Citrus Sinensis ID: 003406
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 823 | 2.2.26 [Sep-21-2011] | |||||||
| Q5PNS0 | 482 | PHD finger protein At3g20 | no | no | 0.173 | 0.296 | 0.520 | 7e-41 | |
| Q3LHL9 | 1658 | Protein winged eye OS=Dro | no | no | 0.120 | 0.059 | 0.323 | 0.0005 | |
| Q9UIF8 | 2168 | Bromodomain adjacent to z | yes | no | 0.069 | 0.026 | 0.4 | 0.0006 |
| >sp|Q5PNS0|Y3228_ARATH PHD finger protein At3g20280 OS=Arabidopsis thaliana GN=At3g20280 PE=2 SV=1 | Back alignment and function desciption |
|---|
Score = 169 bits (429), Expect = 7e-41, Method: Compositional matrix adjust.
Identities = 76/146 (52%), Positives = 98/146 (67%), Gaps = 3/146 (2%)
Query: 362 QAPQFGSNHGEIAKIVQKLLHPKLPQHPTWTPPSREYMSKAFTCQICKLTANEVETVVLC 421
Q FG NH EIAKI+ K L P++ Q+P W PPSREYMS+A CQIC++T NE++T+++C
Sbjct: 5 QTSSFGGNHTEIAKIIHKFLQPRVKQYPLWNPPSREYMSRAMACQICEVTINEMDTLLIC 64
Query: 422 DACEKGFHLKCLQMNNQKGIPRGGEWHCMSCLKLSNGKPLPPKYG--RVMRSINTTKMPS 479
DACEK +HLKCLQ NN KG+P+ EWHC C++ NGKP PP YG + T KMP
Sbjct: 65 DACEKAYHLKCLQGNNMKGVPK-SEWHCSRCVQAFNGKPFPPTYGRATRAVATTTAKMPF 123
Query: 480 NTSVIQSPSDKKFISVDQKVNNQQKI 505
+ + S S KK +D K N Q+ I
Sbjct: 124 RAAGVLSSSAKKIGPMDIKANQQKPI 149
|
Arabidopsis thaliana (taxid: 3702) |
| >sp|Q3LHL9|WGE_DROME Protein winged eye OS=Drosophila melanogaster GN=wge PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q9UIF8|BAZ2B_HUMAN Bromodomain adjacent to zinc finger domain protein 2B OS=Homo sapiens GN=BAZ2B PE=1 SV=3 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 823 | ||||||
| 224056409 | 798 | predicted protein [Populus trichocarpa] | 0.940 | 0.969 | 0.533 | 0.0 | |
| 255580768 | 892 | conserved hypothetical protein [Ricinus | 0.948 | 0.875 | 0.515 | 0.0 | |
| 356501576 | 830 | PREDICTED: uncharacterized protein LOC10 | 0.916 | 0.908 | 0.513 | 0.0 | |
| 356553535 | 830 | PREDICTED: uncharacterized protein LOC10 | 0.919 | 0.912 | 0.503 | 0.0 | |
| 357494725 | 874 | PHD finger protein [Medicago truncatula] | 0.964 | 0.908 | 0.441 | 0.0 | |
| 449463270 | 874 | PREDICTED: uncharacterized protein LOC10 | 0.946 | 0.891 | 0.442 | 1e-169 | |
| 449503219 | 728 | PREDICTED: uncharacterized LOC101224472 | 0.818 | 0.925 | 0.445 | 1e-141 | |
| 297847406 | 611 | PHD finger family protein [Arabidopsis l | 0.473 | 0.638 | 0.424 | 4e-87 | |
| 225898018 | 629 | hypothetical protein [Arabidopsis thalia | 0.484 | 0.634 | 0.418 | 2e-86 | |
| 15223606 | 629 | RING/FYVE/PHD zinc finger-containing pro | 0.484 | 0.634 | 0.416 | 4e-86 |
| >gi|224056409|ref|XP_002298842.1| predicted protein [Populus trichocarpa] gi|222846100|gb|EEE83647.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 781 bits (2017), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 441/827 (53%), Positives = 548/827 (66%), Gaps = 53/827 (6%)
Query: 1 MDPAPITSPNANAPFNPQPDVSITTKTNEKRAAENGEDPEMKSKKRARIGAAGKEGKRVA 60
MDP+ + N + P Q D T +EKR EN E E+ +K RA+ G E ++VA
Sbjct: 1 MDPSAVDDCNKSLP---QSDGE-TDLVSEKRQMENVESEELAAK-RAKNGVG--EIRKVA 53
Query: 61 EIVLVLSAMWRMRGGGGKGPTEVERRLMAEAREKLVDMCEGLAPKDIVARDAIVGLIEDL 120
EIVLVLSAM MRGG K PT+ E RLM EAREKLV++C+ L+PKD+VARD+I +IEDL
Sbjct: 54 EIVLVLSAMAGMRGG--KNPTDAEVRLMEEAREKLVEICQDLSPKDLVARDSIGTVIEDL 111
Query: 121 GLNGRVKEQKLGFRGQRLSIKEKVELSKRKMEEPKKFSTQPTAYTSNSLQTSFGTAPENR 180
GLN ++K+Q+LGFRG RLSIKEK+ LSKRKMEE KKF+ YT+ Q SFG PE+
Sbjct: 112 GLNFKLKDQRLGFRGSRLSIKEKLSLSKRKMEESKKFAAPSATYTTQITQPSFGAMPESH 171
Query: 181 GTSHTVRMFPLDKVGSSPTLSSGGFSTSSPPVHVHATTSASLPYQLLNNDARPPTVSTGL 240
G SH R+ P DK S+ ++SSG F +S P HV A T AS Q L +A+ VS+GL
Sbjct: 172 GPSHAFRVLPSDK-PSNISVSSGIF-PASLPGHVSAATPASSTLQPLTTEAKISAVSSGL 229
Query: 241 PSSHLGRDSSSLALPRVEKPQVKLDGGSNGSSYVSQVQANASANHPLVNAPTWSVQPQSA 300
PSS LGRD SS+A +VEK Q K++GGSNG+SY QV ANASANH LVNAP+WS+QP SA
Sbjct: 230 PSSQLGRDLSSVAFSKVEKTQFKVEGGSNGASYAPQVPANASANHSLVNAPSWSMQPHSA 289
Query: 301 SSAKAVLENKVPNHIPVKLEGPADMSRT-APQAVRDQSFRPFISQT--GNMPNVHQPLQG 357
SS K+ EN +PNH K+EG AD+ RT A QA RDQ+FRPF QT N+P++H P+QG
Sbjct: 290 SSGKSAPENNMPNHNSAKVEGVADLGRTRATQAARDQTFRPFTPQTPPANLPSIHPPMQG 349
Query: 358 TNIVQAPQFGSNHGEIAKIVQKLLHPKLPQHPTWTPPSREYMSKAFTCQICKLTANEVET 417
VQ P F +NH EIAKIVQKLL PKLP++PTW PPSREYM+ A TCQICKLT NEVET
Sbjct: 350 VEYVQPPSFINNHNEIAKIVQKLLQPKLPEYPTWIPPSREYMTTAMTCQICKLTVNEVET 409
Query: 418 VVLCDACEKGFHLKCLQMNNQKGIPRGGEWHCMSCLKLSNGKPLPPKYGRVMRSINTTKM 477
VVLCDACE GFH+KC + NQKGIPRG EWHC +C+ LSNGKPLPPKYGRVMRS K
Sbjct: 410 VVLCDACESGFHIKCREAINQKGIPRG-EWHCRNCMALSNGKPLPPKYGRVMRSATPPKG 468
Query: 478 PSNTSVIQSPSDKKFISVDQKVNNQQKITVNGSSGGSGALGSNSNDCDLKIHNIRATQGG 537
PSN + S +KK +VD KV+ Q+ ++ GSG++ + + D +I R
Sbjct: 469 PSNPAGSHSSLEKKAENVDLKVDQQKSTNGVQNNAGSGSVNNVESASDSRISGEREMPRD 528
Query: 538 NLVSSTKSKDQETSSGTYPSNVTKPLGVVPPPGDSHGPIQSTQVCESSTQLEKLASESKS 597
+ SS K DQ T S +P+N T+ Q QV ES Q + SES
Sbjct: 529 GITSSGKDADQSTCS--FPNNSTE------------RSTQQDQVSESPAQEKSSLSESSE 574
Query: 598 EHPAISSETVSNHSAASQPSHNSQ-VVRTDLANSAEVSLKNSHDSSSTIKQDEEVVGRLN 656
+ S+P H SQ +++T+ +N + L H S +++ V G
Sbjct: 575 KISKCED---------SKPLHISQDIIQTEQSNFPKAPL-TPHQDHSIMEESASVRGSSV 624
Query: 657 PVGNSV-----ISSDALHNVQWIGDVLQIVDGKKFYQSCRIGGVTYKVKDHVLLHSSNNK 711
P N V +SS +H+V+WIG+ +++ DGK FY+SC I GV+YKV+DH L HSS+ K
Sbjct: 625 P-NNRVGKHPGLSSSGIHSVEWIGNEIKVADGKTFYKSCCIDGVSYKVQDHALFHSSDGK 683
Query: 712 LMPSKLQTMWEDTGTGSKWVMVNRCFFPGDLPEAVGCPCAPESNELYESNNESSVMAGLI 771
L PSKLQTMWE+ TGSKWV+V++C+FPGDLP AVG PCAPESNE+YESN+ESSVMA LI
Sbjct: 684 LTPSKLQTMWEEIETGSKWVLVSQCYFPGDLPAAVGHPCAPESNEVYESNHESSVMASLI 743
Query: 772 RGPCEVLPPGKFKEENERLNHLGNEANKGRHPVFLCQ-------WFY 811
GPCEVLPP KFKE +ER N L EAN G PVF+C+ WFY
Sbjct: 744 EGPCEVLPPNKFKEMSERQNRLAIEANNGSAPVFICKELHDMSIWFY 790
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255580768|ref|XP_002531205.1| conserved hypothetical protein [Ricinus communis] gi|223529207|gb|EEF31182.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|356501576|ref|XP_003519600.1| PREDICTED: uncharacterized protein LOC100807139 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356553535|ref|XP_003545110.1| PREDICTED: uncharacterized protein LOC100783208 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357494725|ref|XP_003617651.1| PHD finger protein [Medicago truncatula] gi|355518986|gb|AET00610.1| PHD finger protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|449463270|ref|XP_004149357.1| PREDICTED: uncharacterized protein LOC101222588 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449503219|ref|XP_004161893.1| PREDICTED: uncharacterized LOC101224472 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|297847406|ref|XP_002891584.1| PHD finger family protein [Arabidopsis lyrata subsp. lyrata] gi|297337426|gb|EFH67843.1| PHD finger family protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|225898018|dbj|BAH30341.1| hypothetical protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|15223606|ref|NP_175477.1| RING/FYVE/PHD zinc finger-containing protein [Arabidopsis thaliana] gi|12322340|gb|AAG51196.1|AC079279_17 hypothetical protein [Arabidopsis thaliana] gi|332194450|gb|AEE32571.1| RING/FYVE/PHD zinc finger-containing protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 823 | ||||||
| TAIR|locus:2008051 | 629 | AT1G50620 "AT1G50620" [Arabido | 0.498 | 0.651 | 0.344 | 3.9e-89 | |
| TAIR|locus:2092414 | 743 | AT3G20280 "AT3G20280" [Arabido | 0.360 | 0.399 | 0.356 | 8e-44 | |
| FB|FBgn0033636 | 3131 | tou "toutatis" [Drosophila mel | 0.072 | 0.019 | 0.359 | 0.00011 | |
| TAIR|locus:2096672 | 2176 | MBD9 "methyl-CPG-binding domai | 0.142 | 0.053 | 0.272 | 0.00036 | |
| FB|FBgn0029861 | 878 | CG3815 [Drosophila melanogaste | 0.144 | 0.135 | 0.279 | 0.0004 | |
| TAIR|locus:2169779 | 349 | ATXR6 "AT5G24330" [Arabidopsis | 0.098 | 0.232 | 0.329 | 0.00063 |
| TAIR|locus:2008051 AT1G50620 "AT1G50620" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 580 (209.2 bits), Expect = 3.9e-89, Sum P(2) = 3.9e-89
Identities = 153/444 (34%), Positives = 224/444 (50%)
Query: 216 ATTSASLPYQLLNNDARPPTVSTGLPSSHLGRDSSSLALPRVEKPQVKLDGGSNGSSYVS 275
A + S+ +Q N++ + S SH R++S + R+E+PQ K D + S
Sbjct: 151 AVNNVSMAHQWPNSEMKASASSVNASGSHYVREASGITQARMERPQFKSDLHTG----TS 206
Query: 276 QVQANASANHPLVNAPTWSVQPQSASSAKAVLENKVPNHIPVKLEGPADMSRTAPQAVRD 335
Q A + N+ N TWS QP S++S + + +PV P+ SR + D
Sbjct: 207 QGPAVPAGNY-FGNTTTWSAQPHSSTSTIS-FGTASDSKVPV----PSS-SR-----ISD 254
Query: 336 QSFRPFISQTGNMPNVHQPLQGTNIVQAPQ-FGSN-HGEIAKIVQKLLHPKLPQHPTWTP 393
SFRPF+SQT P ++G Q FG+N H EIAK++ K+L P+ Q+ W P
Sbjct: 255 PSFRPFMSQTP--PGAFPGMKGATYGQTSSPFGNNNHAEIAKLIHKVLQPRAKQNLLWNP 312
Query: 394 PSREYMSKAFTCQICKLTANEVETVVLCDACEKGFHLKCLQMNNQKGIPRGGEWHCMSCL 453
PSREYMSKA TCQIC+ T NE+ETV++CDACEKG+HLKCL +N KG+P+ EWHC C+
Sbjct: 313 PSREYMSKAMTCQICQGTINEIETVLICDACEKGYHLKCLHAHNIKGVPKS-EWHCSRCV 371
Query: 454 KLSNGKPLPPKYGRVMRSINTTKMPSNTSVIQSPSDKKFISVDQKVNNQQKITVXXXXXX 513
+L NGK PPKYGRVMRS T KM S+T+ +Q P++K +DQKV+ + +
Sbjct: 372 QLYNGKSFPPKYGRVMRSATTAKMSSSTAEVQLPAEKGVGKMDQKVSQEGMPHLETAKPT 431
Query: 514 XXXXXXXXXDC-DLKIHNIRATQGGNLVSSTKSKDQ---ETSSGTYPSNVTKPLGVVPPP 569
+ D+ ++ I +V + + E G V K + +
Sbjct: 432 KDSAMEQTVEAEDVAMNPIVEKAMSEMVEAEGAAINPIVEAEDGAMNPIVEKAMSQIVEA 491
Query: 570 GDSHGPIQSTQVCESSTQLEKLASESKSEHPAISSETVSNHSAASQPS-HNSQVVRTDLA 628
D+ I TQ +++S+ P SE VS+ + P +V+R D
Sbjct: 492 EDA--AINQAVDANFQTQAPTGNDDAESDDP---SEPVSHSETLNPPELEKKEVMRKDAT 546
Query: 629 N---SAEVSLKNSHDSSSTIKQDE 649
SA+ KNS + + Q+E
Sbjct: 547 ERSVSADCQDKNSKIIAESSLQEE 570
|
|
| TAIR|locus:2092414 AT3G20280 "AT3G20280" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0033636 tou "toutatis" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2096672 MBD9 "methyl-CPG-binding domain 9" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0029861 CG3815 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2169779 ATXR6 "AT5G24330" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
No confident hit for EC number transfering in SWISSPROT detected by BLAST
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
No EC number assignment, probably not an enzyme!
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 823 | |||
| cd04370 | 123 | cd04370, BAH, BAH, or Bromo Adjacent Homology doma | 3e-16 | |
| pfam01426 | 120 | pfam01426, BAH, BAH domain | 4e-13 | |
| smart00439 | 121 | smart00439, BAH, Bromo adjacent homology domain | 5e-09 | |
| pfam00628 | 51 | pfam00628, PHD, PHD-finger | 1e-08 | |
| smart00249 | 47 | smart00249, PHD, PHD zinc finger | 1e-08 |
| >gnl|CDD|239835 cd04370, BAH, BAH, or Bromo Adjacent Homology domain (also called ELM1 and BAM for Bromo Adjacent Motif) | Back alignment and domain information |
|---|
Score = 75.5 bits (186), Expect = 3e-16
Identities = 36/133 (27%), Positives = 58/133 (43%), Gaps = 14/133 (10%)
Query: 694 GVTYKVKDHVLLHSS----NNKLMPSKLQTMWEDTGTGSKWVMVNRCFFPGDLPEAVGCP 749
G+TY+V D V + ++ ++++ +WEDT GSK V V + P + P+ +
Sbjct: 1 GITYEVGDSVYVEPDDSIKSDPPYIARIEELWEDTN-GSKQVKVRWFYRPEETPKGLSPF 59
Query: 750 CAPESNELYESNNESSVMAGLIRGPCEVLPPGKFKEENERLNHLGNEANKGRHPVFLCQW 809
EL+ S++ + I G C+VL F E E L NK F C+
Sbjct: 60 A--LRRELFLSDHLDEIPVESIIGKCKVL----FVSEFEGLKQRP---NKIDTDDFFCRL 110
Query: 810 FYDELKGVFRPVS 822
YD F+ +
Sbjct: 111 AYDPTTKEFKALE 123
|
BAH domains have first been described as domains found in the polybromo protein and Yeast Rsc1/Rsc2 (Remodeling of the Structure of Chromatin). They also occur in mammalian DNA methyltransferases and the MTA1 subunits of histone deacetylase complexes. A BAH domain is also found in Yeast Sir3p and in the origin receptor complex protein 1 (Orc1p), where it was found to interact with the N-terminal lobe of the silence information regulator 1 protein (Sir1p), confirming the initial hypothesis that BAH plays a role in protein-protein interactions. Length = 123 |
| >gnl|CDD|216495 pfam01426, BAH, BAH domain | Back alignment and domain information |
|---|
| >gnl|CDD|214664 smart00439, BAH, Bromo adjacent homology domain | Back alignment and domain information |
|---|
| >gnl|CDD|201356 pfam00628, PHD, PHD-finger | Back alignment and domain information |
|---|
| >gnl|CDD|214584 smart00249, PHD, PHD zinc finger | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 823 | |||
| cd04714 | 121 | BAH_BAHCC1 BAH, or Bromo Adjacent Homology domain, | 99.94 | |
| cd04717 | 121 | BAH_polybromo BAH, or Bromo Adjacent Homology doma | 99.93 | |
| cd04715 | 159 | BAH_Orc1p_like BAH, or Bromo Adjacent Homology dom | 99.92 | |
| cd04713 | 146 | BAH_plant_3 BAH, or Bromo Adjacent Homology domain | 99.91 | |
| cd04370 | 123 | BAH BAH, or Bromo Adjacent Homology domain (also c | 99.89 | |
| cd04721 | 130 | BAH_plant_1 BAH, or Bromo Adjacent Homology domain | 99.88 | |
| PF01426 | 119 | BAH: BAH domain; InterPro: IPR001025 The BAH (brom | 99.88 | |
| smart00439 | 120 | BAH Bromo adjacent homology domain. | 99.87 | |
| cd04718 | 148 | BAH_plant_2 BAH, or Bromo Adjacent Homology domain | 99.85 | |
| cd04716 | 122 | BAH_plantDCM_I BAH, or Bromo Adjacent Homology dom | 99.85 | |
| cd04709 | 164 | BAH_MTA BAH, or Bromo Adjacent Homology domain, as | 99.83 | |
| cd04720 | 179 | BAH_Orc1p_Yeast BAH, or Bromo Adjacent Homology do | 99.8 | |
| KOG1827 | 629 | consensus Chromatin remodeling complex RSC, subuni | 99.79 | |
| cd04712 | 130 | BAH_DCM_I BAH, or Bromo Adjacent Homology domain, | 99.71 | |
| cd04710 | 135 | BAH_fungalPHD BAH, or Bromo Adjacent Homology doma | 99.71 | |
| cd04708 | 202 | BAH_plantDCM_II BAH, or Bromo Adjacent Homology do | 99.64 | |
| cd04760 | 124 | BAH_Dnmt1_I BAH, or Bromo Adjacent Homology domain | 99.62 | |
| cd04719 | 128 | BAH_Orc1p_animal BAH, or Bromo Adjacent Homology d | 99.61 | |
| KOG0825 | 1134 | consensus PHD Zn-finger protein [General function | 99.6 | |
| KOG1886 | 464 | consensus BAH domain proteins [Transcription] | 99.55 | |
| cd04711 | 137 | BAH_Dnmt1_II BAH, or Bromo Adjacent Homology domai | 99.43 | |
| KOG1244 | 336 | consensus Predicted transcription factor Requiem/N | 98.86 | |
| KOG1246 | 904 | consensus DNA-binding protein jumonji/RBP2/SMCY, c | 98.73 | |
| PF00628 | 51 | PHD: PHD-finger; InterPro: IPR019787 Zinc finger ( | 98.62 | |
| smart00249 | 47 | PHD PHD zinc finger. The plant homeodomain (PHD) f | 98.37 | |
| KOG4299 | 613 | consensus PHD Zn-finger protein [General function | 98.28 | |
| KOG1512 | 381 | consensus PHD Zn-finger protein [General function | 98.22 | |
| KOG1973 | 274 | consensus Chromatin remodeling protein, contains P | 98.22 | |
| cd04718 | 148 | BAH_plant_2 BAH, or Bromo Adjacent Homology domain | 98.07 | |
| KOG1245 | 1404 | consensus Chromatin remodeling complex WSTF-ISWI, | 97.86 | |
| COG5034 | 271 | TNG2 Chromatin remodeling protein, contains PhD zi | 97.86 | |
| KOG0955 | 1051 | consensus PHD finger protein BR140/LIN-49 [General | 97.66 | |
| KOG4443 | 694 | consensus Putative transcription factor HALR/MLL3, | 97.54 | |
| KOG0957 | 707 | consensus PHD finger protein [General function pre | 97.41 | |
| KOG0956 | 900 | consensus PHD finger protein AF10 [General functio | 97.4 | |
| KOG0954 | 893 | consensus PHD finger protein [General function pre | 97.39 | |
| COG5076 | 371 | Transcription factor involved in chromatin remodel | 97.37 | |
| KOG0383 | 696 | consensus Predicted helicase [General function pre | 97.35 | |
| KOG4323 | 464 | consensus Polycomb-like PHD Zn-finger protein [Gen | 97.35 | |
| COG5141 | 669 | PHD zinc finger-containing protein [General functi | 97.33 | |
| PF13831 | 36 | PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A. | 96.86 | |
| PF12678 | 73 | zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 | 93.7 | |
| PF13639 | 44 | zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C | 93.66 | |
| KOG3554 | 693 | consensus Histone deacetylase complex, MTA1 compon | 93.14 | |
| PHA02929 | 238 | N1R/p28-like protein; Provisional | 92.18 | |
| KOG1473 | 1414 | consensus Nucleosome remodeling factor, subunit NU | 92.03 | |
| KOG0957 | 707 | consensus PHD finger protein [General function pre | 90.83 | |
| PF12861 | 85 | zf-Apc11: Anaphase-promoting complex subunit 11 RI | 90.32 | |
| KOG0317 | 293 | consensus Predicted E3 ubiquitin ligase, integral | 88.24 | |
| COG5194 | 88 | APC11 Component of SCF ubiquitin ligase and anapha | 87.44 | |
| PF12861 | 85 | zf-Apc11: Anaphase-promoting complex subunit 11 RI | 86.54 | |
| PF15446 | 175 | zf-PHD-like: PHD/FYVE-zinc-finger like domain | 86.2 | |
| KOG4628 | 348 | consensus Predicted E3 ubiquitin ligase [Posttrans | 85.15 | |
| KOG0804 | 493 | consensus Cytoplasmic Zn-finger protein BRAP2 (BRC | 85.08 | |
| PHA02926 | 242 | zinc finger-like protein; Provisional | 84.55 | |
| KOG0802 | 543 | consensus E3 ubiquitin ligase [Posttranslational m | 84.46 | |
| PF14446 | 54 | Prok-RING_1: Prokaryotic RING finger family 1 | 82.3 | |
| KOG4443 | 694 | consensus Putative transcription factor HALR/MLL3, | 82.0 | |
| cd00162 | 45 | RING RING-finger (Really Interesting New Gene) dom | 81.87 | |
| KOG1493 | 84 | consensus Anaphase-promoting complex (APC), subuni | 81.12 | |
| COG5243 | 491 | HRD1 HRD ubiquitin ligase complex, ER membrane com | 80.47 |
| >cd04714 BAH_BAHCC1 BAH, or Bromo Adjacent Homology domain, as present in mammalian BAHCC1 and similar proteins | Back alignment and domain information |
|---|
Probab=99.94 E-value=2.4e-27 Score=221.84 Aligned_cols=118 Identities=20% Similarity=0.374 Sum_probs=104.4
Q ss_pred CEEEeecCEEEEecCCCCCCh--hhhhhhhccCCCCceEEEeeeeccCCCCCCccCCCCCCCcccccccCCccccccccc
Q 003406 694 GVTYKVKDHVLLHSSNNKLMP--SKLQTMWEDTGTGSKWVMVNRCFFPGDLPEAVGCPCAPESNELYESNNESSVMAGLI 771 (823)
Q Consensus 694 GetyrvgDcVLl~S~~~~~~P--akI~~lWE~~~sG~~~v~v~WYYrPE~t~~~~grp~~~~~NEVf~S~H~D~n~Va~I 771 (823)
|++|+|||||+|++++++.+| |+|.+|||+ .+|++|++++||||||||.+ ||...+.+||||.|+|+|+|++.+|
T Consensus 1 ~~~~~vGD~V~v~~~~~~~~pyIgrI~~i~e~-~~g~~~~~v~WfyrPeEt~~--~~~~~~~~~EvF~S~~~d~~~~~~I 77 (121)
T cd04714 1 KEIIRVGDCVLFKSPGRPSLPYVARIESLWED-PEGNMVVRVKWYYRPEETKG--GRKPNHGEKELFASDHQDENSVQTI 77 (121)
T ss_pred CCEEEcCCEEEEeCCCCCCCCEEEEEEEEEEc-CCCCEEEEEEEEEcHHHccC--cccccCCCCceEecCCcccccHHHh
Confidence 789999999999999887888 999999997 46999999999999999976 4555899999999999999999999
Q ss_pred ccceEEeCcchhhhhHHHhhhcCCCCCCCCCCeEEEeeeeecccCccc
Q 003406 772 RGPCEVLPPGKFKEENERLNHLGNEANKGRHPVFLCQWFYDELKGVFR 819 (823)
Q Consensus 772 egKC~Vl~f~ry~~~~~rr~~~g~~~~~~~~p~F~Cr~~Yd~~~~~f~ 819 (823)
.|||.|+++.+|.++..++ +......++|+|+..||+.+..++
T Consensus 78 ~gkc~V~~~~ey~~~~~~~-----~~~~~~~d~~~Ce~~yn~~~~~~~ 120 (121)
T cd04714 78 EHKCYVLTFAEYERLARVK-----KKPQDGVDFYYCAGTYNPDTGMLK 120 (121)
T ss_pred CcccEEEehhHheeccccc-----CCCCcCCCEEEEeccCCCCcCccc
Confidence 9999999999997666553 233457779999999999998876
|
BAHCC1 stands for BAH domain and coiled-coil containing 1. BAH domains are found in a variety of proteins playing roles in transcriptional silencing and the remodeling of chromatin. It is assumed that in most or all of these instances the BAH domain mediates protein-protein interactions. |
| >cd04717 BAH_polybromo BAH, or Bromo Adjacent Homology domain, as present in polybromo and yeast RSC1/2 | Back alignment and domain information |
|---|
| >cd04715 BAH_Orc1p_like BAH, or Bromo Adjacent Homology domain, as present in the Schizosaccharomyces pombe homolog of Saccharomyces cerevisiae Orc1p and similar proteins | Back alignment and domain information |
|---|
| >cd04713 BAH_plant_3 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function | Back alignment and domain information |
|---|
| >cd04370 BAH BAH, or Bromo Adjacent Homology domain (also called ELM1 and BAM for Bromo Adjacent Motif) | Back alignment and domain information |
|---|
| >cd04721 BAH_plant_1 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function | Back alignment and domain information |
|---|
| >PF01426 BAH: BAH domain; InterPro: IPR001025 The BAH (bromo-adjacent homology) family contains proteins such as eukaryotic DNA (cytosine-5) methyltransferases IPR001525 from INTERPRO, the origin recognition complex 1 (Orc1) proteins, as well as several proteins involved in transcriptional regulation | Back alignment and domain information |
|---|
| >smart00439 BAH Bromo adjacent homology domain | Back alignment and domain information |
|---|
| >cd04718 BAH_plant_2 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function | Back alignment and domain information |
|---|
| >cd04716 BAH_plantDCM_I BAH, or Bromo Adjacent Homology domain, first copy present in DNA (Cytosine-5)-methyltransferases (DCM) from plants | Back alignment and domain information |
|---|
| >cd04709 BAH_MTA BAH, or Bromo Adjacent Homology domain, as present in MTA1 and similar proteins | Back alignment and domain information |
|---|
| >cd04720 BAH_Orc1p_Yeast BAH, or Bromo Adjacent Homology domain, as present in Orc1p, which again is part of the Saccharomyces cerevisiae Sir1-origin recognition complex, and as present in Sir3p | Back alignment and domain information |
|---|
| >KOG1827 consensus Chromatin remodeling complex RSC, subunit RSC1/Polybromo and related proteins [Chromatin structure and dynamics; Transcription] | Back alignment and domain information |
|---|
| >cd04712 BAH_DCM_I BAH, or Bromo Adjacent Homology domain, as present in DNA (Cytosine-5)-methyltransferases (DCM) 1 | Back alignment and domain information |
|---|
| >cd04710 BAH_fungalPHD BAH, or Bromo Adjacent Homology domain, as present in fungal proteins containing PHD domains | Back alignment and domain information |
|---|
| >cd04708 BAH_plantDCM_II BAH, or Bromo Adjacent Homology domain, second copy present in DNA (Cytosine-5)-methyltransferases (DCM) from plants | Back alignment and domain information |
|---|
| >cd04760 BAH_Dnmt1_I BAH, or Bromo Adjacent Homology domain, first copy present in DNA (Cytosine-5)-methyltransferases from Bilateria, Dnmt1 and similar proteins | Back alignment and domain information |
|---|
| >cd04719 BAH_Orc1p_animal BAH, or Bromo Adjacent Homology domain, as present in animal homologs of Saccharomyces cerevisiae Orc1p | Back alignment and domain information |
|---|
| >KOG0825 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1886 consensus BAH domain proteins [Transcription] | Back alignment and domain information |
|---|
| >cd04711 BAH_Dnmt1_II BAH, or Bromo Adjacent Homology domain, second copy present in DNA (Cytosine-5)-methyltransferases from Bilateria, Dnmt1 and similar proteins | Back alignment and domain information |
|---|
| >KOG1244 consensus Predicted transcription factor Requiem/NEURO-D4 [Transcription] | Back alignment and domain information |
|---|
| >KOG1246 consensus DNA-binding protein jumonji/RBP2/SMCY, contains JmjC domain [General function prediction only] | Back alignment and domain information |
|---|
| >PF00628 PHD: PHD-finger; InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >smart00249 PHD PHD zinc finger | Back alignment and domain information |
|---|
| >KOG4299 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1512 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1973 consensus Chromatin remodeling protein, contains PHD Zn-finger [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >cd04718 BAH_plant_2 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function | Back alignment and domain information |
|---|
| >KOG1245 consensus Chromatin remodeling complex WSTF-ISWI, large subunit (contains heterochromatin localization, PHD and BROMO domains) [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >COG5034 TNG2 Chromatin remodeling protein, contains PhD zinc finger [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG0955 consensus PHD finger protein BR140/LIN-49 [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4443 consensus Putative transcription factor HALR/MLL3, involved in embryonic development [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0957 consensus PHD finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0956 consensus PHD finger protein AF10 [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0954 consensus PHD finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG5076 Transcription factor involved in chromatin remodeling, contains bromodomain [Chromatin structure and dynamics / Transcription] | Back alignment and domain information |
|---|
| >KOG0383 consensus Predicted helicase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4323 consensus Polycomb-like PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG5141 PHD zinc finger-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF13831 PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A | Back alignment and domain information |
|---|
| >PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A | Back alignment and domain information |
|---|
| >KOG3554 consensus Histone deacetylase complex, MTA1 component [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PHA02929 N1R/p28-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG1473 consensus Nucleosome remodeling factor, subunit NURF301/BPTF [Chromatin structure and dynamics; Transcription] | Back alignment and domain information |
|---|
| >KOG0957 consensus PHD finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger | Back alignment and domain information |
|---|
| >KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger | Back alignment and domain information |
|---|
| >PF15446 zf-PHD-like: PHD/FYVE-zinc-finger like domain | Back alignment and domain information |
|---|
| >KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02926 zinc finger-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14446 Prok-RING_1: Prokaryotic RING finger family 1 | Back alignment and domain information |
|---|
| >KOG4443 consensus Putative transcription factor HALR/MLL3, involved in embryonic development [General function prediction only] | Back alignment and domain information |
|---|
| >cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B Length = 70 | Back alignment and structure |
|---|
| >2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 | Back alignment and structure |
|---|
| >1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Length = 51 | Back alignment and structure |
|---|
| >3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} Length = 77 | Back alignment and structure |
|---|
| >2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Length = 114 | Back alignment and structure |
|---|
| >2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Length = 114 | Back alignment and structure |
|---|
| >2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 77 | Back alignment and structure |
|---|
| >1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Length = 66 | Back alignment and structure |
|---|
| >3av4_A DNA (cytosine-5)-methyltransferase 1; CXXC-type zinc finger/C5-methyltransferase family; HET: DNA; 2.75A {Mus musculus} PDB: 3av5_A* 3av6_A* Length = 1330 | Back alignment and structure |
|---|
| >2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Length = 111 | Back alignment and structure |
|---|
| >2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Length = 111 | Back alignment and structure |
|---|
| >3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} Length = 226 | Back alignment and structure |
|---|
| >2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Length = 75 | Back alignment and structure |
|---|
| >3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Length = 112 | Back alignment and structure |
|---|
| >3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Length = 112 | Back alignment and structure |
|---|
| >2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 56 | Back alignment and structure |
|---|
| >2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Length = 60 | Back alignment and structure |
|---|
| >1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Length = 61 | Back alignment and structure |
|---|
| >1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Length = 88 | Back alignment and structure |
|---|
| >2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Length = 61 | Back alignment and structure |
|---|
| >3swr_A DNA (cytosine-5)-methyltransferase 1; epigenetics, DNA methyltransferase fold, maintenance methyla transferase; HET: DNA SFG MES; 2.49A {Homo sapiens} PDB: 3pta_A* 3pt6_A* 3pt9_A* 4da4_A* Length = 1002 | Back alignment and structure |
|---|
| >2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} Length = 66 | Back alignment and structure |
|---|
| >2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} Length = 71 | Back alignment and structure |
|---|
| >1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 Length = 88 | Back alignment and structure |
|---|
| >1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Length = 64 | Back alignment and structure |
|---|
| >1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 Length = 79 | Back alignment and structure |
|---|
| >3kqi_A GRC5, PHD finger protein 2; metal-binding, zinc-finger, histone-binding, NUC protein; HET: M3L; 1.78A {Homo sapiens} Length = 75 | Back alignment and structure |
|---|
| >2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A Length = 129 | Back alignment and structure |
|---|
| >2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Length = 189 | Back alignment and structure |
|---|
| >2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A Length = 142 | Back alignment and structure |
|---|
| >2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} Length = 105 | Back alignment and structure |
|---|
| >1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Length = 72 | Back alignment and structure |
|---|
| >2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A* Length = 52 | Back alignment and structure |
|---|
| >2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Length = 174 | Back alignment and structure |
|---|
| >2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A* Length = 65 | Back alignment and structure |
|---|
| >1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 Length = 76 | Back alignment and structure |
|---|
| >3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Length = 184 | Back alignment and structure |
|---|
| >3a1b_A DNA (cytosine-5)-methyltransferase 3A, histone H3; zinc-finger, histone binding, chromosomal protein, DNA damag repair, DNA-binding, methylation; HET: DNA; 2.29A {Homo sapiens} PDB: 3a1a_A* Length = 159 | Back alignment and structure |
|---|
| >3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Length = 183 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 823 | |||
| 1w4s_A | 174 | Polybromo, polybromo 1 protein; BAH, bromo-associa | 99.97 | |
| 3swr_A | 1002 | DNA (cytosine-5)-methyltransferase 1; epigenetics, | 99.86 | |
| 3av4_A | 1330 | DNA (cytosine-5)-methyltransferase 1; CXXC-type zi | 99.86 | |
| 3av4_A | 1330 | DNA (cytosine-5)-methyltransferase 1; CXXC-type zi | 99.61 | |
| 4dov_A | 163 | ORC1, origin recognition complex subunit 1; DNA re | 99.56 | |
| 3swr_A | 1002 | DNA (cytosine-5)-methyltransferase 1; epigenetics, | 99.56 | |
| 2e6r_A | 92 | Jumonji/ARID domain-containing protein 1D; PHD dom | 99.54 | |
| 4ft4_B | 784 | DNA (cytosine-5)-methyltransferase 1; chromodomain | 99.48 | |
| 1f62_A | 51 | Transcription factor WSTF; Zn-finger; NMR {Homo sa | 99.35 | |
| 2lri_C | 66 | Autoimmune regulator; Zn binding protein domain, a | 99.28 | |
| 1mm2_A | 61 | MI2-beta; PHD, zinc finger, protein scaffold, DNA | 99.25 | |
| 1xwh_A | 66 | Autoimmune regulator; PHD domain, Zn binding domai | 99.24 | |
| 1fp0_A | 88 | KAP-1 corepressor; PHD domain, C3HC4 type zinc bin | 99.24 | |
| 2e6s_A | 77 | E3 ubiquitin-protein ligase UHRF2; PHD domain, str | 99.23 | |
| 3asl_A | 70 | E3 ubiquitin-protein ligase UHRF1; histone reader | 99.23 | |
| 2yql_A | 56 | PHD finger protein 21A; PHD domain, structural gen | 99.23 | |
| 2l5u_A | 61 | Chromodomain-helicase-DNA-binding protein 4; CHD4, | 99.23 | |
| 2puy_A | 60 | PHD finger protein 21A; PHD finger, histone CODE, | 99.2 | |
| 1wev_A | 88 | Riken cDNA 1110020M19; structural genomics, PHD do | 99.19 | |
| 2yt5_A | 66 | Metal-response element-binding transcription facto | 99.18 | |
| 3shb_A | 77 | E3 ubiquitin-protein ligase UHRF1; unmodified hist | 99.18 | |
| 2ku3_A | 71 | Bromodomain-containing protein 1; PHD finger, chro | 99.1 | |
| 3u5n_A | 207 | E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b | 99.09 | |
| 3ask_A | 226 | E3 ubiquitin-protein ligase UHRF1; histone reader | 99.09 | |
| 2l43_A | 88 | N-teminal domain from histone H3.3, linker, PHD1 f | 99.07 | |
| 3o36_A | 184 | Transcription intermediary factor 1-alpha; TRIM24, | 99.07 | |
| 2k16_A | 75 | Transcription initiation factor TFIID subunit 3; p | 99.05 | |
| 2kwj_A | 114 | Zinc finger protein DPF3; acetyl-lysine, transcrip | 99.03 | |
| 3v43_A | 112 | Histone acetyltransferase KAT6A; MOZ, PHD finger, | 99.01 | |
| 2ro1_A | 189 | Transcription intermediary factor 1-beta; KAP, TIF | 98.99 | |
| 2ysm_A | 111 | Myeloid/lymphoid or mixed-lineage leukemia protein | 98.96 | |
| 4gne_A | 107 | Histone-lysine N-methyltransferase NSD3; zinc fing | 98.82 | |
| 1wen_A | 71 | Inhibitor of growth family, member 4; ING1-like pr | 98.74 | |
| 2lv9_A | 98 | Histone-lysine N-methyltransferase MLL5; zinc fing | 98.74 | |
| 2vnf_A | 60 | ING 4, P29ING4, inhibitor of growth protein 4; ace | 98.72 | |
| 1weu_A | 91 | Inhibitor of growth family, member 4; structural g | 98.66 | |
| 3c6w_A | 59 | P28ING5, inhibitor of growth protein 5; chromatin, | 98.66 | |
| 2g6q_A | 62 | Inhibitor of growth protein 2; protein-peptide com | 98.65 | |
| 2jmi_A | 90 | Protein YNG1, ING1 homolog 1; PHD, histone, recogn | 98.6 | |
| 2fl7_A | 232 | Regulatory protein SIR3; ORC, silencing, chromatin | 98.52 | |
| 1m4z_A | 238 | Origin recognition complex subunit 1; DNA replicat | 98.51 | |
| 2ysm_A | 111 | Myeloid/lymphoid or mixed-lineage leukemia protein | 98.44 | |
| 1we9_A | 64 | PHD finger family protein; structural genomics, PH | 98.42 | |
| 1x4i_A | 70 | Inhibitor of growth protein 3; structural genomics | 98.36 | |
| 1wem_A | 76 | Death associated transcription factor 1; structura | 98.34 | |
| 2xb1_A | 105 | Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; | 98.32 | |
| 2vpb_A | 65 | Hpygo1, pygopus homolog 1; gene regulation, WNT si | 98.31 | |
| 2lbm_A | 142 | Transcriptional regulator ATRX; metal binding prot | 98.27 | |
| 3o70_A | 68 | PHD finger protein 13; PHF13, structural genomics | 98.24 | |
| 1wee_A | 72 | PHD finger family protein; structural genomics, PH | 98.23 | |
| 1wep_A | 79 | PHF8; structural genomics, PHD domain, riken struc | 98.21 | |
| 2ri7_A | 174 | Nucleosome-remodeling factor subunit BPTF; zinc fi | 98.18 | |
| 2kgg_A | 52 | Histone demethylase jarid1A; PHD finger, histone m | 98.16 | |
| 3kqi_A | 75 | GRC5, PHD finger protein 2; metal-binding, zinc-fi | 98.11 | |
| 1wew_A | 78 | DNA-binding family protein; structural genomics, P | 98.06 | |
| 3ql9_A | 129 | Transcriptional regulator ATRX; zinc finger, trans | 97.99 | |
| 3o7a_A | 52 | PHD finger protein 13 variant; PHF13, zinc finger, | 97.86 | |
| 2rsd_A | 68 | E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant | 97.81 | |
| 2kwj_A | 114 | Zinc finger protein DPF3; acetyl-lysine, transcrip | 97.8 | |
| 3lqh_A | 183 | Histone-lysine N-methyltransferase MLL; PHD finger | 97.76 | |
| 3v43_A | 112 | Histone acetyltransferase KAT6A; MOZ, PHD finger, | 97.73 | |
| 3kv5_D | 488 | JMJC domain-containing histone demethylation prote | 97.54 | |
| 3kv4_A | 447 | PHD finger protein 8; epigenetics, histone CODE, c | 97.23 | |
| 3pur_A | 528 | Lysine-specific demethylase 7 homolog; oxidoreduct | 97.2 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 97.09 | |
| 1wil_A | 89 | KIAA1045 protein; ring finger domain, structural g | 96.93 | |
| 4bbq_A | 117 | Lysine-specific demethylase 2A; oxidoreductase, ub | 96.55 | |
| 2ku7_A | 140 | MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio | 95.8 | |
| 2ecl_A | 81 | Ring-box protein 2; RNF7, ring domian, zinc-bindin | 95.46 | |
| 2ect_A | 78 | Ring finger protein 126; metal binding protein, st | 95.46 | |
| 1iym_A | 55 | EL5; ring-H2 finger, ubiquitin ligase, DNA binding | 95.43 | |
| 2ecm_A | 55 | Ring finger and CHY zinc finger domain- containing | 94.83 | |
| 2ep4_A | 74 | Ring finger protein 24; zinc binding, ubiquitin, E | 94.81 | |
| 1x4j_A | 75 | Ring finger protein 38; structural genomics, NPPSF | 94.57 | |
| 3dpl_R | 106 | Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST | 94.29 | |
| 2d8s_A | 80 | Cellular modulator of immune recognition; C-MIR, m | 94.2 | |
| 2kiz_A | 69 | E3 ubiquitin-protein ligase arkadia; ring-H2 finge | 94.17 | |
| 3ng2_A | 71 | RNF4, snurf, ring finger protein 4; ring domain, E | 94.02 | |
| 4a0k_B | 117 | E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi | 93.96 | |
| 1v87_A | 114 | Deltex protein 2; ring-H2 domain, zinc-binding dom | 93.89 | |
| 1chc_A | 68 | Equine herpes virus-1 ring domain; viral protein; | 93.83 | |
| 2l0b_A | 91 | E3 ubiquitin-protein ligase praja-1; zinc finger, | 93.71 | |
| 2ea6_A | 69 | Ring finger protein 4; RNF4, RES4-26, ring domain, | 93.61 | |
| 2xeu_A | 64 | Ring finger protein 4; transcription, zinc-finger, | 93.57 | |
| 2d8t_A | 71 | Dactylidin, ring finger protein 146; RNF146, ring | 93.03 | |
| 2djb_A | 72 | Polycomb group ring finger protein 6; PCGF6, ring | 91.98 | |
| 2ecn_A | 70 | Ring finger protein 141; RNF141, ring domain, zinc | 91.67 | |
| 4ayc_A | 138 | E3 ubiquitin-protein ligase RNF8; DNA damage, K63 | 91.33 | |
| 3lrq_A | 100 | E3 ubiquitin-protein ligase TRIM37; structural gen | 90.7 | |
| 2y43_A | 99 | E3 ubiquitin-protein ligase RAD18; DNA repair, met | 90.51 | |
| 2yur_A | 74 | Retinoblastoma-binding protein 6; P53-associated c | 90.16 | |
| 3fl2_A | 124 | E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA | 89.81 | |
| 2csy_A | 81 | Zinc finger protein 183-like 1; ring finger protei | 89.35 | |
| 1t1h_A | 78 | Gspef-atpub14, armadillo repeat containing protein | 89.32 | |
| 2ct0_A | 74 | Non-SMC element 1 homolog; ring domain, structural | 88.87 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 88.86 | |
| 1jm7_A | 112 | BRCA1, breast cancer type 1 susceptibility protein | 88.54 | |
| 2ckl_A | 108 | Polycomb group ring finger protein 4; BMI1, RING1B | 88.17 | |
| 1g25_A | 65 | CDK-activating kinase assembly factor MAT1; ring f | 87.96 | |
| 3ztg_A | 92 | E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR | 87.91 | |
| 2ecy_A | 66 | TNF receptor-associated factor 3; metal binding pr | 87.77 | |
| 3rsn_A | 177 | SET1/ASH2 histone methyltransferase complex subun; | 87.52 | |
| 2egp_A | 79 | Tripartite motif-containing protein 34; ZF-C3HC4 d | 87.1 | |
| 2ecv_A | 85 | Tripartite motif-containing protein 5; metal bindi | 86.74 | |
| 2ct2_A | 88 | Tripartite motif protein 32; zinc-finger protein H | 86.05 | |
| 2ysl_A | 73 | Tripartite motif-containing protein 31; ring-type | 86.03 | |
| 2ckl_B | 165 | Ubiquitin ligase protein RING2; BMI1, RING1B, poly | 85.11 | |
| 1z6u_A | 150 | NP95-like ring finger protein isoform B; structura | 84.53 | |
| 2ecw_A | 85 | Tripartite motif-containing protein 30; metal bind | 84.52 | |
| 1rmd_A | 116 | RAG1; V(D)J recombination, antibody, MAD, ring fin | 84.2 | |
| 1jm7_B | 117 | BARD1, BRCA1-associated ring domain protein 1; rin | 83.72 | |
| 1x4j_A | 75 | Ring finger protein 38; structural genomics, NPPSF | 83.26 | |
| 3hct_A | 118 | TNF receptor-associated factor 6; cross-brace, bet | 82.8 | |
| 3l11_A | 115 | E3 ubiquitin-protein ligase RNF168; E3 ligase, rin | 81.92 | |
| 1iym_A | 55 | EL5; ring-H2 finger, ubiquitin ligase, DNA binding | 81.82 | |
| 3a1b_A | 159 | DNA (cytosine-5)-methyltransferase 3A, histone H3; | 81.8 | |
| 2d8s_A | 80 | Cellular modulator of immune recognition; C-MIR, m | 81.55 | |
| 1vyx_A | 60 | ORF K3, K3RING; zinc-binding protein, ring domain, | 80.99 | |
| 2ecl_A | 81 | Ring-box protein 2; RNF7, ring domian, zinc-bindin | 80.29 |
| >3swr_A DNA (cytosine-5)-methyltransferase 1; epigenetics, DNA methyltransferase fold, maintenance methyla transferase; HET: DNA SFG MES; 2.49A {Homo sapiens} PDB: 3pta_A* 3pt6_A* 3pt9_A* 4da4_A* | Back alignment and structure |
|---|
| >3av4_A DNA (cytosine-5)-methyltransferase 1; CXXC-type zinc finger/C5-methyltransferase family; HET: DNA; 2.75A {Mus musculus} PDB: 3av5_A* 3av6_A* | Back alignment and structure |
|---|
| >3av4_A DNA (cytosine-5)-methyltransferase 1; CXXC-type zinc finger/C5-methyltransferase family; HET: DNA; 2.75A {Mus musculus} PDB: 3av5_A* 3av6_A* | Back alignment and structure |
|---|
| >4dov_A ORC1, origin recognition complex subunit 1; DNA replication, replication; 1.70A {Mus musculus} PDB: 4dow_A* | Back alignment and structure |
|---|
| >3swr_A DNA (cytosine-5)-methyltransferase 1; epigenetics, DNA methyltransferase fold, maintenance methyla transferase; HET: DNA SFG MES; 2.49A {Homo sapiens} PDB: 3pta_A* 3pt6_A* 3pt9_A* 4da4_A* | Back alignment and structure |
|---|
| >2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ft4_B DNA (cytosine-5)-methyltransferase 1; chromodomain, BAH domain, DNA methyltransferase domain, H3K9 binding, methylation, transferase; HET: DNA MLY SAH; 2.70A {Zea mays} PDB: 4ft2_A* 4fsx_A* | Back alignment and structure |
|---|
| >1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A | Back alignment and structure |
|---|
| >1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A | Back alignment and structure |
|---|
| >1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B | Back alignment and structure |
|---|
| >2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} | Back alignment and structure |
|---|
| >1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* | Back alignment and structure |
|---|
| >3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A | Back alignment and structure |
|---|
| >2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* | Back alignment and structure |
|---|
| >2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* | Back alignment and structure |
|---|
| >3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A | Back alignment and structure |
|---|
| >2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4gne_A Histone-lysine N-methyltransferase NSD3; zinc finger, transcription, nuclear protein, transf nuclear protein complex; 1.47A {Homo sapiens} PDB: 4gnd_A 4gnf_A 4gng_A* | Back alignment and structure |
|---|
| >1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A | Back alignment and structure |
|---|
| >2lv9_A Histone-lysine N-methyltransferase MLL5; zinc finger, transcription, protein binding, NESG, northeast structural genomics consortium, SGC; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2vnf_A ING 4, P29ING4, inhibitor of growth protein 4; acetylation, alternative splicing, anti-oncogene, cell cycle, coiled C nucleus, zinc, zinc-finger, ING4; HET: M3L; 1.76A {Homo sapiens} SCOP: g.50.1.2 PDB: 2k1j_A 2jmq_A 2qic_A* | Back alignment and structure |
|---|
| >1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A* | Back alignment and structure |
|---|
| >2g6q_A Inhibitor of growth protein 2; protein-peptide complex, gene regulation, apoptosis; HET: M3L; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >2jmi_A Protein YNG1, ING1 homolog 1; PHD, histone, recognition, yeast, protein binding; NMR {Saccharomyces cerevisiae} PDB: 2jmj_A* | Back alignment and structure |
|---|
| >2fl7_A Regulatory protein SIR3; ORC, silencing, chromatin, transcription; 1.85A {Saccharomyces cerevisiae} PDB: 2fvu_A 3tu4_K* | Back alignment and structure |
|---|
| >1m4z_A Origin recognition complex subunit 1; DNA replication, transcriptional silencing, chromatin, BAH D gene regulation; 2.20A {Saccharomyces cerevisiae} SCOP: b.34.12.1 PDB: 1zhi_A 1zbx_A | Back alignment and structure |
|---|
| >2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A* | Back alignment and structure |
|---|
| >2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A | Back alignment and structure |
|---|
| >3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* | Back alignment and structure |
|---|
| >2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A* | Back alignment and structure |
|---|
| >3kqi_A GRC5, PHD finger protein 2; metal-binding, zinc-finger, histone-binding, NUC protein; HET: M3L; 1.78A {Homo sapiens} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >1wew_A DNA-binding family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A | Back alignment and structure |
|---|
| >3o7a_A PHD finger protein 13 variant; PHF13, zinc finger, PHD domain, nuclear protein, structural structural genomics consortium, SGC, protein binding; HET: M3L; 1.67A {Homo sapiens} | Back alignment and structure |
|---|
| >2rsd_A E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant homeodomain (PHD), histone binding; NMR {Oryza sativa japonica group} | Back alignment and structure |
|---|
| >2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* | Back alignment and structure |
|---|
| >3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A | Back alignment and structure |
|---|
| >3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A | Back alignment and structure |
|---|
| >3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* | Back alignment and structure |
|---|
| >3kv4_A PHD finger protein 8; epigenetics, histone CODE, covalent histone modifications, jumonji demethylase, mental retardation, metal-binding, zinc; HET: M3L MLY OGA; 2.19A {Homo sapiens} | Back alignment and structure |
|---|
| >3pur_A Lysine-specific demethylase 7 homolog; oxidoreductase-oxidoreductase inhibitor complex; HET: 2HG; 2.10A {Caenorhabditis elegans} PDB: 3n9l_A 3n9m_A* 3n9o_A* 3n9p_A* 3n9q_A* 3n9n_A* 3puq_A* | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 | Back alignment and structure |
|---|
| >4bbq_A Lysine-specific demethylase 2A; oxidoreductase, ubiquitin, ligase, ubiquitination, demethyla ZF-CXXC DNA binding domain, CPG island, chromatin; 2.24A {Homo sapiens} | Back alignment and structure |
|---|
| >2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A | Back alignment and structure |
|---|
| >2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A | Back alignment and structure |
|---|
| >2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} | Back alignment and structure |
|---|
| >1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A | Back alignment and structure |
|---|
| >1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3rsn_A SET1/ASH2 histone methyltransferase complex subun; PHD domain, winged helix domain, binding, transcription; 2.10A {Homo sapiens} PDB: 3s32_A | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} | Back alignment and structure |
|---|
| >1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >3a1b_A DNA (cytosine-5)-methyltransferase 3A, histone H3; zinc-finger, histone binding, chromosomal protein, DNA damag repair, DNA-binding, methylation; HET: DNA; 2.29A {Homo sapiens} PDB: 3a1a_A* | Back alignment and structure |
|---|
| >2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 | Back alignment and structure |
|---|
| >2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 823 | ||||
| d1we9a_ | 64 | g.50.1.2 (A:) PHD finger protein At5g26210 {Thale | 1e-10 | |
| d1f62a_ | 51 | g.50.1.2 (A:) Williams-Beuren syndrome transcripti | 6e-10 | |
| d1fp0a1 | 70 | g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF- | 1e-09 | |
| d1mm2a_ | 61 | g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens | 6e-09 | |
| d1weea_ | 72 | g.50.1.2 (A:) PHD finger protein At1g33420 {Thale | 8e-08 | |
| d1weva_ | 88 | g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus mu | 1e-07 | |
| d1wepa_ | 79 | g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus mus | 3e-06 | |
| d1wema_ | 76 | g.50.1.2 (A:) Death associated transcription facto | 2e-05 | |
| d1m4za_ | 217 | b.34.12.1 (A:) Origin-recognition complex protein | 9e-04 |
| >d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 64 | Back information, alignment and structure |
|---|
class: Small proteins fold: FYVE/PHD zinc finger superfamily: FYVE/PHD zinc finger family: PHD domain domain: PHD finger protein At5g26210 species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]
Score = 55.8 bits (134), Expect = 1e-10
Identities = 14/51 (27%), Positives = 22/51 (43%), Gaps = 1/51 (1%)
Query: 404 TCQICKLTANEVETVVLCDACEKGFHLKCLQMNNQKGIPRGGEWHCMSCLK 454
C C + E + CD CE FH KC+++ + ++ C SC
Sbjct: 8 QCGACGESYAADEFWICCDLCEMWFHGKCVKITPARAEHI-KQYKCPSCSN 57
|
| >d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Length = 51 | Back information, alignment and structure |
|---|
| >d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Length = 70 | Back information, alignment and structure |
|---|
| >d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Length = 61 | Back information, alignment and structure |
|---|
| >d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 72 | Back information, alignment and structure |
|---|
| >d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Length = 88 | Back information, alignment and structure |
|---|
| >d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Length = 79 | Back information, alignment and structure |
|---|
| >d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 76 | Back information, alignment and structure |
|---|
| >d1m4za_ b.34.12.1 (A:) Origin-recognition complex protein 120kDa subunit, Orc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 217 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 823 | |||
| d1m4za_ | 217 | Origin-recognition complex protein 120kDa subunit, | 99.4 | |
| d1f62a_ | 51 | Williams-Beuren syndrome transcription factor, WST | 99.16 | |
| d1fp0a1 | 70 | Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo | 99.09 | |
| d1mm2a_ | 61 | Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 | 98.97 | |
| d1weva_ | 88 | PHD finger protein 22 {Mouse (Mus musculus) [TaxId | 98.8 | |
| d1weea_ | 72 | PHD finger protein At1g33420 {Thale cress (Arabido | 98.62 | |
| d1we9a_ | 64 | PHD finger protein At5g26210 {Thale cress (Arabido | 98.61 | |
| d2pnxa1 | 51 | Inhibitor of growth protein 4, Ing4 {Homo sapiens | 98.55 | |
| d1wesa_ | 71 | PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu | 98.51 | |
| d1wepa_ | 79 | PHD finger protein 8 {Mouse (Mus musculus) [TaxId: | 98.39 | |
| d1wema_ | 76 | Death associated transcription factor 1, Datf1 (DI | 98.14 | |
| d1wewa_ | 78 | Sumoylation ligase E3, SIZ1 {Thale cress (Arabidop | 97.97 | |
| d3dplr1 | 88 | RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase | 96.21 | |
| d1iyma_ | 55 | EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 | 95.81 | |
| d1chca_ | 68 | Immediate early protein, IEEHV {Equine herpesvirus | 95.39 | |
| d1ur6b_ | 52 | Not-4 N-terminal RING finger domain {Human (Homo s | 94.99 | |
| d1v87a_ | 114 | Deltex protein 2 RING-H2 domain {Mouse (Mus muscul | 94.31 | |
| d1g25a_ | 65 | TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 | 94.06 | |
| d1vyxa_ | 60 | IE1B protein (ORF K3), N-terminal domain {Kaposi's | 93.73 | |
| d1fbva4 | 79 | CBL {Human (Homo sapiens) [TaxId: 9606]} | 92.43 | |
| d2baya1 | 56 | Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac | 90.92 | |
| d1jm7b_ | 97 | bard1 RING domain {Human (Homo sapiens) [TaxId: 96 | 89.78 | |
| d1wila_ | 89 | Hypothetical protein KIAA1045 {Human (Homo sapiens | 89.67 | |
| d1iyma_ | 55 | EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 | 87.15 | |
| d1jm7a_ | 103 | brca1 RING domain {Human (Homo sapiens) [TaxId: 96 | 86.25 | |
| d1rmda2 | 86 | V(D)J recombination activating protein 1 (RAG1), d | 85.27 | |
| d1bora_ | 56 | Acute promyelocytic leukaemia proto-oncoprotein PM | 84.65 | |
| d1vyxa_ | 60 | IE1B protein (ORF K3), N-terminal domain {Kaposi's | 80.25 |
| >d1m4za_ b.34.12.1 (A:) Origin-recognition complex protein 120kDa subunit, Orc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: SH3-like barrel superfamily: BAH domain family: BAH domain domain: Origin-recognition complex protein 120kDa subunit, Orc1p species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=99.40 E-value=3.5e-15 Score=149.29 Aligned_cols=126 Identities=13% Similarity=0.038 Sum_probs=91.1
Q ss_pred eeeEEEEEE--CCEEEeecCEEEEecCCCCCCh--hhhhhh-----------------------hccCCCCceEEEeeee
Q 003406 684 KKFYQSCRI--GGVTYKVKDHVLLHSSNNKLMP--SKLQTM-----------------------WEDTGTGSKWVMVNRC 736 (823)
Q Consensus 684 k~~Y~~~~~--~GetyrvgDcVLl~S~~~~~~P--akI~~l-----------------------WE~~~sG~~~v~v~WY 736 (823)
++-...+.+ ||..|++||+|||+++... .+ +.|..+ |.. ..+++|..+.||
T Consensus 38 ~~~~~~~~r~~D~~e~~~GD~Vlvk~~~~~-~~~v~iI~ei~~~~~~~~~e~~~~~~lr~~e~~~~~-~~~~~~~~~~w~ 115 (217)
T d1m4za_ 38 AKTEHYLKRSSDGIKLGRGDSVVMHNEAAG-TYSVYMIQELRLNTLNNVVELWALTYLRWFEVNPLA-HYRQFNPDANIL 115 (217)
T ss_dssp --CEEEEEETTTCCEECTTCEEEEEETTTT-EEEEEEEEEEEEETTTTEEEEEEEEEECGGGSCHHH-HHHHHCHHHHHS
T ss_pred CCCcEEEEEecCCeEEecCCEEEEeCCCCC-CceEEEEeeeccCcccchheeeeecccchhhhccch-hhhhcccceeee
Confidence 333344444 9999999999999976542 32 555443 331 235678888899
Q ss_pred ccCCCCCCccCCCCCCCcccccccCCcccccccccccceEEeCcchhhhhHHHhhhcCCCCCCCCCCeEEEeeeeecccC
Q 003406 737 FFPGDLPEAVGCPCAPESNELYESNNESSVMAGLIRGPCEVLPPGKFKEENERLNHLGNEANKGRHPVFLCQWFYDELKG 816 (823)
Q Consensus 737 YrPE~t~~~~grp~~~~~NEVf~S~H~D~n~Va~IegKC~Vl~f~ry~~~~~rr~~~g~~~~~~~~p~F~Cr~~Yd~~~~ 816 (823)
|+|+++-+. +++....+||||.|+|.|++.+++|.|||.|+.+.+|+.. + .......+||||+.||+.++
T Consensus 116 ~~p~e~~~~-k~r~~~~~~ElflT~~~d~i~~~~I~~k~~V~s~~ef~~~---~------~~~~~~~~F~cr~~~D~~~~ 185 (217)
T d1m4za_ 116 NRPLNYYNK-LFSETANKNELYLTAELAELQLFNFIRVANVMDGSKWEVL---K------GNVDPERDFTVRYICEPTGE 185 (217)
T ss_dssp CCCHHHHHH-HHHHHSCTTEEEEEEEEEEECGGGEEEEEEEECHHHHHHH---G------GGCCTTTEEEEEEECCTTSC
T ss_pred cCchhhhhh-ccccccCcceeEecCccceeehhheeeeEEEecHHHhcch---h------hccCCCCeEEEEEEEcCCCC
Confidence 999874332 2334566899999999999999999999999999999422 1 11233459999999999999
Q ss_pred ccccC
Q 003406 817 VFRPV 821 (823)
Q Consensus 817 ~f~~v 821 (823)
.|.+|
T Consensus 186 ~f~~i 190 (217)
T d1m4za_ 186 KFVDI 190 (217)
T ss_dssp CCEEC
T ss_pred ceeec
Confidence 99875
|
| >d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} | Back information, alignment and structure |
|---|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} | Back information, alignment and structure |
|---|