHHIGSAPS------------------MHHLLSRISVGFNGGSGALEMNSNG--  304 (549)
T ss_pred             CCcccc---------ccccccCcccccCccCCCcc------------------cccccccCccccCCCCCCccccccc--
Confidence            112111         11122344567999999996                  1222335566777777776554222  


Q ss_pred             cCCCC-ccCCCCCCCCCCc-ccccCCCCCCCcccCCCCCCCCCCCccccccc---cccccccccCCCCccccccccccch
Q 003400          610 SVNPG-ITVPRNLSDNGSS-FRVMSSPRLSPVFLGNGPYPGLTPANIEGLYE---RGRSRRIENNNGNQLDSKKQFQLEL  684 (823)
Q Consensus       610 ~~~~~-~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~---r~r~rr~~~~~~~~~~~~~~~~~~~  684 (823)
                      ..|-| .+..+++.+..+. +++.+.++..+.|-+++.+.    ...+...+   ..+.||.+. ...+ ...+++.+|+
T Consensus       305 ~~n~g~~~~t~~~~e~~s~n~~~e~~~rv~~~f~~~~~~~----~~~~~~~~~~~~~~~~Rtt~-~i~n-i~n~~~~~dl  378 (549)
T KOG4660|consen  305 QANQGFLTKTGNVTEFNSKNVGMESSPRVPKNFEGRRSYT----SQNDYPVELILNYRDRRTTV-MIKN-IPNKYGQLDL  378 (549)
T ss_pred             cCCCCccccCcccccccCCCccccccCCCCcccccccccc----cccccccccccccccchhhh-hhhc-cccchhHHHH
Confidence            23444 4578899888886 99999999999999888653    33444444   777788886 3333 3489999999


Q ss_pred             hhHhcCCCcceeEEeecCCCCCCHHHHHHHHHhhCCCcceEEEeeecccccceeEEEEEecCCcccHHHHHHHhcCCccc
Q 003400          685 EKIRSGEDTRTTLMIKNIPNKYTSKMLLAAIDENHKGTYDFLYLPIDFKNKCNVGYAFINMLSPLHIIPFYEAFNGKKWE  764 (823)
Q Consensus       685 ~~i~~g~d~rTt~MirNIPnk~~~~~l~~~id~~~~~~ydf~Ylp~d~~~~~n~gyafin~~~~~~~~~f~~~f~g~~w~  764 (823)
                      .+|.+|+|.|||+||||||||||++||++. ||.++|+|||+||||||+|+||||||||||++|++|++||++|||++|+
T Consensus       379 ~~Ildge~~rtt~~iknipNK~T~~ml~~~-d~~~~gtYDFlYLPiDF~nkcNvGYAFINm~sp~ai~~F~kAFnGk~W~  457 (549)
T KOG4660|consen  379 LRILDGECPRTTLMIKNIPNKYTSKMLLAA-DEKNKGTYDFLYLPIDFKNKCNVGYAFINMTSPEAIIRFYKAFNGKKWE  457 (549)
T ss_pred             HHHHhCcCchhhhHhhccCchhhHHhhhhh-hccccCccceEEeccccccccccceeEEeecCHHHHHHHHHHHcCCchh
Confidence            999999999999999999999999999999 9999999999999999999999999999999999999999999999999


Q ss_pred             CCCCccEEEEEeeecccHHHHHHHhccCccCCCCCCccceEEcC
Q 003400          765 KFNSEKVASLAYARIQGRAALVAHFQNSSLMNEDKRCRPILFHS  808 (823)
Q Consensus       765 ~~~s~k~~~~~~A~iQg~~~l~~~~~~s~~~~~~~~~~p~~f~~  808 (823)
                      +|+|+|||+|+|||||||++|++|||||++|||++.|+|++|++
T Consensus       458 ~FnS~Kia~itYArIQGk~~Li~hFqnS~lm~E~e~y~Pvvf~p  501 (549)
T KOG4660|consen  458 KFNSEKIASITYARIQGKEALIEHFQNSSLMCEDEAYRPVVFSP  501 (549)
T ss_pred             hhcceeeeeeehhhhhchHHHHHHhhcccccccchhcCceEecC
Confidence            99999999999999999999999999999999999999999997



>PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2 Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>KOG0117 consensus Heterogeneous nuclear ribonucleoprotein R (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>KOG0145 consensus RNA-binding protein ELAV/HU (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>KOG0148 consensus Apoptosis-promoting RNA-binding protein TIA-1/TIAR (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0145 consensus RNA-binding protein ELAV/HU (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>KOG0110 consensus RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>KOG0144 consensus RNA-binding protein CUGBP1/BRUNO (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0127 consensus Nucleolar protein fibrillarin NOP77 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>KOG0144 consensus RNA-binding protein CUGBP1/BRUNO (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>KOG0117 consensus Heterogeneous nuclear ribonucleoprotein R (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0123 consensus Polyadenylate-binding protein (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0131 consensus Splicing factor 3b, subunit 4 [RNA processing and modification] Back     alignment and domain information
>KOG0109 consensus RNA-binding protein LARK, contains RRM and retroviral-type Zn-finger domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG0123 consensus Polyadenylate-binding protein (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0127 consensus Nucleolar protein fibrillarin NOP77 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0110 consensus RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0148 consensus Apoptosis-promoting RNA-binding protein TIA-1/TIAR (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0124 consensus Polypyrimidine tract-binding protein PUF60 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>KOG4206 consensus Spliceosomal protein snRNP-U1A/U2B [RNA processing and modification] Back     alignment and domain information
>KOG0146 consensus RNA-binding protein ETR-3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0147 consensus Transcriptional coactivator CAPER (RRM superfamily) [Transcription] Back     alignment and domain information
>KOG4212 consensus RNA-binding protein hnRNP-M [RNA processing and modification] Back     alignment and domain information
>KOG0124 consensus Polypyrimidine tract-binding protein PUF60 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG1190 consensus Polypyrimidine tract-binding protein [RNA processing and modification] Back     alignment and domain information
>KOG0105 consensus Alternative splicing factor ASF/SF2 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0147 consensus Transcriptional coactivator CAPER (RRM superfamily) [Transcription] Back     alignment and domain information
>KOG4205 consensus RNA-binding protein musashi/mRNA cleavage and polyadenylation factor I complex, subunit HRP1 [RNA processing and modification] Back     alignment and domain information
>KOG1190 consensus Polypyrimidine tract-binding protein [RNA processing and modification] Back     alignment and domain information
>KOG0109 consensus RNA-binding protein LARK, contains RRM and retroviral-type Zn-finger domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG1457 consensus RNA binding protein (contains RRM repeats) [General function prediction only] Back     alignment and domain information
>KOG0106 consensus Alternative splicing factor SRp55/B52/SRp75 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>KOG1456 consensus Heterogeneous nuclear ribonucleoprotein L (contains RRM repeats) [RNA processing and modification] Back     alignment and domain information
>KOG1548 consensus Transcription elongation factor TAT-SF1 [Transcription] Back     alignment and domain information
>KOG4212 consensus RNA-binding protein hnRNP-M [RNA processing and modification] Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>KOG0107 consensus Alternative splicing factor SRp20/9G8 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>KOG0107 consensus Alternative splicing factor SRp20/9G8 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0120 consensus Splicing factor U2AF, large subunit (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG4205 consensus RNA-binding protein musashi/mRNA cleavage and polyadenylation factor I complex, subunit HRP1 [RNA processing and modification] Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>KOG0131 consensus Splicing factor 3b, subunit 4 [RNA processing and modification] Back     alignment and domain information
>KOG4211 consensus Splicing factor hnRNP-F and related RNA-binding proteins [RNA processing and modification] Back     alignment and domain information
>KOG0125 consensus Ataxin 2-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0122 consensus Translation initiation factor 3, subunit g (eIF-3g) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG4660 consensus Protein Mei2, essential for commitment to meiosis, and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0122 consensus Translation initiation factor 3, subunit g (eIF-3g) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1456 consensus Heterogeneous nuclear ribonucleoprotein L (contains RRM repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0121 consensus Nuclear cap-binding protein complex, subunit CBP20 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0114 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>PLN03120 nucleic acid binding protein; Provisional Back     alignment and domain information
>KOG0114 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0121 consensus Nuclear cap-binding protein complex, subunit CBP20 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PLN03120 nucleic acid binding protein; Provisional Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>KOG0125 consensus Ataxin 2-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information
>KOG1365 consensus RNA-binding protein Fusilli, contains RRM domain [RNA processing and modification; General function prediction only] Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>PLN03213 repressor of silencing 3; Provisional Back     alignment and domain information
>KOG0113 consensus U1 small nuclear ribonucleoprotein (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0105 consensus Alternative splicing factor ASF/SF2 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG4207 consensus Predicted splicing factor, SR protein superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0149 consensus Predicted RNA-binding protein SEB4 (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG4207 consensus Predicted splicing factor, SR protein superfamily [RNA processing and modification] Back     alignment and domain information
>KOG4211 consensus Splicing factor hnRNP-F and related RNA-binding proteins [RNA processing and modification] Back     alignment and domain information
>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability Back     alignment and domain information
>PLN03121 nucleic acid binding protein; Provisional Back     alignment and domain information
>PLN03213 repressor of silencing 3; Provisional Back     alignment and domain information
>smart00360 RRM RNA recognition motif Back     alignment and domain information
>KOG0111 consensus Cyclophilin-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0113 consensus U1 small nuclear ribonucleoprotein (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information
>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability Back     alignment and domain information
>PLN03121 nucleic acid binding protein; Provisional Back     alignment and domain information
>KOG0149 consensus Predicted RNA-binding protein SEB4 (RRM superfamily) [General function prediction only] Back     alignment and domain information
>smart00360 RRM RNA recognition motif Back     alignment and domain information
>KOG0130 consensus RNA-binding protein RBM8/Tsunagi (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0111 consensus Cyclophilin-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>KOG0129 consensus Predicted RNA-binding protein (RRM superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0112 consensus Large RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0108 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA15 [RNA processing and modification] Back     alignment and domain information
>KOG0146 consensus RNA-binding protein ETR-3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0108 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA15 [RNA processing and modification] Back     alignment and domain information
>KOG0126 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG4206 consensus Spliceosomal protein snRNP-U1A/U2B [RNA processing and modification] Back     alignment and domain information
>smart00361 RRM_1 RNA recognition motif Back     alignment and domain information
>KOG0130 consensus RNA-binding protein RBM8/Tsunagi (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0126 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0120 consensus Splicing factor U2AF, large subunit (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0132 consensus RNA polymerase II C-terminal domain-binding protein RA4, contains RPR and RRM domains [RNA processing and modification; Transcription] Back     alignment and domain information
>KOG0132 consensus RNA polymerase II C-terminal domain-binding protein RA4, contains RPR and RRM domains [RNA processing and modification; Transcription] Back     alignment and domain information
>smart00361 RRM_1 RNA recognition motif Back     alignment and domain information
>KOG0153 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG4454 consensus RNA binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0153 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0415 consensus Predicted peptidyl prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4210 consensus Nuclear localization sequence binding protein [Transcription] Back     alignment and domain information
>KOG0226 consensus RNA-binding proteins [General function prediction only] Back     alignment and domain information
>KOG0415 consensus Predicted peptidyl prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0106 consensus Alternative splicing factor SRp55/B52/SRp75 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG1548 consensus Transcription elongation factor TAT-SF1 [Transcription] Back     alignment and domain information
>KOG4208 consensus Nucleolar RNA-binding protein NIFK [General function prediction only] Back     alignment and domain information
>KOG4208 consensus Nucleolar RNA-binding protein NIFK [General function prediction only] Back     alignment and domain information
>KOG1457 consensus RNA binding protein (contains RRM repeats) [General function prediction only] Back     alignment and domain information
>KOG0129 consensus Predicted RNA-binding protein (RRM superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG4661 consensus Hsp27-ERE-TATA-binding protein/Scaffold attachment factor (SAF-B) [Transcription] Back     alignment and domain information
>KOG2193 consensus IGF-II mRNA-binding protein IMP, contains RRM and KH domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG4661 consensus Hsp27-ERE-TATA-binding protein/Scaffold attachment factor (SAF-B) [Transcription] Back     alignment and domain information
>PF03467 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 Nonsense-mediated mRNA decay (NMD) is a surveillance mechanism by which eukaryotic cells detect and degrade transcripts containing premature termination codons Back     alignment and domain information
>KOG0112 consensus Large RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0533 consensus RRM motif-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG0533 consensus RRM motif-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG0151 consensus Predicted splicing regulator, contains RRM, SWAP and RPR domains [General function prediction only] Back     alignment and domain information
>KOG0151 consensus Predicted splicing regulator, contains RRM, SWAP and RPR domains [General function prediction only] Back     alignment and domain information
>KOG0116 consensus RasGAP SH3 binding protein rasputin, contains NTF2 and RRM domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG1365 consensus RNA-binding protein Fusilli, contains RRM domain [RNA processing and modification; General function prediction only] Back     alignment and domain information
>PF11608 Limkain-b1: Limkain b1; InterPro: IPR024582 This entry represents a conserved domain found in limkain b1, which is a novel human autoantigen, localised to a subset of ABCD3 and PXF marked peroxisomes Back     alignment and domain information
>PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2 Back     alignment and domain information
>PF11608 Limkain-b1: Limkain b1; InterPro: IPR024582 This entry represents a conserved domain found in limkain b1, which is a novel human autoantigen, localised to a subset of ABCD3 and PXF marked peroxisomes Back     alignment and domain information
>KOG0116 consensus RasGAP SH3 binding protein rasputin, contains NTF2 and RRM domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG4209 consensus Splicing factor RNPS1, SR protein superfamily [RNA processing and modification] Back     alignment and domain information
>KOG4676 consensus Splicing factor, arginine/serine-rich [RNA processing and modification] Back     alignment and domain information
>KOG4307 consensus RNA binding protein RBM12/SWAN [General function prediction only] Back     alignment and domain information
>KOG4454 consensus RNA binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG4209 consensus Splicing factor RNPS1, SR protein superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0226 consensus RNA-binding proteins [General function prediction only] Back     alignment and domain information
>PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation Back     alignment and domain information
>KOG4210 consensus Nuclear localization sequence binding protein [Transcription] Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG2193 consensus IGF-II mRNA-binding protein IMP, contains RRM and KH domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG1855 consensus Predicted RNA-binding protein [General function prediction only] Back     alignment and domain information
>KOG0115 consensus RNA-binding protein p54nrb (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif Back     alignment and domain information
>PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation Back     alignment and domain information
>KOG1995 consensus Conserved Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG3152 consensus TBP-binding protein, activator of basal transcription (contains rrm motif) [Transcription] Back     alignment and domain information
>PF05172 Nup35_RRM: Nup53/35/40-type RNA recognition motif; InterPro: IPR007846 The MPPN (Mitotic PhosphoProtein N end) family is uncharacterised however it probably plays a role in the cell cycle because the family includes mitotic phosphoproteins O13026 from SWISSPROT [] Back     alignment and domain information
>KOG1855 consensus Predicted RNA-binding protein [General function prediction only] Back     alignment and domain information
>KOG1295 consensus Nonsense-mediated decay protein Upf3 [RNA processing and modification] Back     alignment and domain information
>KOG1995 consensus Conserved Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG3152 consensus TBP-binding protein, activator of basal transcription (contains rrm motif) [Transcription] Back     alignment and domain information
>KOG4307 consensus RNA binding protein RBM12/SWAN [General function prediction only] Back     alignment and domain information
>PF05172 Nup35_RRM: Nup53/35/40-type RNA recognition motif; InterPro: IPR007846 The MPPN (Mitotic PhosphoProtein N end) family is uncharacterised however it probably plays a role in the cell cycle because the family includes mitotic phosphoproteins O13026 from SWISSPROT [] Back     alignment and domain information
>PF07576 BRAP2: BRCA1-associated protein 2; InterPro: IPR011422 These proteins include BRCA1-associated protein 2 (BRAP2), which binds nuclear localisation signals (NLSs) in vitro and in yeast two-hybrid screening [] Back     alignment and domain information
>PF08952 DUF1866: Domain of unknown function (DUF1866) ; InterPro: IPR015047 This domain, found in synaptojanin, has no known function Back     alignment and domain information
>KOG2202 consensus U2 snRNP splicing factor, small subunit, and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>KOG1996 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2202 consensus U2 snRNP splicing factor, small subunit, and related proteins [RNA processing and modification] Back     alignment and domain information
>PF15023 DUF4523: Protein of unknown function (DUF4523) Back     alignment and domain information
>KOG4849 consensus mRNA cleavage factor I subunit/CPSF subunit [RNA processing and modification] Back     alignment and domain information
>PF15023 DUF4523: Protein of unknown function (DUF4523) Back     alignment and domain information
>KOG2416 consensus Acinus (induces apoptotic chromatin condensation) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1996 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG2135 consensus Proteins containing the RNA recognition motif [General function prediction only] Back     alignment and domain information
>PF08675 RNA_bind: RNA binding domain; InterPro: IPR014789 This domain corresponds to the RNA binding domain of Poly(A)-specific ribonuclease (PARN) Back     alignment and domain information
>KOG2591 consensus c-Mpl binding protein, contains La domain [Signal transduction mechanisms] Back     alignment and domain information
>PF08675 RNA_bind: RNA binding domain; InterPro: IPR014789 This domain corresponds to the RNA binding domain of Poly(A)-specific ribonuclease (PARN) Back     alignment and domain information
>KOG2591 consensus c-Mpl binding protein, contains La domain [Signal transduction mechanisms] Back     alignment and domain information
>PF04847 Calcipressin: Calcipressin; InterPro: IPR006931 Calcipressin 1 negatively regulates calcineurin (IPR015757 from INTERPRO) by direct binding and is essential for the survival of T helper type 1 cells Back     alignment and domain information
>PF10309 DUF2414: Protein of unknown function (DUF2414); InterPro: IPR019416 This entry contains proteins that have no known function Back     alignment and domain information
>PF03467 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 Nonsense-mediated mRNA decay (NMD) is a surveillance mechanism by which eukaryotic cells detect and degrade transcripts containing premature termination codons Back     alignment and domain information
>KOG4849 consensus mRNA cleavage factor I subunit/CPSF subunit [RNA processing and modification] Back     alignment and domain information
>KOG2416 consensus Acinus (induces apoptotic chromatin condensation) [Chromatin structure and dynamics] Back     alignment and domain information
>PF08952 DUF1866: Domain of unknown function (DUF1866) ; InterPro: IPR015047 This domain, found in synaptojanin, has no known function Back     alignment and domain information
>KOG4676 consensus Splicing factor, arginine/serine-rich [RNA processing and modification] Back     alignment and domain information
>PF10309 DUF2414: Protein of unknown function (DUF2414); InterPro: IPR019416 This entry contains proteins that have no known function Back     alignment and domain information
>KOG4285 consensus Mitotic phosphoprotein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2068 consensus MOT2 transcription factor [Transcription] Back     alignment and domain information
>KOG2068 consensus MOT2 transcription factor [Transcription] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query823
3sde_B261 Crystal Structure Of A Paraspeckle-Protein Heterodi 4e-07
2qfj_A216 Crystal Structure Of First Two Rrm Domains Of Fir B 1e-06
3sde_A261 Crystal Structure Of A Paraspeckle-Protein Heterodi 4e-06
2kxf_A199 Solution Structure Of The First Two Rrm Domains Of 8e-06
1b7f_A168 Sxl-Lethal ProteinRNA COMPLEX Length = 168 2e-05
2dhs_A187 Solution Structure Of Nucleic Acid Binding Protein 3e-05
3nnc_A175 Crystal Structure Of Cugbp1 Rrm12-Rna Complex Lengt 5e-05
1fxl_A167 Crystal Structure Of Hud And Au-Rich Element Of The 6e-05
1fnx_H174 Solution Structure Of The Huc Rbd1-Rbd2 Complexed W 6e-05
3sxl_A184 Sex-Lethal Rna Recognition Domains 1 And 2 From Dro 7e-05
3uwt_A200 Crystal Structure Of A Rna Binding Domain Of Poly-U 8e-05
1x5s_A102 Solution Structure Of Rrm Domain In A18 Hnrnp Lengt 2e-04
2krr_A180 Solution Structure Of The Rbd1,2 Domains From Human 2e-04
3pgw_A282 Crystal Structure Of Human U1 Snrnp Length = 282 2e-04
1fje_B175 Solution Structure Of Nucleolin Rbd12 In Complex Wi 3e-04
4f02_A213 Crystal Structure Of The Pabp-Binding Site Of Eif4g 5e-04
3nmr_A175 Crystal Structure Of Cugbp1 Rrm12-Rna Complex Lengt 6e-04
2fc9_A101 Solution Structure Of The Rrm_1 Domain Of Ncl Prote 6e-04
>pdb|3SDE|B Chain B, Crystal Structure Of A Paraspeckle-Protein Heterodimer, Pspc1NONO Length = 261 Back     alignment and structure

Iteration: 1

Score = 53.5 bits (127), Expect = 4e-07, Method: Composition-based stats. Identities = 36/111 (32%), Positives = 55/111 (49%), Gaps = 11/111 (9%) Query: 195 LFVRNINSNVEDSELRALFEQYGDIRTLYTACKHRGFVMISYYDIRAARTAMRALQNKPL 254 LFV N+ ++ + E+R LFE+YG ++ K +GF I A A L N PL Sbjct: 25 LFVGNLPPDITEEEMRKLFEKYGKAGEVFIH-KDKGFGFIRLETRTLAEIAKVELDNMPL 83 Query: 255 RRRKLDIHFSIPKDNPSDKDLNQGTLVVFNLDPSVSNEDLRQIFGAYGEVK 305 R ++L + F+ + +L V NL VSNE L + F +G+V+ Sbjct: 84 RGKQLRVRFAC----------HSASLTVRNLPQYVSNELLEEAFSVFGQVE 124
>pdb|2QFJ|A Chain A, Crystal Structure Of First Two Rrm Domains Of Fir Bound To Ssdna From A Portion Of Fuse Length = 216 Back     alignment and structure
>pdb|3SDE|A Chain A, Crystal Structure Of A Paraspeckle-Protein Heterodimer, Pspc1NONO Length = 261 Back     alignment and structure
>pdb|2KXF|A Chain A, Solution Structure Of The First Two Rrm Domains Of Fbp-Interacting Repressor (Fir) Length = 199 Back     alignment and structure
>pdb|1B7F|A Chain A, Sxl-Lethal ProteinRNA COMPLEX Length = 168 Back     alignment and structure
>pdb|2DHS|A Chain A, Solution Structure Of Nucleic Acid Binding Protein Cugbp1ab And Its Binding Study With Dna And Rna Length = 187 Back     alignment and structure
>pdb|3NNC|A Chain A, Crystal Structure Of Cugbp1 Rrm12-Rna Complex Length = 175 Back     alignment and structure
>pdb|1FXL|A Chain A, Crystal Structure Of Hud And Au-Rich Element Of The C-Fos Rna Length = 167 Back     alignment and structure
>pdb|1FNX|H Chain H, Solution Structure Of The Huc Rbd1-Rbd2 Complexed With The Au-Rich Element Length = 174 Back     alignment and structure
>pdb|3SXL|A Chain A, Sex-Lethal Rna Recognition Domains 1 And 2 From Drosophila Melanogaster Length = 184 Back     alignment and structure
>pdb|3UWT|A Chain A, Crystal Structure Of A Rna Binding Domain Of Poly-U Binding Splicing Factor 60kda (Puf60) From Homo Sapiens At 2.50 A Resolution Length = 200 Back     alignment and structure
>pdb|1X5S|A Chain A, Solution Structure Of Rrm Domain In A18 Hnrnp Length = 102 Back     alignment and structure
>pdb|2KRR|A Chain A, Solution Structure Of The Rbd1,2 Domains From Human Nucleoli Length = 180 Back     alignment and structure
>pdb|3PGW|A Chain A, Crystal Structure Of Human U1 Snrnp Length = 282 Back     alignment and structure
>pdb|1FJE|B Chain B, Solution Structure Of Nucleolin Rbd12 In Complex With Snre Rna Length = 175 Back     alignment and structure
>pdb|4F02|A Chain A, Crystal Structure Of The Pabp-Binding Site Of Eif4g In Complex With Rrm1-2 Of Pabp And Poly(A) Length = 213 Back     alignment and structure
>pdb|3NMR|A Chain A, Crystal Structure Of Cugbp1 Rrm12-Rna Complex Length = 175 Back     alignment and structure
>pdb|2FC9|A Chain A, Solution Structure Of The Rrm_1 Domain Of Ncl Protein Length = 101 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query823
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 2e-32
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 1e-13
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 3e-07
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 6e-32
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 2e-12
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 8e-30
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 3e-14
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 6e-09
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 3e-29
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 2e-26
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 2e-11
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 1e-07
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 8e-28
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 7e-14
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 3e-26
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 7e-24
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 5e-11
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 4e-25
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 1e-11
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 2e-24
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 4e-13
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 3e-04
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 3e-24
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 4e-06
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 4e-23
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 4e-23
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 7e-13
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 9e-08
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 7e-23
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 3e-12
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 1e-22
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 2e-13
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 2e-21
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 8e-12
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 3e-21
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 9e-13
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 7e-06
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 3e-21
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 3e-12
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 2e-04
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 3e-20
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 1e-06
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 6e-20
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 2e-09
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 9e-20
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 2e-07
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 1e-06
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 4e-19
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 6e-15
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 4e-19
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 4e-09
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 3e-17
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 3e-16
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 3e-17
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 1e-16
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 1e-16
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 4e-11
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 6e-16
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 2e-10
2i2y_A150 Fusion protein consists of immunoglobin G- binding 6e-16
2i2y_A150 Fusion protein consists of immunoglobin G- binding 2e-12
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 6e-16
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 7e-12
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 1e-15
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 6e-08
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 2e-15
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 1e-11
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 2e-15
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 6e-11
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 2e-15
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 6e-10
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 3e-15
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 2e-10
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 3e-15
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 4e-13
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 3e-15
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 2e-14
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 3e-15
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 1e-07
2cpj_A99 Non-POU domain-containing octamer-binding protein; 4e-15
2cpj_A99 Non-POU domain-containing octamer-binding protein; 1e-11
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 4e-15
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 3e-09
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 5e-15
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 2e-09
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 5e-15
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 1e-11
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 7e-15
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 1e-09
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 1e-14
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 7e-10
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 1e-14
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 6e-09
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 2e-14
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 6e-14
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 4e-14
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 5e-11
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 5e-14
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 5e-10
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 6e-14
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 2e-08
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 9e-14
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 9e-11
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 9e-14
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 5e-07
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 1e-13
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 7e-11
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 1e-13
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 1e-08
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 1e-13
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 2e-09
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 2e-13
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 6e-11
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 2e-13
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 7e-13
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 2e-13
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 5e-10
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 2e-13
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 5e-11
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 2e-13
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 5e-06
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 3e-13
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 2e-09
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 4e-13
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 5e-11
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 4e-13
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 1e-10
2cph_A107 RNA binding motif protein 19; RNA recognition moti 4e-13
2cph_A107 RNA binding motif protein 19; RNA recognition moti 8e-12
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 5e-13
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 7e-10
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 5e-13
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 3e-12
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 6e-13
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 2e-11
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 7e-13
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 4e-09
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 8e-13
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 2e-10
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 9e-13
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 7e-09
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 9e-13
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 5e-08
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 9e-13
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 3e-09
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 9e-13
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 2e-08
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 1e-12
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 3e-11
1x5p_A97 Negative elongation factor E; structure genomics, 1e-12
1x5p_A97 Negative elongation factor E; structure genomics, 5e-07
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 1e-12
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 2e-07
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 1e-12
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 3e-10
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 2e-12
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 8e-07
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 2e-12
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 8e-08
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 3e-12
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 1e-08
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 3e-12
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 7e-11
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 3e-12
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 9e-08
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 4e-12
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 4e-10
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 4e-12
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 2e-08
1x4e_A85 RNA binding motif, single-stranded interacting pro 5e-12
1x4e_A85 RNA binding motif, single-stranded interacting pro 1e-07
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 5e-12
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 3e-06
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 5e-12
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 3e-09
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 5e-12
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 2e-09
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 5e-12
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 4e-08
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 6e-12
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 4e-06
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 8e-12
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 9e-12
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 1e-11
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 5e-05
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 1e-11
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 1e-08
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 1e-11
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 3e-09
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 2e-11
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 4e-06
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 3e-11
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 1e-06
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 3e-11
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 6e-10
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 5e-08
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 2e-07
2dis_A109 Unnamed protein product; structural genomics, RRM 3e-11
2dis_A109 Unnamed protein product; structural genomics, RRM 8e-10
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 4e-11
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 5e-08
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 4e-11
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 1e-08
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 4e-11
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 8e-06
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 4e-11
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 7e-07
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} Len 5e-11
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} Len 1e-08
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 6e-11
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 1e-08
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 7e-11
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 4e-07
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 2e-10
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 1e-06
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 3e-10
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 7e-07
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 3e-10
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 4e-08
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 3e-10
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 7e-10
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 3e-10
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 7e-10
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 4e-10
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 1e-06
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 4e-10
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 7e-10
1x5o_A114 RNA binding motif, single-stranded interacting pro 6e-10
1x5o_A114 RNA binding motif, single-stranded interacting pro 7e-06
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 8e-10
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 2e-07
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 8e-10
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 7e-06
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 1e-09
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 2e-06
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 1e-09
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 1e-06
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 2e-09
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 2e-07
2la6_A99 RNA-binding protein FUS; structural genomics, nort 2e-09
2la6_A99 RNA-binding protein FUS; structural genomics, nort 1e-08
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 2e-09
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 2e-09
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 5e-08
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 3e-09
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 8e-09
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 3e-09
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 7e-08
3p5t_L90 Cleavage and polyadenylation specificity factor S; 4e-09
3p5t_L90 Cleavage and polyadenylation specificity factor S; 3e-05
2kt5_A124 RNA and export factor-binding protein 2; chaperone 5e-09
2kt5_A124 RNA and export factor-binding protein 2; chaperone 7e-07
2f3j_A177 RNA and export factor binding protein 2; RRM domai 5e-09
2f3j_A177 RNA and export factor binding protein 2; RRM domai 1e-05
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 6e-09
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 7e-06
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 7e-09
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-06
2div_A99 TRNA selenocysteine associated protein; structural 9e-09
2div_A99 TRNA selenocysteine associated protein; structural 2e-05
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 9e-09
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 5e-04
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 1e-08
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 7e-05
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 2e-08
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 5e-06
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 2e-08
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 1e-04
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 2e-08
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 9e-08
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 3e-08
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 4e-08
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 8e-06
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 4e-08
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 2e-06
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 4e-08
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 1e-06
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 5e-08
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 1e-04
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 5e-08
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 7e-08
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 6e-08
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 2e-04
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 6e-08
2cqd_A116 RNA-binding region containing protein 1; RNA recog 8e-08
2cqd_A116 RNA-binding region containing protein 1; RNA recog 9e-08
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 9e-08
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 9e-08
3n9u_C156 Cleavage and polyadenylation specificity factor S; 1e-07
3n9u_C156 Cleavage and polyadenylation specificity factor S; 5e-06
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 1e-07
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 8e-04
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 3e-07
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 2e-05
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 4e-07
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 2e-06
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 4e-07
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 6e-07
3q2s_C229 Cleavage and polyadenylation specificity factor S; 7e-07
3q2s_C229 Cleavage and polyadenylation specificity factor S; 7e-06
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 1e-06
2krb_A81 Eukaryotic translation initiation factor 3 subunit 1e-06
2krb_A81 Eukaryotic translation initiation factor 3 subunit 1e-04
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 1e-06
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 6e-04
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 2e-06
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 4e-05
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 2e-06
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 3e-06
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 3e-06
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 9e-05
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 6e-06
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 3e-04
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 7e-06
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 4e-04
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 1e-05
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 5e-04
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 1e-05
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 6e-05
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 1e-05
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 5e-04
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 2e-05
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 2e-05
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 5e-04
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 2e-05
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 3e-05
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 3e-05
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 3e-05
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 4e-05
2dnl_A114 Cytoplasmic polyadenylation element binding protei 1e-04
2dnl_A114 Cytoplasmic polyadenylation element binding protei 2e-04
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 1e-04
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 1e-04
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 1e-04
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 5e-04
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 1e-04
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 2e-04
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 2e-04
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 4e-04
1wey_A104 Calcipressin 1; structural genomics, RRM domain, r 3e-04
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 6e-04
3tht_A345 Alkylated DNA repair protein ALKB homolog 8; struc 8e-04
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
 Score =  124 bits (311), Expect = 2e-32
 Identities = 33/196 (16%), Positives = 59/196 (30%), Gaps = 39/196 (19%)

Query: 191 PSRTLFVRNIN-SNVEDSELRALFEQYGDIRTLYTACKHRGFVMISYYDIRAARTAMRAL 249
            S  L V  ++ S +    +  +F  YG++  +       G  M+   D  A   A+  L
Sbjct: 3   DSPVLMVYGLDQSKMNCDRVFNVFCLYGNVEKVKFMKSKPGAAMVEMADGYAVDRAITHL 62

Query: 250 QNKPLRRRKLDIHFS------------IPKDNPSDKDLNQG------------------- 278
            N  +  +K+++  S            +   + S KD ++                    
Sbjct: 63  NNNFMFGQKMNVCVSKQPAIMPGQSYGLEDGSCSYKDFSESRNNRFSTPEQAAKNRIQHP 122

Query: 279 --TLVVFNLDPSVSNEDLRQIFGAYG-----EVKEIRETPHKRHHKFIEFYDVRAAEAAL 331
              L  FN    V+ E+  +I    G      VK       +     +E+     A   L
Sbjct: 123 SNVLHFFNAPLEVTEENFFEICDELGVKRPTSVKVFSGKSERSSSGLLEWDSKSDALETL 182

Query: 332 KSLNRSDIAGKRIKLE 347
             LN   +        
Sbjct: 183 GFLNHYQMKNPNGPYP 198


>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Length = 97 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Length = 97 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 119 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 119 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} PDB: 2f9d_A 2f9j_A 2fho_B Length = 115 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} PDB: 2f9d_A 2f9j_A 2fho_B Length = 115 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 93 Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 93 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Length = 101 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Length = 101 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Length = 150 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Length = 150 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Length = 108 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Length = 108 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Length = 88 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Length = 88 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Length = 110 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Length = 110 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Length = 158 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Length = 158 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Length = 103 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Length = 103 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Length = 156 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Length = 156 Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Length = 110 Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Length = 110 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 95 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 95 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Length = 96 Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Length = 96 Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Length = 135 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Length = 135 Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Length = 143 Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Length = 143 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 115 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 115 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Length = 110 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Length = 110 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Length = 100 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Length = 100 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Length = 124 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Length = 124 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Length = 129 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Length = 129 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Length = 165 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Length = 165 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 107 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 107 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 97 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 97 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Length = 97 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Length = 97 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 102 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 102 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Length = 126 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Length = 126 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Length = 115 Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Length = 115 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Length = 88 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Length = 88 Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 124 Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 124 Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Length = 164 Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Length = 164 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ALT splicing, mRNA processing, mRNA splicing; 1.85A {Homo sapiens} PDB: 2kyx_A 3lpy_A* Length = 85 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ALT splicing, mRNA processing, mRNA splicing; 1.85A {Homo sapiens} PDB: 2kyx_A 3lpy_A* Length = 85 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 85 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 85 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Length = 139 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Length = 139 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Length = 106 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Length = 106 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Length = 89 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Length = 89 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Length = 96 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Length = 96 Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Length = 115 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Length = 115 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Length = 118 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Length = 118 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Length = 92 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Length = 92 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Length = 115 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Length = 115 Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} Length = 83 Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} Length = 83 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Length = 95 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Length = 95 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Length = 87 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Length = 87 Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 113 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 113 Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Length = 90 Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Length = 90 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Length = 89 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Length = 95 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Length = 95 Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Length = 130 Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Length = 130 Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Length = 90 Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Length = 90 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Length = 124 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Length = 124 Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Length = 177 Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Length = 177 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Length = 107 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Length = 107 Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Length = 240 Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Length = 240 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Length = 102 Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Length = 102 Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 124 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Length = 106 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Length = 106 Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 112 Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 112 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Length = 105 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Length = 105 Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Length = 126 Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Length = 126 Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Length = 139 Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Length = 156 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Length = 156 Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Length = 100 Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Length = 100 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 108 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 108 Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Length = 115 Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Length = 115 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Length = 229 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Length = 229 Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 109 Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 103 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 103 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 88 Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 88 Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Length = 87 Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Length = 87 Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Length = 87 Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Length = 87 Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Length = 111 Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Length = 111 Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Length = 75 Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Length = 75 Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Length = 89 Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Length = 89 Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Length = 193 Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 118 Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Length = 75 Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Length = 75 Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Length = 77 Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Length = 77 Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Length = 109 Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Length = 107 Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>1wey_A Calcipressin 1; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Length = 345 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query823
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 99.98
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 99.97
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 99.96
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.96
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 99.96
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 99.96
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 99.95
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.95
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 99.95
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.95
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 99.95
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 99.95
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.95
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 99.95
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 99.95
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 99.95
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 99.95
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 99.94
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 99.94
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 99.93
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 99.78
2i2y_A150 Fusion protein consists of immunoglobin G- binding 99.78
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 99.77
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 99.77
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 99.76
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.76
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 99.75
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 99.75
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 99.75
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 99.75
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 99.74
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 99.73
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 99.7
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 99.7
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.7
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 99.69
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.68
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 99.63
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.62
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 99.61
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 99.61
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 99.61
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 99.59
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 99.59
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 99.59
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 99.58
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 99.57
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 99.56
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 99.56
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 99.55
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 99.55
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 99.55
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 99.55
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 99.55
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 99.54
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.54
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.54
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 99.54
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 99.54
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 99.54
2cph_A107 RNA binding motif protein 19; RNA recognition moti 99.53
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 99.53
2cph_A107 RNA binding motif protein 19; RNA recognition moti 99.53
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 99.53
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 99.53
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 99.53
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 99.53
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 99.53
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 99.53
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 99.53
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 99.53
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 99.53
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 99.53
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.52
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 99.52
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 99.52
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 99.52
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.52
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 99.52
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 99.52
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 99.52
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 99.52
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 99.52
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 99.52
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 99.52
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 99.52
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 99.52
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 99.52
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 99.52
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 99.52
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 99.52
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 99.51
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 99.51
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 99.51
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 99.51
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 99.51
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 99.51
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 99.51
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 99.51
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 99.51
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 99.51
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 99.51
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 99.51
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 99.51
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 99.51
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 99.51
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 99.51
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 99.51
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 99.51
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 99.51
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.51
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 99.5
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 99.5
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 99.5
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 99.5
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 99.5
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 99.5
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 99.5
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 99.5
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 99.5
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 99.5
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 99.5
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.5
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 99.5
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 99.5
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 99.5
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 99.5
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 99.5
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 99.49
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 99.49
3p5t_L90 Cleavage and polyadenylation specificity factor S; 99.49
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.49
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 99.49
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 99.49
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 99.49
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 99.49
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 99.49
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 99.49
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 99.49
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 99.49
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 99.49
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 99.49
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 99.49
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 99.49
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.49
2div_A99 TRNA selenocysteine associated protein; structural 99.49
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 99.48
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.48
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 99.48
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 99.48
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 99.48
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 99.48
2cpj_A99 Non-POU domain-containing octamer-binding protein; 99.48
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 99.48
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 99.48
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 99.48
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 99.48
3p5t_L90 Cleavage and polyadenylation specificity factor S; 99.48
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 99.48
2la6_A99 RNA-binding protein FUS; structural genomics, nort 99.48
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 99.48
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 99.48
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 99.48
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 99.47
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 99.47
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 99.47
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 99.47
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 99.47
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 99.47
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 99.47
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 99.47
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 99.47
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 99.47
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 99.47
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 99.47
2cpj_A99 Non-POU domain-containing octamer-binding protein; 99.47
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.47
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 99.47
1x4e_A85 RNA binding motif, single-stranded interacting pro 99.47
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 99.47
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 99.47
2cqd_A116 RNA-binding region containing protein 1; RNA recog 99.47
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 99.47
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.47
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 99.47
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 99.47
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 99.46
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 99.46
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 99.46
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 99.46
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 99.46
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.46
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 99.46
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 99.46
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 99.46
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 99.46
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 99.46
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.46
2dis_A109 Unnamed protein product; structural genomics, RRM 99.46
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 99.46
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 99.46
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 99.46
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 99.46
2cqd_A116 RNA-binding region containing protein 1; RNA recog 99.46
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 99.46
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 99.46
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 99.46
2la6_A99 RNA-binding protein FUS; structural genomics, nort 99.46
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 99.46
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 99.46
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 99.46
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 99.46
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 99.45
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 99.45
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 99.45
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 99.45
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 99.45
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 99.45
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 99.45
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 99.45
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 99.45
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 99.45
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 99.45
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 99.45
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 99.45
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 99.45
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 99.45
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 99.45
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 99.45
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 99.45
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 99.45
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 99.45
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 99.44
2i2y_A150 Fusion protein consists of immunoglobin G- binding 99.44
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 99.44
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 99.44
2div_A99 TRNA selenocysteine associated protein; structural 99.44
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 99.44
2krb_A81 Eukaryotic translation initiation factor 3 subunit 99.44
1x5p_A97 Negative elongation factor E; structure genomics, 99.44
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.44
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 99.44
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 99.44
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 99.44
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 99.44
2kt5_A124 RNA and export factor-binding protein 2; chaperone 99.43
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 99.43
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 99.43
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 99.43
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 99.43
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 99.43
1x5p_A97 Negative elongation factor E; structure genomics, 99.43
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 99.43
1x5o_A114 RNA binding motif, single-stranded interacting pro 99.43
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 99.43
2dis_A109 Unnamed protein product; structural genomics, RRM 99.43
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 99.43
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 99.42
3n9u_C156 Cleavage and polyadenylation specificity factor S; 99.42
1x5o_A114 RNA binding motif, single-stranded interacting pro 99.42
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 99.42
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 99.42
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 99.42
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 99.42
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 99.42
1x4e_A85 RNA binding motif, single-stranded interacting pro 99.42
3n9u_C156 Cleavage and polyadenylation specificity factor S; 99.41
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 99.41
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 99.41
2krb_A81 Eukaryotic translation initiation factor 3 subunit 99.41
2kt5_A124 RNA and export factor-binding protein 2; chaperone 99.41
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 99.41
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 99.41
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 99.41
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 99.41
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 99.41
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 99.41
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 99.41
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 99.41
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 99.4
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 99.4
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 99.4
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 99.4
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 99.4
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 99.4
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 99.4
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 99.4
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 99.39
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 99.39
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 99.39
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 99.39
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 99.39
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 99.39
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 99.39
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 99.38
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 99.38
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 99.38
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 99.38
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 99.37
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 99.37
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 99.37
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 99.37
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 99.37
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 99.36
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 99.36
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 99.36
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 99.36
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 99.36
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 99.35
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 99.35
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 99.35
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 99.34
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 99.34
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 99.33
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 99.33
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 99.33
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 99.33
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 99.33
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 99.33
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 99.32
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 99.32
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 99.0
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 99.0
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 99.32
3q2s_C229 Cleavage and polyadenylation specificity factor S; 99.32
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 99.31
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 99.31
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 99.31
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 99.31
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 99.3
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 99.3
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 99.3
3q2s_C229 Cleavage and polyadenylation specificity factor S; 99.3
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 99.3
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 99.3
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 99.29
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 99.29
2f3j_A177 RNA and export factor binding protein 2; RRM domai 99.29
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 99.29
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 99.28
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 99.28
2f3j_A177 RNA and export factor binding protein 2; RRM domai 99.28
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 99.27
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 99.24
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 99.24
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 99.24
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 99.23
2dnl_A114 Cytoplasmic polyadenylation element binding protei 99.22
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 99.22
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 99.21
2dit_A112 HIV TAT specific factor 1 variant; structural geno 99.21
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 99.21
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 99.21
2dnl_A114 Cytoplasmic polyadenylation element binding protei 99.2
2dit_A112 HIV TAT specific factor 1 variant; structural geno 99.2
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 99.19
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 99.18
2j8a_A136 Histone-lysine N-methyltransferase, H3 lysine-4 sp 99.15
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 99.09
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 99.09
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 99.08
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 99.08
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 99.06
2j8a_A136 Histone-lysine N-methyltransferase, H3 lysine-4 sp 99.06
3tht_A345 Alkylated DNA repair protein ALKB homolog 8; struc 99.02
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 98.99
3tht_A345 Alkylated DNA repair protein ALKB homolog 8; struc 98.98
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 98.93
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 98.93
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 98.9
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 98.9
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 98.84
2dnr_A91 Synaptojanin-1; RRM domain, RBD, structural genomi 98.71
1uw4_A91 UPF3X; nonsense mediated mRNA decay protein, RNA-b 98.61
1owx_A121 Lupus LA protein, SS-B, LA; RRM, transcription; NM 98.59
1ufw_A95 Synaptojanin 2; RNP domain, structural genomics, r 98.43
2l08_A97 Regulator of nonsense transcripts 3A; NESG, nonsen 98.42
1owx_A121 Lupus LA protein, SS-B, LA; RRM, transcription; NM 98.41
2dnr_A91 Synaptojanin-1; RRM domain, RBD, structural genomi 98.31
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 98.29
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 98.1
2l9w_A117 U4/U6 snRNA-associated-splicing factor PRP24; RRM, 98.1
1ufw_A95 Synaptojanin 2; RNP domain, structural genomics, r 97.98
2l9w_A117 U4/U6 snRNA-associated-splicing factor PRP24; RRM, 97.73
2dhx_A104 Poly (ADP-ribose) polymerase family, member 10 var 97.54
2dhx_A104 Poly (ADP-ribose) polymerase family, member 10 var 97.49
1wey_A104 Calcipressin 1; structural genomics, RRM domain, r 96.81
1wey_A104 Calcipressin 1; structural genomics, RRM domain, r 96.46
1wwh_A119 Nucleoporin 35, nucleoporin; structural genomics, 96.13
1uw4_A91 UPF3X; nonsense mediated mRNA decay protein, RNA-b 96.03
1whv_A100 Poly(A)-specific ribonuclease; RNA recognition mot 94.72
1whv_A100 Poly(A)-specific ribonuclease; RNA recognition mot 94.31
1wwh_A119 Nucleoporin 35, nucleoporin; structural genomics, 94.11
3ctr_A101 Poly(A)-specific ribonuclease PARN; protein-RNA-co 93.76
3ctr_A101 Poly(A)-specific ribonuclease PARN; protein-RNA-co 93.63
2l08_A97 Regulator of nonsense transcripts 3A; NESG, nonsen 93.12
3pq1_A464 Poly(A) RNA polymerase; nucleotidyl transferase, R 92.67
3p3d_A132 Nucleoporin 53; structural genomics, PSI-2, protei 92.14
3pq1_A464 Poly(A) RNA polymerase; nucleotidyl transferase, R 91.41
3p3d_A132 Nucleoporin 53; structural genomics, PSI-2, protei 86.92
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
Probab=99.98  E-value=1.3e-31  Score=285.74  Aligned_cols=237  Identities=16%  Similarity=0.231  Sum_probs=198.8

Q ss_pred             ccccccccCCCCCChHHHHHhhcCCCcEEEeccCccCcccceeEeeecCccccc----cccccccCCCCccccCCCCCCC
Q 003400          114 MDDFDLRGLPSSLEDLEDYDIFGSGGGMELEGEPQESLSMSMSKISISDSASGN----GLLHYSVPNGAGTVAGEHPYGE  189 (823)
Q Consensus       114 ~~el~V~~Lp~~~~E~el~dlFs~~G~v~V~~d~~es~~~g~~~v~~~e~~~a~----~~~~~~l~n~~~~~~~~~~~~e  189 (823)
                      .++++|++||.++++.++.++|+.+|-+.+.+    ...+|++++.|.+...+.    .+++..+.+....+..     .
T Consensus        22 ~~~l~V~nLp~~~te~~l~~~F~~~Gi~~~~~----~~~~g~afV~f~~~~~A~~A~~~l~~~~~~g~~i~v~~-----~   92 (284)
T 3smz_A           22 RRKILIRGLPGDVTNQEVHDLLSDYELKYCFV----DKYKGTAFVTLLNGEQAEAAINAFHQSRLRERELSVQL-----Q   92 (284)
T ss_dssp             CCEEEEECCCTTCCHHHHHHHTTTSCEEEEEE----ETTTTEEEEEESSHHHHHHHHHHHTTCEETTEECEEEE-----C
T ss_pred             CCEEEEeCCCCCCCHHHHHHHHHHcCCEEEEE----ecCCCEEEEEeCCHHHHHHHHHHcCCCeeCCeEEEEEe-----c
Confidence            47899999999999999999999999334433    456789999999887664    2344444443333322     2


Q ss_pred             CCCcEEEEcCCCCCCCHHHHHHHhhcCCCEEEEEe-----CCCcccEEEEEeCCHHHHHHHHHHhcCCcccccccccccc
Q 003400          190 HPSRTLFVRNINSNVEDSELRALFEQYGDIRTLYT-----ACKHRGFVMISYYDIRAARTAMRALQNKPLRRRKLDIHFS  264 (823)
Q Consensus       190 ~~srtLfV~NLP~~vteeeLr~lFs~fG~I~~v~~-----~~ksrG~AFV~F~~~e~A~~Ai~~Lng~~l~gr~L~V~~a  264 (823)
                      .+.++|||+|||.++++++|+++|++||.|..|++     +++++|||||+|.+.++|.+|++.|+|..+.|++|.|.++
T Consensus        93 ~~~~~l~v~nlp~~~t~~~l~~~f~~~G~i~~~~i~~~~~~g~~~g~afV~f~~~~~a~~A~~~l~~~~~~g~~i~v~~a  172 (284)
T 3smz_A           93 PTDALLCVANLPPSLTQQQFEELVRPFGSLERCFLVYSERTGQSKGYGFAEYMKKDSAARAKSDLLGKPLGPRTLYVHWT  172 (284)
T ss_dssp             CCSCEEEEESCCTTCCHHHHHHHHGGGSCEEEEEEEECTTTCCEEEEEEEEESSHHHHHHHHHHHTTCEETTEECEEEEC
T ss_pred             CCCCEEEEcCCCCcCCHHHHHHHHHhcCCeeEEEEEeeCCCCccceEEEEEECCHHHHHHHHHHhCCCEeCCcEEEEEEC
Confidence            35689999999999999999999999999999873     5668999999999999999999999999999999999999


Q ss_pred             CCCCCCCCCCCCccceeeecCCCCC-CHHHHHHHhcccCceEEEEe----CCCcccEEEEEEcCHHHHHHHHHHhCCCcc
Q 003400          265 IPKDNPSDKDLNQGTLVVFNLDPSV-SNEDLRQIFGAYGEVKEIRE----TPHKRHHKFIEFYDVRAAEAALKSLNRSDI  339 (823)
Q Consensus       265 ~pk~~~~~~~~~~~tLfV~NLp~~v-teedL~~~Fs~fG~I~~iri----~~~srG~aFVeF~d~e~A~kAl~~LnG~~i  339 (823)
                      .++.... ......+|||+|||.++ ++++|+++|++||.|..+++    ++.++|+|||+|.+.++|.+|++.|||..+
T Consensus       173 ~~~~~~~-~~~~~~~l~v~nlp~~~~~~~~l~~~f~~~G~i~~v~i~~~~~g~~~g~afV~f~~~~~A~~A~~~l~g~~~  251 (284)
T 3smz_A          173 DAGQLTP-ALLHSRCLCVDRLPPGFNDVDALCRALSAVHSPTFCQLACGQDGQLKGFAVLEYETAEMAEEAQQQADGLSL  251 (284)
T ss_dssp             CGGGCCT-TTTSCSEEEEECCCTTCCCHHHHHHHTCSSSCCSEEEEEECSSCCEEEEEEEECSSHHHHHHHHHHHTTCEE
T ss_pred             CCCCCCc-ccCCccEEEEecCCcccCCHHHHHHHhhCCCCeEEEEEEECCCCCcccEEEEEeCCHHHHHHHHHHhCCCcc
Confidence            8765432 33456799999999995 99999999999999999875    355789999999999999999999999999


Q ss_pred             CCceEEEEecCCCcccchhhh
Q 003400          340 AGKRIKLEPSRPGGARRNLML  360 (823)
Q Consensus       340 ~Gr~I~V~~s~~~~~r~~~~~  360 (823)
                      .|++|+|.|++++..++..+.
T Consensus       252 ~g~~l~v~~a~~~~~~~~~~~  272 (284)
T 3smz_A          252 GGSHLRVSFCAPGPPGRSMLA  272 (284)
T ss_dssp             TTEECEEEECCSSSCHHHHHH
T ss_pred             CCeEEEEEEecCCCcccchhh
Confidence            999999999999887665433



>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1uw4_A UPF3X; nonsense mediated mRNA decay protein, RNA-binding protein, N domain, MIF4G domain; 1.95A {Homo sapiens} SCOP: d.58.7.4 Back     alignment and structure
>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2l08_A Regulator of nonsense transcripts 3A; NESG, nonsense regulator, structural genomics, PSI-2, protei structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>2l9w_A U4/U6 snRNA-associated-splicing factor PRP24; RRM, U6 snRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2l9w_A U4/U6 snRNA-associated-splicing factor PRP24; RRM, U6 snRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wey_A Calcipressin 1; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1wey_A Calcipressin 1; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1wwh_A Nucleoporin 35, nucleoporin; structural genomics, MPPN, riken structural genomics/proteomics initiative, RSGI, protein transport; 2.70A {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1uw4_A UPF3X; nonsense mediated mRNA decay protein, RNA-binding protein, N domain, MIF4G domain; 1.95A {Homo sapiens} SCOP: d.58.7.4 Back     alignment and structure
>1whv_A Poly(A)-specific ribonuclease; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, PARN, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2rok_A* Back     alignment and structure
>1whv_A Poly(A)-specific ribonuclease; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, PARN, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2rok_A* Back     alignment and structure
>1wwh_A Nucleoporin 35, nucleoporin; structural genomics, MPPN, riken structural genomics/proteomics initiative, RSGI, protein transport; 2.70A {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3ctr_A Poly(A)-specific ribonuclease PARN; protein-RNA-complex, M7G-CAP, M7GTP, RNA recognition motif, RRM, cytoplasm, exonuclease, hydrolase, magnesium; HET: MGP; 2.10A {Homo sapiens} Back     alignment and structure
>3ctr_A Poly(A)-specific ribonuclease PARN; protein-RNA-complex, M7G-CAP, M7GTP, RNA recognition motif, RRM, cytoplasm, exonuclease, hydrolase, magnesium; HET: MGP; 2.10A {Homo sapiens} Back     alignment and structure
>2l08_A Regulator of nonsense transcripts 3A; NESG, nonsense regulator, structural genomics, PSI-2, protei structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3pq1_A Poly(A) RNA polymerase; nucleotidyl transferase, RNP-type RNA binding domain, poly(A polymerase, mitochondria, transferase; 3.10A {Homo sapiens} Back     alignment and structure
>3p3d_A Nucleoporin 53; structural genomics, PSI-2, protein structure initiative, NE structural genomix research consortium, nysgxrc; 2.35A {Pichia guilliermondii} Back     alignment and structure
>3pq1_A Poly(A) RNA polymerase; nucleotidyl transferase, RNP-type RNA binding domain, poly(A polymerase, mitochondria, transferase; 3.10A {Homo sapiens} Back     alignment and structure
>3p3d_A Nucleoporin 53; structural genomics, PSI-2, protein structure initiative, NE structural genomix research consortium, nysgxrc; 2.35A {Pichia guilliermondii} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 823
d1u1qa_183 d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 9e-20
d2f9da1114 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p 8e-17
d2f9da1114 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p 1e-15
d1cvja180 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human 2e-15
d1cvja180 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human 5e-12
d1h2vz_93 d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding pro 2e-15
d1h2vz_93 d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding pro 4e-13
d1b7fa182 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophil 4e-15
d1b7fa182 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophil 4e-11
d1no8a_78 d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus muscu 7e-15
d1no8a_78 d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus muscu 7e-10
d1fjca_96 d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocrice 9e-15
d1fjca_96 d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocrice 2e-13
d1x5ua193 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Hu 2e-14
d1x5ua193 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Hu 2e-11
d1cvja289 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human 2e-14
d1cvja289 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human 1e-10
d2cq4a1101 d.58.7.1 (A:132-232) RNA binding protein 23 {Human 3e-14
d2cq4a1101 d.58.7.1 (A:132-232) RNA binding protein 23 {Human 7e-10
d2cq0a190 d.58.7.1 (A:231-320) Eukaryotic translation initia 3e-14
d2cq0a190 d.58.7.1 (A:231-320) Eukaryotic translation initia 2e-11
d2cqia190 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sa 6e-14
d2cqia190 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sa 1e-11
d1x4ga196 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo s 6e-14
d1x4ga196 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo s 2e-11
d2cqba189 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomer 9e-14
d2cqba189 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomer 2e-12
d2cpfa185 d.58.7.1 (A:362-446) Probable RNA-binding protein 9e-14
d2cpfa185 d.58.7.1 (A:362-446) Probable RNA-binding protein 2e-13
d1wf2a_98 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 2e-13
d1wf2a_98 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 2e-11
d2disa196 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 { 2e-13
d2disa196 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 { 4e-10
d2u2fa_85 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 3e-13
d2u2fa_85 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 3e-10
d1fxla182 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Hom 4e-13
d1fxla182 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Hom 1e-09
d2cpha194 d.58.7.1 (A:454-547) Probable RNA-binding protein 4e-13
d2cpha194 d.58.7.1 (A:454-547) Probable RNA-binding protein 6e-12
d2cqca183 d.58.7.1 (A:109-191) Arginine/serine-rich splicing 1e-12
d2cqca183 d.58.7.1 (A:109-191) Arginine/serine-rich splicing 2e-10
d1nu4a_91 d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo 1e-12
d1nu4a_91 d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo 4e-11
d2cpda186 d.58.7.1 (A:223-308) APOBEC1 stimulating protein { 1e-12
d2cpda186 d.58.7.1 (A:223-308) APOBEC1 stimulating protein { 1e-11
d1b7fa285 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophil 1e-12
d1b7fa285 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophil 1e-10
d2cpja186 d.58.7.1 (A:65-150) Non-POU domain-containing octa 2e-12
d2cpja186 d.58.7.1 (A:65-150) Non-POU domain-containing octa 9e-12
d2cq3a193 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human 2e-12
d2cq3a193 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human 8e-11
d1wf0a_88 d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 { 3e-12
d1wf0a_88 d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 { 3e-11
d1x4ba1103 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucle 4e-12
d1x4ba1103 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucle 2e-10
d2ghpa181 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splici 5e-12
d2ghpa181 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splici 3e-10
d1x5ta183 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Hu 6e-12
d1x5ta183 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Hu 8e-12
d2cpea1101 d.58.7.1 (A:353-453) RNA-binding protein EWS {Huma 8e-12
d2cpea1101 d.58.7.1 (A:353-453) RNA-binding protein EWS {Huma 4e-09
d1rk8a_88 d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Dr 8e-12
d1rk8a_88 d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Dr 1e-10
d2adba1108 d.58.7.1 (A:177-284) Polypyrimidine tract-binding 9e-12
d2adba1108 d.58.7.1 (A:177-284) Polypyrimidine tract-binding 5e-11
d1x4aa195 d.58.7.1 (A:9-103) Splicing factor, arginine/serin 9e-12
d1x4aa195 d.58.7.1 (A:9-103) Splicing factor, arginine/serin 2e-10
d1uawa_77 d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [Tax 2e-11
d1uawa_77 d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [Tax 3e-08
d1whwa_99 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 3e-11
d1whwa_99 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 3e-09
d2cqga190 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TD 3e-11
d2cqga190 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TD 1e-09
d1fxla285 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Ho 5e-11
d1fxla285 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Ho 7e-10
d2msta_75 d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 7e-11
d2msta_75 d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 5e-06
d2cqha180 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 is 1e-10
d2cqha180 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 is 2e-09
d2cpza1102 d.58.7.1 (A:383-484) CUG triplet repeat RNA-bindin 2e-10
d2cpza1102 d.58.7.1 (A:383-484) CUG triplet repeat RNA-bindin 7e-09
d1p1ta_104 d.58.7.1 (A:) Cleavage stimulation factor, 64 kda 3e-10
d1p1ta_104 d.58.7.1 (A:) Cleavage stimulation factor, 64 kda 2e-09
d1u6fa1139 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypa 4e-10
d1u6fa1139 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypa 2e-07
d2adca1109 d.58.7.1 (A:335-443) Polypyrimidine tract-binding 5e-10
d2adca1109 d.58.7.1 (A:335-443) Polypyrimidine tract-binding 3e-07
d1whya_97 d.58.7.1 (A:) Putative RNA-binding protein 15B, Rb 7e-10
d1whya_97 d.58.7.1 (A:) Putative RNA-binding protein 15B, Rb 5e-07
d1hd0a_75 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 9e-10
d1hd0a_75 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 2e-05
d1x5sa190 d.58.7.1 (A:8-97) Cold-inducible RNA-binding prote 1e-09
d1x5sa190 d.58.7.1 (A:8-97) Cold-inducible RNA-binding prote 8e-08
d1x4ea172 d.58.7.1 (A:8-79) RNA-binding motif, single-strand 1e-09
d1x4ea172 d.58.7.1 (A:8-79) RNA-binding motif, single-strand 4e-06
d1x0fa175 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 2e-09
d1x0fa175 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 1e-06
d2cqda1103 d.58.7.1 (A:1-103) RNA-binding region containing p 3e-09
d2cqda1103 d.58.7.1 (A:1-103) RNA-binding region containing p 9e-07
d1x4ha198 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse ( 3e-09
d1x4ha198 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse ( 2e-08
d1weya_104 d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) 3e-09
d1weya_104 d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) 1e-07
d2cpxa1102 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 5e-09
d2cpxa1102 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 1e-08
d1l3ka184 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RN 7e-09
d1l3ka184 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RN 6e-07
d1wexa_104 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 8e-09
d1wexa_104 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 4e-06
d1wg1a_88 d.58.7.1 (A:) Probable RNA-binding protein KIAA157 1e-08
d1wg1a_88 d.58.7.1 (A:) Probable RNA-binding protein KIAA157 1e-06
d2adca288 d.58.7.1 (A:444-531) Polypyrimidine tract-binding 2e-08
d2adca288 d.58.7.1 (A:444-531) Polypyrimidine tract-binding 2e-07
d2ghpa386 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splici 2e-08
d2ghpa386 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splici 1e-07
d2bz2a179 d.58.7.1 (A:35-113) Negative elongation factor E, 4e-08
d2bz2a179 d.58.7.1 (A:35-113) Negative elongation factor E, 8e-08
d1x5oa1101 d.58.7.1 (A:8-108) RNA-binding motif, single-stran 6e-08
d1x5oa1101 d.58.7.1 (A:8-108) RNA-binding motif, single-stran 8e-07
d1x4da189 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [ 7e-08
d1x4da189 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [ 2e-05
d1wi8a_104 d.58.7.1 (A:) Eukaryotic translation initiation fa 9e-08
d1wi8a_104 d.58.7.1 (A:) Eukaryotic translation initiation fa 2e-07
d2b0ga183 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosoph 9e-08
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 d.58.7.3 (A:) 1e-07
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 d.58.7.3 (A:) 8e-05
d2dita199 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Huma 1e-07
d2dita199 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Huma 8e-06
d1l3ka279 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 2e-07
d1l3ka279 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 2e-06
d2cq1a188 d.58.7.1 (A:51-138) Polypyrimidine tract-binding p 2e-07
d2cq2a1101 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 3e-07
d2cq2a1101 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 4e-07
d1u2fa_90 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 8e-07
d1u2fa_90 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 8e-06
d1owxa_113 d.58.7.1 (A:) Lupus LA protein {Human (Homo sapien 1e-06
d1owxa_113 d.58.7.1 (A:) Lupus LA protein {Human (Homo sapien 3e-06
d1zh5a285 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo 2e-06
d1zh5a285 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo 5e-06
d1wg4a_98 d.58.7.1 (A:) Splicing factor, arginine/serine-ric 4e-06
d1wg4a_98 d.58.7.1 (A:) Splicing factor, arginine/serine-ric 3e-05
d2cqpa186 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mous 1e-05
d2cqpa186 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mous 3e-04
d2cqpa186 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mous 0.001
d1fjeb191 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesoc 1e-05
d2cpia189 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase C 2e-05
d2cpia189 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase C 0.001
d3begb187 d.58.7.1 (B:121-207) Splicing factor, arginine/ser 3e-05
d1o0pa_104 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 5e-05
d1o0pa_104 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 1e-04
d1wi6a175 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 3e-04
d1wi6a175 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 7e-04
d1whxa_111 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 4e-04
d1wela1112 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human 6e-04
d1x4fa199 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) 0.001
d1uw4a_91 d.58.7.4 (A:) RNA processing protein UPF3x, RRM do 0.003
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Nuclear ribonucleoprotein A1 (RNP A1, UP1)
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 85.4 bits (210), Expect = 9e-20
 Identities = 34/171 (19%), Positives = 59/171 (34%), Gaps = 12/171 (7%)

Query: 192 SRTLFVRNINSNVEDSELRALFEQYGDIRTLYTAC-----KHRGFVMISYYDIRAARTAM 246
            R LF+  ++    D  LR+ FEQ+G +            + RGF  ++Y  +     AM
Sbjct: 6   LRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAM 65

Query: 247 RALQNKPLRRRKLDIHFSI-PKDNPSDKDLNQGTLVVFNLDPSVSNEDLRQIFGAYGEVK 305
            A  +K   R                   L    + V  +        LR  F  YG+++
Sbjct: 66  NARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIE 125

Query: 306 EI-----RETPHKRHHKFIEFYDVRAAEAALKSLNRSDIAGKRIKLEPSRP 351
            I     R +  KR   F+ F D  + +  +       + G   ++  +  
Sbjct: 126 VIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVI-QKYHTVNGHNCEVRKALS 175


>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 82 Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 82 Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 96 Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 96 Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Length = 86 Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Length = 86 Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 85 Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 85 Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 81 Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 81 Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 88 Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 88 Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Length = 139 Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Length = 139 Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Length = 97 Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Length = 97 Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Length = 83 Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Length = 113 Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Length = 113 Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 91 Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 87 Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 111 Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Length = 112 Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1uw4a_ d.58.7.4 (A:) RNA processing protein UPF3x, RRM domain {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query823
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.93
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.73
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 99.64
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 99.63
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 99.62
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.62
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.62
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 99.61
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.61
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 99.61
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 99.6
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 99.6
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.6
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 99.6
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 99.6
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.59
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.59
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 99.59
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.59
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.59
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 99.59
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 99.58
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.58
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 99.58
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.58
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 99.58
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 99.58
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.58
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.58
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 99.57
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 99.57
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.57
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 99.57
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 99.57
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 99.57
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.56
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.56
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 99.56
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.56
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 99.56
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 99.56
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 99.55
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 99.55
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.55
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.55
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.55
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.55
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 99.55
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 99.55
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 99.55
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.55
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.55
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 99.55
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.55
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.55
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 99.54
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.54
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 99.54
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.54
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.54
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 99.54
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 99.54
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 99.54
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 99.54
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.53
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.53
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.53
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 99.53
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 99.53
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 99.53
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 99.53
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.53
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 99.53
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.53
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 99.53
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 99.53
d2cpja186 Non-POU domain-containing octamer-binding protein, 99.52
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 99.52
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.52
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 99.52
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.52
d2cpja186 Non-POU domain-containing octamer-binding protein, 99.51
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 99.51
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 99.51
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 99.51
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 99.51
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 99.51
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.51
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 99.51
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 99.51
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.5
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.5
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 99.5
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 99.5
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.49
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 99.49
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.49
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 99.49
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 99.49
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 99.49
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 99.49
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 99.49
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 99.49
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 99.49
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 99.49
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 99.48
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 99.48
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 99.48
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 99.48
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.48
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.47
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 99.47
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 99.47
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.47
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 99.47
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 99.47
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.47
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 99.47
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.46
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.46
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 99.46
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 99.46
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 99.45
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.45
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 99.45
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 99.45
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 99.44
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.44
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 99.43
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 99.43
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 99.43
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 99.43
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 99.43
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.43
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.43
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 99.42
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 99.42
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 99.42
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 99.41
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 99.4
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.39
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 99.38
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.38
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.38
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.37
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 99.37
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 99.36
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 99.36
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 99.36
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 99.36
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.35
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 99.35
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 99.34
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 99.32
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.27
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.25
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.25
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 99.2
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.19
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 99.18
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.18
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.16
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 99.16
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 99.14
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.11
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 99.1
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.08
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 99.08
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 99.07
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 98.93
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 98.88
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 98.87
d1uw4a_91 RNA processing protein UPF3x, RRM domain {Human (H 98.73
d2dgxa173 Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 960 96.84
d1ufwa_95 Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606] 96.37
d1uw4a_91 RNA processing protein UPF3x, RRM domain {Human (H 95.99
d2dgxa173 Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 960 95.73
d1ufwa_95 Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606] 94.12
d1whva_100 Poly(A)-specific ribonuclease PARN {Mouse (Mus mus 84.1
d1whva_100 Poly(A)-specific ribonuclease PARN {Mouse (Mus mus 84.03
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Nuclear ribonucleoprotein A1 (RNP A1, UP1)
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.93  E-value=2.2e-25  Score=220.23  Aligned_cols=162  Identities=20%  Similarity=0.383  Sum_probs=138.0

Q ss_pred             CcEEEEcCCCCCCCHHHHHHHhhcCCCEEEEEe-----CCCcccEEEEEeCCHHHHHHHHHHhcCCccccccccccccCC
Q 003400          192 SRTLFVRNINSNVEDSELRALFEQYGDIRTLYT-----ACKHRGFVMISYYDIRAARTAMRALQNKPLRRRKLDIHFSIP  266 (823)
Q Consensus       192 srtLfV~NLP~~vteeeLr~lFs~fG~I~~v~~-----~~ksrG~AFV~F~~~e~A~~Ai~~Lng~~l~gr~L~V~~a~p  266 (823)
                      .|+|||+|||+++|+++|+++|++||+|.++.+     ++.++|||||+|.+.++|++|+.. .+..+..+.+.+....+
T Consensus         6 ~r~lfV~nLp~~~te~~L~~~F~~~G~v~~~~~~~~~~~~~~~g~afv~f~~~~~a~~a~~~-~~~~~~~~~~~~~~~~~   84 (183)
T d1u1qa_           6 LRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNA-RPHKVDGRVVEPKRAVS   84 (183)
T ss_dssp             HHEEEEESCCTTCCHHHHHHHHGGGSCEEEEEEEECTTTCCEEEEEEEEESSHHHHHHHHHT-CSCEETTEECEEEECCC
T ss_pred             CCEEEEECCCCCCCHHHHHHHHHHcCCEEEEEeeecccCCCccCceecccCCHHHHHHHHHh-cCCcccccchhhhhhhh
Confidence            389999999999999999999999999999873     567899999999999999999984 56667777777766544


Q ss_pred             CCCC--CCCCCCccceeeecCCCCCCHHHHHHHhcccCceEEEEe-----CCCcccEEEEEEcCHHHHHHHHHHhCCCcc
Q 003400          267 KDNP--SDKDLNQGTLVVFNLDPSVSNEDLRQIFGAYGEVKEIRE-----TPHKRHHKFIEFYDVRAAEAALKSLNRSDI  339 (823)
Q Consensus       267 k~~~--~~~~~~~~tLfV~NLp~~vteedL~~~Fs~fG~I~~iri-----~~~srG~aFVeF~d~e~A~kAl~~LnG~~i  339 (823)
                      ....  .......++|||+|||..+|+++|+++|+.||.|..+.+     ++.++|||||+|.+.++|.+|++ +++..+
T Consensus        85 ~~~~~~~~~~~~~~~i~V~~lp~~~te~~L~~~f~~~G~v~~~~i~~~~~~~~~~g~~fV~f~~~e~A~~Al~-~~~~~~  163 (183)
T d1u1qa_          85 REDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVI-QKYHTV  163 (183)
T ss_dssp             TTGGGSTTTTCCCSEEEEECCCTTCCHHHHHHHHGGGSCEEEEEEEECTTTCCEEEEEEEEESCHHHHHHHHT-SSCEEE
T ss_pred             cccccccccccccceeEEccCCCcCCHHHHhhhhccCCceeeeeeecccccCccceeEEEEECCHHHHHHHHH-hCCCeE
Confidence            3321  122345579999999999999999999999999999865     35678999999999999999997 789999


Q ss_pred             CCceEEEEecCCCccc
Q 003400          340 AGKRIKLEPSRPGGAR  355 (823)
Q Consensus       340 ~Gr~I~V~~s~~~~~r  355 (823)
                      .|++|+|.+|.++.++
T Consensus       164 ~G~~i~V~~A~~k~e~  179 (183)
T d1u1qa_         164 NGHNCEVRKALSKQEM  179 (183)
T ss_dssp             TTEEEEEEECCCHHHH
T ss_pred             CCEEEEEEecCCcccc
Confidence            9999999999876543



>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uw4a_ d.58.7.4 (A:) RNA processing protein UPF3x, RRM domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dgxa1 d.58.7.1 (A:563-635) Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufwa_ d.58.7.1 (A:) Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uw4a_ d.58.7.4 (A:) RNA processing protein UPF3x, RRM domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dgxa1 d.58.7.1 (A:563-635) Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufwa_ d.58.7.1 (A:) Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whva_ d.58.7.1 (A:) Poly(A)-specific ribonuclease PARN {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1whva_ d.58.7.1 (A:) Poly(A)-specific ribonuclease PARN {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure