Citrus Sinensis ID: 003423

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-
MGKKDLSEWRLDVGQYLGEISALCFVHLPSHLSSLPFLLAGSGSQVLLYDLEAGTLIRPFQVFHGIRLHGISCNFINCTEGSVSTRVTFEVALFGEKRVKLFELNFELSPNSQYQPETCVNLSLVQSLPRLSHWVFDVCFLKVCNGNRSLAIGCSDNSIRVWDISNSSIILEVHSPERCLLYSMKLWGDNLEALRIASGTIYNEIIVWKVDWEHVAPLLNSPEGNHAHGSSSDFKCFKLQDQQHTAVNLFRLVGHEGSIFRIEWSSCGSKLVSVSDDRSARIWEVRAEYWKDSDSIEEVGSSVLYGHNARVWDCCLTDSFIITAGEDCTCRVWGSDGKQLKMIKEHIGRGIWRCLYDSLSSLLVTAGFDSAIKVHQFQAFLPGSLESHPEAKEFNGRTEIFSIKIPNFSEQIRLTDSKSEYVRCLHLTSEDTLYIATNHGYLYHTKLCDMDSVNWNKILQVSEGMPIICMDLLSNEPKYPCGIDDWVALGDGKGNMTIVRVVGDVHTPQLSFTFTWSAGIERQLLGTYWCKSLGHRFIFTADPKGRLKLWQLCDPFSSVCYESSKTNNVFLVAEFSSCFGARIMCLDASFEDEVLFCGDLRGNLVLFPLLRDLLNDKSVALHVEVSPLNYFKGAHGISTVSTLSVAKLRSNQTEIRSTGGDGCICYLEYDKDRESLEFIGMKQVKELSLIQSVSAENNSIDLASCNYAAGFASTDFIIWNLITEAKVVQIPCGGWRRPHSYFLGDVPEIKNCFAYVKANQLWRLRDLCSLIWWILHQDLHNMKLYKHFLCSLFNILMILCPFPYETIDSDIFCVLFSSIFL
ccccEEEEEEcccccccEEEEEEEEEccccccccccEEEEEEcccEEEEEccccEEEEEEEEEEccEEEEEEEcccccEEEEEcccccEEEEEEcccEEEEEEEEccccccccccccEEEccccccccccccccEEEEEEEEEcccccEEEEEEcccEEEEEEccccEEEEEEcccccccEEEEEEEEcccccEEEEEEEccccEEEEEcccccEEEEEEcccccEEEEEcccccEEEEEEcccccEEEEEEEcccccEEEEEEcccccEEEEEEccccEEEEEcccccEEccccccccccEEEEEccccEEEEEEcccEEEEEEccccEEEEcccccEEEEEcccccccEEEEEEcccccEEEEEEccccEEEEEcccccccEEEcccccEEEccccccEEEEEccccccEEEcccccccEEEEEEEcccEEEEEEccccEEEEEEEEccccccEEEEEEEcccEEEEEEccccccccccccccEEEEEEccccEEEEEEEcccccccEEEEEEEEcccEEEEEEEEEEEcccccEEEEEEccccEEEEEcccccccEEEEEEEEEEEEEEEEEEcccccEEEEEEEEccccEEEEEccccEEEEEEccccccccccccEEEEEEccEEEEcccccccEEEEEEEEEcccccEEEEEEccccEEEEEEEccccEEEEEEEEcEEEEEEEEEEEEcccEEEcccccEEEEEEccEEEEEEccccEEEEEEEcccccccEEEEEcccccccEEEEEEEccEEEEEEcccccEEEEEEccccccEEEEEEEEEEEcccEEEEcccccEEEEEEEEEccccccc
ccccEEEEEEcccccEEEEEEcccccEEEEEEccccEEEEcccccEEEEEcccccEEEEEEcccccEEEEEEEEcccccEEEcccccEEEEEEcccEEEEEcccccEEEEcccccEEEEEEcccccEEEEcccccccEEEEEEcccccEEEEEccccEEEEEEcccccEEEEEEcccccEEEEEEEEEEcccccEEEEEccccEEEEEEcccccEEEEEEcccccEEEEEEcccccEEEEcccccccEEEEEEcccccEEEEEEcccccEEEEEccccEEEEEEcccccEEEccccccccEEEEEcccccEEEEEEcccEEEEcccccEEEEEEccccEEEEEEccccccEEEEEEcccccEEEEEccccEEEEEEcccccEEEccccccEEEEEcccccEEEEEEcccccEEEEcccccEEEEEEcccccEEEEEEccccEEEEEEEccccccccEEEEEEccccccEEEEEEccccccEEEEEEEEEccccEEEEEEcccccEEEEEEccccEEEEcccccEEEEEEcccccEEEEEEEcccccEEEEEcccccEEEEEcccccEEEEcccHccccccccEEEEEEcccccEEEEEccccEEEEEEccccEEEEEcccccccEEEEEEcccccEEEEccEEEEEEEccccEEEEEEccccEEEEEEEcccccEEEEccccccEEccHEEEcccccccccccccEEEEEEccccEEEEEcccccEEEEEEcccccccEEEEEEccccccEEEEEEcccEEEEEEcccccccEEEcccccccEEEEEEEEccccEEEEEEccccEccccHHEHHHHHHHcc
MGKKDLSEWRLDVGQYLGEISALCFvhlpshlsslpfllagsgsqvllydleagtlirpfqVFHGIRLHgiscnfinctegsvstRVTFEVALFGEKRVKLFELNfelspnsqyqpetcvnlslvqslprlshwvfDVCFLKVcngnrslaigcsdnsirvwdisnssiilevhspercLLYSMKLWGDNLEALRIASGTIYNEIIVWKVDwehvapllnspegnhahgsssdfkcfklqdQQHTAVNLFRLVGHEGSIFRIEwsscgsklvsvsddrSARIWEVRAEYwkdsdsieevgssvlyghnarvwdccltdsfiitagedctcrvwgsdgkqLKMIKEHIGRGIWRCLYDSLSSLLVTAGFDSAIKVHQFqaflpgsleshpeakefngrteifsikipnfseqirltdskseyvrclhltsedtlyiatnhgylyhtklcdmdsvnwnkilqvsegmpiicmdllsnepkypcgiddwvalgdgkgnmTIVRVVgdvhtpqlsftFTWSAGIERQLLGTYWckslghrfiftadpkgrlklwqlcdpfssvcyessktnNVFLVAEFSScfgarimcldasfedevlfcgdlrgnlvlFPLLRDLLNDKSVALHVevsplnyfkgahgisTVSTLSVAKLRSNqteirstggdgcicyleydkdrESLEFIGMKQVKELSLIQSVsaennsidlascnyaagfasTDFIIWNLITEAKvvqipcggwrrphsyflgdvpeikNCFAYVKANQLWRLRDLCSLIWWILHQDLHNMKLYKHFLCSLFNILMilcpfpyetidsdiFCVLFSSIFL
MGKKDLSEWRLDVGQYLGEISALCFVHLPSHLSSLPFLLAGSGSQVLLYDLEAGTLIRPFQVFHGIRLHGISCNFINCTEGSVSTRVTFEVALFGEKRVKLFELNFELSPNSQYQPETCVNLSLVQSLPRLSHWVFDVCFLKVCNGNRSlaigcsdnsirVWDISNSSIILEVHSPERCLLYSMKLWGDNLEALRIASGTIYNEIIVWKVDWEHVAPLLNSPEGNHAHGSSSDFKCFKLQDQQHTAVNLFRLVGHEGSIFRIEwsscgsklvsvsddrsaRIWEVRaeywkdsdsiEEVGSSVLYGHNARVWDCCLTDSFIITAGEDCTCRVWGSDGKQLKMIKEHIGRGIWRCLYDSLSSLLVTAGFDSAIKVHQFQAFLPGSLESHPEAKEFNGRteifsikipnfseqirltdSKSEYVRCLHLTSEDTLYIATNHGYLYHTKLCDMDSVNWNKILQVSEGMPIICMDLLSNEPKYPCGIDDWVALGDGKGNMTIVRVVGDVHTPQLSFTFTWSAGIERQLLGTYWCKSLGHRFIFTADPKGRLKLWQLCDPFSSVCYESSKTNNVFLVAEFSSCFGARIMCLDASFEDEVLFCGDLRGNLVLFPLLRDLLNDKSVALHVEVSPLNYFKGAHGISTVSTLSVAKLRSnqteirstggdgcICYLEYDKDRESLEFIGMKQVKELSLIQSVSAENNSIDLASCNYAAGFASTDFIIWNLITEAKVVQIPCGGWRRPHSYFLGDVPEIKNCFAYVKANQLWRLRDLCSLIWWILHQDLHNMKLYKHFLCSLFNILMILCPFPYETIDSDIFCVLFSSIFL
MGKKDLSEWRLDVGQYLGEISALCFVhlpshlsslpfllAGSGSQVLLYDLEAGTLIRPFQVFHGIRLHGISCNFINCTEGSVSTRVTFEVALFGEKRVKLFELNFELSPNSQYQPETCVNLSLVQSLPRLSHWVFDVCFLKVCNGNRSLAIGCSDNSIRVWDISNSSIILEVHSPERCLLYSMKLWGDNLEALRIASGTIYNEIIVWKVDWEHVAPLLNSPEGNHAHGSSSDFKCFKLQDQQHTAVNLFRLVGHEGSIFRIEWSSCGSKLVSVSDDRSARIWEVRAEYWKDSDSIEEVGSSVLYGHNARVWDCCLTDSFIITAGEDCTCRVWGSDGKQLKMIKEHIGRGIWRCLYDSLSSLLVTAGFDSAIKVHQFQAFLPGSLESHPEAKEFNGRTEIFSIKIPNFSEQIRLTDSKSEYVRCLHLTSEDTLYIATNHGYLYHTKLCDMDSVNWNKILQVSEGMPIICMDLLSNEPKYPCGIDDWVALGDGKGNMTIVRVVGDVHTPQLSFTFTWSAGIERQLLGTYWCKSLGHRFIFTADPKGRLKLWQLCDPFSSVCYESSKTNNVFLVAEFSSCFGARIMCLDASFEDEVLFCGDLRGNLVLFPLLRDLLNDKSVALHVEVSPLNYFKGAHGISTVSTLSVAKLRSNQTEIRSTGGDGCICYLEYDKDRESLEFIGMKQVKELSLIQSVSAENNSIDLASCNYAAGFASTDFIIWNLITEAKVVQIPCGGWRRPHSYFLGDVPEIKNCFAYVKANQLWRLRDLCSLIWWILHQDLHNMKLYKHFLCSLFNILMILCPFPYETIDSDIFCVLFSSIFL
*******EWRLDVGQYLGEISALCFVHLPSHLSSLPFLLAGSGSQVLLYDLEAGTLIRPFQVFHGIRLHGISCNFINCTEGSVSTRVTFEVALFGEKRVKLFELNFELSPNSQYQPETCVNLSLVQSLPRLSHWVFDVCFLKVCNGNRSLAIGCSDNSIRVWDISNSSIILEVHSPERCLLYSMKLWGDNLEALRIASGTIYNEIIVWKVDWEHVAPLLN*************FKCFKLQDQQHTAVNLFRLVGHEGSIFRIEWSSCGSKLVSVSDDRSARIWEVRAEYWKDSDSIEEVGSSVLYGHNARVWDCCLTDSFIITAGEDCTCRVWGSDGKQLKMIKEHIGRGIWRCLYDSLSSLLVTAGFDSAIKVHQFQAFLPGSL********FNGRTEIFSIKIPNFSEQIRLTDSKSEYVRCLHLTSEDTLYIATNHGYLYHTKLCDMDSVNWNKILQVSEGMPIICMDLLSNEPKYPCGIDDWVALGDGKGNMTIVRVVGDVHTPQLSFTFTWSAGIERQLLGTYWCKSLGHRFIFTADPKGRLKLWQLCDPFSSVCYESSKTNNVFLVAEFSSCFGARIMCLDASFEDEVLFCGDLRGNLVLFPLLRDLLNDKSVALHVEVSPLNYFKGAHGISTVSTLSVAKLRSNQTEIRSTGGDGCICYLEYDKDRESLEFIGMKQVKELSLIQSVSAENNSIDLASCNYAAGFASTDFIIWNLITEAKVVQIPCGGWRRPHSYFLGDVPEIKNCFAYVKANQLWRLRDLCSLIWWILHQDLHNMKLYKHFLCSLFNILMILCPFPYETIDSDIFCVLFSSIF*
MGKKDLSEWRLDVGQYLGEISALCFVHLPSHLSSLPFLLAGSGSQVLLYDLEAGTLIRPFQVFHGIRLHGISCNFINCTEGSVSTRVTFEVALFGEKRVKLFELNFELSPNSQYQPETCVNLSLVQSLPRLSHWVFDVCFLKVCNGNRSLAIGCSDNSIRVWDISNSSIILEVHSPERCLLYSMKLWGDNLEALRIASGTIYNEIIVWKVDWEHVAPLLNSPEGNHAHGSSSDFKCFKLQDQQHTAVNLFRLVGHEGSIFRIEWSSCGSKLVSVSDDRSARIWEVRAEYWKDSDSIEEVGSSVLYGHNARVWDCCLTDSFIITAGEDCTCRVWGSDGKQLKMIKEHIGRGIWRCLYDSLSSLLVTAGFDSAIKVHQFQAFLPGSLESHPEAKEFNGRTEIFSIKIPNFSE*IR**DSKSEYVRCLHLTSEDTLYIATNHGYLYHTKLCDMDSVNWNKILQVSEGMPIICMDLLSNEPKYPCGIDDWVALGDGKGNMTIVRVVGDVHTPQLSFTFTWSAGIERQLLGTYWCKSLGHRFIFTADPKGRLKLWQLCDPFSSVCYESSKTNNVFLVAEFSSCFGARIMCLDASFEDEVLFCGDLRGNLVLFPLLRDLLNDKSVALHVEVSPLNYFKGAHGISTVSTLSVAKLRSNQTEIRSTGGDGCICYLEYDKDRESLEFIGMKQVKELSLIQSVSAENNSIDLASCNYAAGFASTDFIIWNLITEAKVVQIPCGGWRRPHSYFLGDVPEIKNCFAYVKANQLWRLRDLCSLIWWILHQDLHNMKLYKHFLCSLFNILMILCPFPYETIDSDIFCVLFSSIFL
MGKKDLSEWRLDVGQYLGEISALCFVHLPSHLSSLPFLLAGSGSQVLLYDLEAGTLIRPFQVFHGIRLHGISCNFINCTEGSVSTRVTFEVALFGEKRVKLFELNFELSPNSQYQPETCVNLSLVQSLPRLSHWVFDVCFLKVCNGNRSLAIGCSDNSIRVWDISNSSIILEVHSPERCLLYSMKLWGDNLEALRIASGTIYNEIIVWKVDWEHVAPLLNSPE*********DFKCFKLQDQQHTAVNLFRLVGHEGSIFRIEWSSCGSKLVSVSDDRSARIWEVRAEYWKDSDSIEEVGSSVLYGHNARVWDCCLTDSFIITAGEDCTCRVWGSDGKQLKMIKEHIGRGIWRCLYDSLSSLLVTAGFDSAIKVHQFQAFLPGSLESHPEAKEFNGRTEIFSIKIPNFSEQIRLTDSKSEYVRCLHLTSEDTLYIATNHGYLYHTKLCDMDSVNWNKILQVSEGMPIICMDLLSNEPKYPCGIDDWVALGDGKGNMTIVRVVGDVHTPQLSFTFTWSAGIERQLLGTYWCKSLGHRFIFTADPKGRLKLWQLCDPFSSVCYESSKTNNVFLVAEFSSCFGARIMCLDASFEDEVLFCGDLRGNLVLFPLLRDLLNDKSVALHVEVSPLNYFKGAHGISTVSTLSVAKLRSNQTEIRSTGGDGCICYLEYDKDRESLEFIGMKQVKELSLIQSVSAENNSIDLASCNYAAGFASTDFIIWNLITEAKVVQIPCGGWRRPHSYFLGDVPEIKNCFAYVKANQLWRLRDLCSLIWWILHQDLHNMKLYKHFLCSLFNILMILCPFPYETIDSDIFCVLFSSIFL
*GKKDLSEWRLDVGQYLGEISALCFVHLPSHLSSLPFLLAGSGSQVLLYDLEAGTLIRPFQVFHGIRLHGISCNFINCTEGSVSTRVTFEVALFGEKRVKLFELNFELSPNSQYQPETCVNLSLVQSLPRLSHWVFDVCFLKVCNGNRSLAIGCSDNSIRVWDISNSSIILEVHSPERCLLYSMKLWGDNLEALRIASGTIYNEIIVWKVDWEHVAPLLNSPEGNHAHGSSSDFKCFKLQDQQHTAVNLFRLVGHEGSIFRIEWSSCGSKLVSVSDDRSARIWEVRAEYWKDSDSIEEVGSSVLYGHNARVWDCCLTDSFIITAGEDCTCRVWGSDGKQLKMIKEHIGRGIWRCLYDSLSSLLVTAGFDSAIKVHQFQAFLPGSLESHPEAKEFNGRTEIFSIKIPNFSEQIRLTDSKSEYVRCLHLTSEDTLYIATNHGYLYHTKLCDMDSVNWNKILQVSEGMPIICMDLLSNEPKYPCGIDDWVALGDGKGNMTIVRVVGDVHTPQLSFTFTWSAGIERQLLGTYWCKSLGHRFIFTADPKGRLKLWQLCDPFSSVCYESSKTNNVFLVAEFSSCFGARIMCLDASFEDEVLFCGDLRGNLVLFPLLRDLLNDKSVALHVEVSPLNYFKGAHGISTVSTLSVAKLRSNQTEIRSTGGDGCICYLEYDKDRESLEFIGMKQVKELSLIQSVSAENNSIDLASCNYAAGFASTDFIIWNLITEAKVVQIPCGGWRRPHSYFLGDVPEIKNCFAYVKANQLWRLRDLCSLIWWILHQDLHNMKLYKHFLCSLFNILMILCPFPYETIDSDIFCVLFSSIFL
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhoooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGKKDLSEWRLDVGQYLGEISALCFVHLPSHLSSLPFLLAGSGSQVLLYDLEAGTLIRPFQVFHGIRLHGISCNFINCTEGSVSTRVTFEVALFGEKRVKLFELNFELSPNSQYQPETCVNLSLVQSLPRLSHWVFDVCFLKVCNGNRSLAIGCSDNSIRVWDISNSSIILEVHSPERCLLYSMKLWGDNLEALRIASGTIYNEIIVWKVDWEHVAPLLNSPEGNHAHGSSSDFKCFKLQDQQHTAVNLFRLVGHEGSIFRIEWSSCGSKLVSVSDDRSARIWEVRAEYWKDSDSIEEVGSSVLYGHNARVWDCCLTDSFIITAGEDCTCRVWGSDGKQLKMIKEHIGRGIWRCLYDSLSSLLVTAGFDSAIKVHQFQAFLPGSLESHPEAKEFNGRTEIFSIKIPNFSEQIRLTDSKSEYVRCLHLTSEDTLYIATNHGYLYHTKLCDMDSVNWNKILQVSEGMPIICMDLLSNEPKYPCGIDDWVALGDGKGNMTIVRVVGDVHTPQLSFTFTWSAGIERQLLGTYWCKSLGHRFIFTADPKGRLKLWQLCDPFSSVCYESSKTNNVFLVAEFSSCFGARIMCLDASFEDEVLFCGDLRGNLVLFPLLRDLLNDKSVALHVEVSPLNYFKGAHGISTVSTLSVAKLRSNQTEIRSTGGDGCICYLEYDKDRESLEFIGMKQVKELSLIQSVSAENNSIDLASCNYAAGFASTDFIIWNLITEAKVVQIPCGGWRRPHSYFLGDVPEIKNCFAYVKANQLWRLRDLCSLIWWILHQDLHNMKLYKHFLCSLFNILMILCPFPYETIDSDIFCVLFSSIFL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query821 2.2.26 [Sep-21-2011]
A7Z052 1124 WD repeat-containing prot yes no 0.790 0.577 0.235 3e-36
Q9NNW5 1121 WD repeat-containing prot yes no 0.796 0.583 0.235 3e-36
Q5RB07 1121 WD repeat-containing prot yes no 0.796 0.583 0.233 1e-35
Q99ME2 1125 WD repeat-containing prot yes no 0.784 0.572 0.238 4e-32
Q5XFW6 1125 WD repeat-containing prot yes no 0.790 0.576 0.239 1e-31
Q08924 1013 Regulator of Ty1 transpos yes no 0.322 0.261 0.241 2e-16
Q9USZ0 984 Uncharacterized WD repeat yes no 0.239 0.200 0.268 9e-13
Q09715614 Transcriptional repressor no no 0.257 0.343 0.226 4e-07
Q3Y8L7446 Outer row dynein assembly N/A no 0.220 0.405 0.257 8e-07
Q6CG48437 Nuclear distribution prot no no 0.215 0.405 0.267 8e-07
>sp|A7Z052|WDR6_BOVIN WD repeat-containing protein 6 OS=Bos taurus GN=WDR6 PE=2 SV=1 Back     alignment and function desciption
 Score =  154 bits (389), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 181/770 (23%), Positives = 311/770 (40%), Gaps = 121/770 (15%)

Query: 38  LLAGSGSQVLLYDLEAGTLIRPFQVFHGIRLHGISCNFINCTEGSVSTRVTFEVALFGEK 97
           LLAG G  VL+Y L+ G  +R  +    +  H +   F    E +        VA FG K
Sbjct: 31  LLAGEGPDVLVYTLDFGGHLRMMKRVQNLLGHYLIHGFRVRPEPNGDLDSEVMVAAFGSK 90

Query: 98  RVKLFELNFELSPNSQYQPETCVNLSLVQSLPRLSHWVFDVCFLKVCNGNRSLAIGCSDN 157
            +++ ++++      +       N+S          W++D  +L+   GN +LA+G   N
Sbjct: 91  GLRIVKISWGQGRFRELWRSGLWNMS---------DWIWDARWLE---GNIALALG--HN 136

Query: 158 SIRVWDISNSSIILEVHSPERCLLYSMKLWGDNLEALRIASGTIYNEIIVWKVDWEHVAP 217
           S+ ++D      + +V   +RC L S  L GD  + L + +G + N+++VW         
Sbjct: 137 SVVLYDPVVGCSLQDVPCTDRCTLSSACLIGDTWKELTVVAGAVSNQLLVW--------- 187

Query: 218 LLNSPEGNHAHGSSSDFKCFKLQDQQHTAVNLFRLVGHEGSIFRIEWSSCGSKLVSVSDD 277
                           +    L D +   V   R+ GH G IF + +      L + S+D
Sbjct: 188 ----------------YPAAALTDDK-PVVPDRRVSGHVGVIFSMSYLESKGLLATASED 230

Query: 278 RSARIWEVRAEYWKDSDSIEEVGSSVLYGHNARVWDCCLTDSFIITAGEDCTCRVWGSDG 337
           RS RIW+V  +       ++ +G    +GH+ARVW   L ++++I+AGEDC C VW  +G
Sbjct: 231 RSVRIWKV-GDLRVPGGRVQNIGHC--FGHSARVWQVKLLENYLISAGEDCVCLVWSHEG 287

Query: 338 KQLKMIKEHIGRGIWRCLYDSLSSLLVTAGFDSAIKVHQFQAFLPGSLESHPEAKEFNGR 397
           + L+  + H GRGI         + ++T G DS I++             HP +  F   
Sbjct: 288 EILQAFRGHQGRGIRALAAHERQAWVITGGDDSGIRLWHLVG------RGHPGSGVF--- 338

Query: 398 TEIFSIKIPNFSEQIRLTDSKSEYVRCLHLTSEDTLYIATNHGYLYHTKLCDMDSVNWNK 457
               S K          + S+   ++ + L     +   T+ G LY   L D++   W +
Sbjct: 339 --ALSFK----------SHSRPGVLKAVTLAGSWRVLAVTDAGALY---LYDLEVKCWEQ 383

Query: 458 ILQVSEGMPIICMDLLSNEPKYPCGIDDWVALGDGKGNMTIVRVVGDVHTPQLSFTFTWS 517
           +L+  +     C  LL   P  P G     AL +G+G + +V     ++TP  +   T  
Sbjct: 384 LLE-DKRFQSYC--LLEAAPG-PEGF-GLCALANGEGRVKVV----PINTPTAAVDLTLF 434

Query: 518 AGIERQLLGTYWCKSLGHRFIFTADPKGRLKLWQLCDPFSSVCYESSKTNNVFLVAEFSS 577
            G    L  ++  +      +  + P G +   ++    S       +     L      
Sbjct: 435 PGKVHSL--SWALRGYEELLLLASGPGGVVACLEISAAPSGKAIFVKERCRYLLPPSKQR 492

Query: 578 CFGARIMCLDASFEDEVLFCGDLRGNLVLFPLLRDLLNDKSVALHV-------------- 623
                       F    L CGD RG+++L+P   DLL D  V   V              
Sbjct: 493 WHTCSAFLPPGDF----LVCGDRRGSVLLYPSRPDLLKDLGVVSKVGAITSAPGAGSGEG 548

Query: 624 -----EVSPLNYFKGAHGISTVSTLSVAKLRSNQTEIRSTGGDGCICYLEYDKDRESLEF 678
                E  P++     HG   V++++      +   + +TG DG   Y  + +  +    
Sbjct: 549 EPSLAEWGPMSTLPSLHGKQGVTSVTC-----HGGYVYTTGRDGSY-YQLFVRGGQLQPV 602

Query: 679 IGMKQVKELSLIQSVS--AENNSIDLASCNYAAGFASTDFIIWNLITEAKVVQIPCGGWR 736
           +  K  + ++ +  V   A+ N + L       GF + +F++W+  +  K+  I CGG  
Sbjct: 603 LRQKPCRGMNWVAGVRMVADGNMVIL-------GFHANEFVVWSPRSHEKLHIINCGGGH 655

Query: 737 RPHSYFLGDVPEIKNCFAYVKAN--QLWRLRDLCSLIWWILHQDLHNMKL 784
           R  S+   D  E    FAY+K     L+R    C+    IL + LH  ++
Sbjct: 656 R--SWAFSDT-EAAMAFAYLKDGDVMLYRALGGCTRPHVILRESLHGREI 702
Enhances the STK11/LKB1-induced cell growth suppression activity.
Bos taurus (taxid: 9913)
>sp|Q9NNW5|WDR6_HUMAN WD repeat-containing protein 6 OS=Homo sapiens GN=WDR6 PE=1 SV=1 Back     alignment and function description
>sp|Q5RB07|WDR6_PONAB WD repeat-containing protein 6 OS=Pongo abelii GN=WDR6 PE=2 SV=1 Back     alignment and function description
>sp|Q99ME2|WDR6_MOUSE WD repeat-containing protein 6 OS=Mus musculus GN=Wdr6 PE=2 SV=1 Back     alignment and function description
>sp|Q5XFW6|WDR6_RAT WD repeat-containing protein 6 OS=Rattus norvegicus GN=Wdr6 PE=1 SV=2 Back     alignment and function description
>sp|Q08924|WDR6_YEAST Regulator of Ty1 transposition protein 10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RTT10 PE=1 SV=1 Back     alignment and function description
>sp|Q9USZ0|WDR6_SCHPO Uncharacterized WD repeat-containing protein C1306.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1306.02 PE=3 SV=1 Back     alignment and function description
>sp|Q09715|TUP11_SCHPO Transcriptional repressor tup11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup11 PE=1 SV=1 Back     alignment and function description
>sp|Q3Y8L7|WDR69_CHLRE Outer row dynein assembly protein 16 OS=Chlamydomonas reinhardtii GN=ODA16 PE=1 SV=1 Back     alignment and function description
>sp|Q6CG48|LIS1_YARLI Nuclear distribution protein PAC1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PAC1 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query821
359479974 1404 PREDICTED: uncharacterized protein LOC10 0.911 0.532 0.627 0.0
297744046 1324 unnamed protein product [Vitis vinifera] 0.886 0.549 0.620 0.0
224064722 1455 predicted protein [Populus trichocarpa] 0.936 0.528 0.595 0.0
255548301 1385 nucleotide binding protein, putative [Ri 0.946 0.561 0.614 0.0
356571019 1377 PREDICTED: uncharacterized protein LOC10 0.945 0.563 0.559 0.0
297809977 1307 transducin family protein [Arabidopsis l 0.904 0.568 0.550 0.0
449461733 1371 PREDICTED: uncharacterized protein LOC10 0.931 0.557 0.555 0.0
449511518 1079 PREDICTED: WD repeat-containing protein 0.931 0.708 0.554 0.0
22328224 1308 transducin/WD40 domain-containing protei 0.897 0.563 0.546 0.0
4558555 1216 hypothetical protein [Arabidopsis thalia 0.812 0.548 0.552 0.0
>gi|359479974|ref|XP_002273071.2| PREDICTED: uncharacterized protein LOC100257191 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  980 bits (2533), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 479/763 (62%), Positives = 588/763 (77%), Gaps = 15/763 (1%)

Query: 7   SEWRLDVGQYLGEISALCFVHLPS--HLSSLPFLLAGSGSQVLLYDLEAGTLIRPFQVFH 64
           SEWRL  G YLGEISALC +H P   H SSLP+LLAG+GSQVLLYDLE+  ++R F V  
Sbjct: 5   SEWRLHGGHYLGEISALCLIHAPPLPHFSSLPYLLAGTGSQVLLYDLESVKILRSFHVLE 64

Query: 65  GIRLHGISCNFINCTEGSVSTRVTFEVALFGEKRVKLFELNFELSPNSQYQPETCVNLSL 124
           GIR+HGI+C  ++C EGSV   ++ ++A+FGE+RVKLF L  E+ P SQ +P+ C+ L+L
Sbjct: 65  GIRVHGIACRLVDCKEGSV---LSVKIAVFGERRVKLFNLRIEMVPESQDEPQVCLELTL 121

Query: 125 VQSLPRLSHWVFDVCFLK--VCNGNRSLAIGCSDNSIRVWDISNSSIILEVHSPERCLLY 182
           + SLP+ SHWV DVCF K  +   +  L +GCSDNS+ +WD+  SS ILEV +PERCLLY
Sbjct: 122 LHSLPKFSHWVLDVCFFKEDIATSSHCLVVGCSDNSVHLWDMLTSSSILEVRNPERCLLY 181

Query: 183 SMKLWGDNLEALRIASGTIYNE-IIVWKVDWEHVAPLLNSPEGNHAHGSSSDFKCFKLQD 241
           SM+LWGD L+ L +ASGTIYNE IIVWK   ++  P L S   +H + SSS    F    
Sbjct: 182 SMRLWGDELQNLLVASGTIYNEVIIVWKAVPQNCTPSLGSSVKDHINSSSSFCNGFNHYS 241

Query: 242 QQHTAVNLFRLVGHEGSIFRIEWSSCGSKLVSVSDDRSARIWEVRAE--YWKDSDSIEEV 299
           QQ+ A+N+ RL GHEGSIFR+ WSS GSKLVSVSDDRSARIW + AE     +S  I + 
Sbjct: 242 QQYQALNICRLAGHEGSIFRLAWSSNGSKLVSVSDDRSARIWPIHAEREVSDNSGEIVDT 301

Query: 300 GSS--VLYGHNARVWDCCLTDSFIITAGEDCTCRVWGSDGKQLKMIKEHIGRGIWRCLYD 357
           GS+  VL+GHNAR+WDCC+ DS I+TAGEDCTCRVWG+DG QLKMIKEHIGRG+WRCLYD
Sbjct: 302 GSAGPVLFGHNARIWDCCILDSLIVTAGEDCTCRVWGTDGNQLKMIKEHIGRGVWRCLYD 361

Query: 358 SLSSLLVTAGFDSAIKVHQFQAFLPGSLESH-PEAKEFNGRTEIFSIKIPNFSEQIRLTD 416
              SLLVTAGFDSAIKVHQ QA LP + +    E KE   RTEIF++ IPN SE   L D
Sbjct: 362 PKFSLLVTAGFDSAIKVHQLQASLPKAPQEQVAEVKELIDRTEIFTVCIPNSSEHTGLMD 421

Query: 417 SKSEYVRCLHLTSEDTLYIATNHGYLYHTKLCDMDSVNWNKILQVSEGMPIICMDLLS-N 475
           SKSEYVR L  T E++LY++TN GYLYH KL D   V W ++++VSE +PI+CMDLLS N
Sbjct: 422 SKSEYVRSLRFTCENSLYVSTNRGYLYHAKLFDTGDVKWTELIRVSEEVPIVCMDLLSRN 481

Query: 476 EPKYPCGIDDWVALGDGKGNMTIVRVVGDVHTPQLSFTFTWSAGIERQLLGTYWCKSLGH 535
            PK   G++DW+A+GDGKGNMT+  +V D+  P++  T+TWSAGIERQLLGT+WCKSLG+
Sbjct: 482 GPKLSSGVEDWIAVGDGKGNMTVTGIVSDLCPPKVGLTYTWSAGIERQLLGTFWCKSLGY 541

Query: 536 RFIFTADPKGRLKLWQLCDPFSSVCYESSKTNNVFLVAEFSSCFGARIMCLDASFEDEVL 595
           R+IFTADP+G+LKLW+LC+P  S    S+ +NNV L+AEF S F  RIMCLDAS E+EVL
Sbjct: 542 RYIFTADPRGKLKLWRLCNPSQSASQNSAISNNVSLIAEFISSFNIRIMCLDASSEEEVL 601

Query: 596 FCGDLRGNLVLFPLLRDLLNDKSVALHVEVSPLNYFKGAHGISTVSTLSVAKLRSNQTEI 655
            CGDLRGNL+L+PLLR +L   S    V+++PL YFKGAHGIS+VS +S+A   SNQ EI
Sbjct: 602 ICGDLRGNLILYPLLRSILVGSSFGSEVKITPLTYFKGAHGISSVSGISIAGFVSNQIEI 661

Query: 656 RSTGGDGCICYLEYDKDRESLEFIGMKQVKELSLIQSVSAENNSI-DLASCNYAAGFAST 714
           +STGGDGCICYLEY +DR++L+FIGMK+VKELSL+QSVS+  +S+ DL S  YA GFAST
Sbjct: 662 QSTGGDGCICYLEYRRDRQNLQFIGMKRVKELSLVQSVSSGADSVDDLTSSKYAIGFAST 721

Query: 715 DFIIWNLITEAKVVQIPCGGWRRPHSYFLGDVPEIKNCFAYVK 757
           DFIIWNLITE KVVQ+PCGGWRRPHSY+LGDVPE++NCFAYVK
Sbjct: 722 DFIIWNLITETKVVQVPCGGWRRPHSYYLGDVPEMRNCFAYVK 764

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|297744046|emb|CBI37016.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224064722|ref|XP_002301542.1| predicted protein [Populus trichocarpa] gi|222843268|gb|EEE80815.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255548301|ref|XP_002515207.1| nucleotide binding protein, putative [Ricinus communis] gi|223545687|gb|EEF47191.1| nucleotide binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356571019|ref|XP_003553679.1| PREDICTED: uncharacterized protein LOC100780968 [Glycine max] Back     alignment and taxonomy information
>gi|297809977|ref|XP_002872872.1| transducin family protein [Arabidopsis lyrata subsp. lyrata] gi|297318709|gb|EFH49131.1| transducin family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|449461733|ref|XP_004148596.1| PREDICTED: uncharacterized protein LOC101207681 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449511518|ref|XP_004163977.1| PREDICTED: WD repeat-containing protein 6-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|22328224|ref|NP_192095.2| transducin/WD40 domain-containing protein [Arabidopsis thaliana] gi|30678983|ref|NP_849536.1| transducin/WD40 domain-containing protein [Arabidopsis thaliana] gi|19699003|gb|AAL91237.1| unknown protein [Arabidopsis thaliana] gi|32306503|gb|AAP78935.1| At4g01860 [Arabidopsis thaliana] gi|332656686|gb|AEE82086.1| transducin/WD40 domain-containing protein [Arabidopsis thaliana] gi|332656687|gb|AEE82087.1| transducin/WD40 domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|4558555|gb|AAD22648.1|AC007138_12 hypothetical protein [Arabidopsis thaliana] gi|7268570|emb|CAB80679.1| hypothetical protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query821
TAIR|locus:2141395 1308 AT4G01860 "AT4G01860" [Arabido 0.649 0.407 0.573 3.7e-167
UNIPROTKB|A7Z052 1124 WDR6 "WD repeat-containing pro 0.159 0.116 0.355 6e-30
RGD|1307649 1125 Wdr6 "WD repeat domain 6" [Rat 0.158 0.115 0.350 8e-27
UNIPROTKB|E9PDU5 1070 WDR6 "WD repeat-containing pro 0.147 0.113 0.354 5.8e-22
UNIPROTKB|Q9NNW5 1121 WDR6 "WD repeat-containing pro 0.147 0.107 0.354 6.5e-22
UNIPROTKB|E2RQM6 1119 WDR6 "Uncharacterized protein" 0.213 0.156 0.331 1.1e-20
MGI|MGI:1930140 1125 Wdr6 "WD repeat domain 6" [Mus 0.219 0.16 0.304 6.8e-19
UNIPROTKB|F1SKI8 1019 WDR6 "Uncharacterized protein" 0.159 0.128 0.355 5.7e-18
POMBASE|SPBC1306.02 984 rtt10 "WD repeat protein, huma 0.137 0.114 0.357 4.4e-13
SGD|S000006104 1013 RTT10 "WD40 domain-containing 0.141 0.114 0.338 5.7e-12
TAIR|locus:2141395 AT4G01860 "AT4G01860" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1626 (577.4 bits), Expect = 3.7e-167, P = 3.7e-167
 Identities = 321/560 (57%), Positives = 401/560 (71%)

Query:   241 DQQH-TAVNLFRLVGHEGSIFRIEWSSCGSKLVSVSDDRSARIWEVRAEYWKDSDSIEEV 299
             D  H +A ++ RL GHEGSIFRI WS  GSK+VSVSDDRSARIWE+        DS E V
Sbjct:   219 DHGHYSASHMLRLTGHEGSIFRIVWSLDGSKIVSVSDDRSARIWEI--------DSQEVV 270

Query:   300 GSSVLYGHNARVWDCCLTDSFIITAGEDCTCRVWGSDGKQLKMIKEHIGRGIWRCLYDSL 359
             G  VL+GH+ RVWDCC++DS I+TAGEDCTCRVWG DG QL++IKEHIGRGIWRCLYD  
Sbjct:   271 GP-VLFGHSVRVWDCCISDSLIVTAGEDCTCRVWGVDGTQLEVIKEHIGRGIWRCLYDPN 329

Query:   360 SSLLVTAGFDSAIKVHQFQAFLPGSLESHPEAKEFNG--RTEIFSIKIPNFSEQIRLTDS 417
             SSLLVTAGFDSAIKVHQ      GS  S       N   + E FS  +PN ++   LTDS
Sbjct:   330 SSLLVTAGFDSAIKVHQLHN--RGSETSLDAVGVLNSPDKLEYFSTCLPNSTKHTGLTDS 387

Query:   418 KSEYVRCLHLTSEDTLYIATNHGYLYHTKLCDMDSVNWNKILQVSEGMPIICMDLLSN-E 476
             KSEYVRCL  T EDT+Y+ATNHG LYH +L    +V W +++++ E  PII MD++S  +
Sbjct:   388 KSEYVRCLQFTQEDTIYVATNHGCLYHARLLSSGNVRWTELVRIPEEGPIITMDVMSGGK 447

Query:   477 PKYPCGIDDWVALGDGKGNMTIVRVVGDVHTPQLSFTFTWSAGIERQLLGTYWCKSLGHR 536
              +  C +DDWVALGDGKGNMTIVRV+GD++ P      +W A  ERQLLG +WCKSLG+R
Sbjct:   448 VRESCALDDWVALGDGKGNMTIVRVIGDMYNPHAGLNQSWKASPERQLLGAFWCKSLGYR 507

Query:   537 FIFTADPKGRLKLWQLCDPFSSVCYESSKTNNVFLVAEFSSCFGARIMCLDASFEDEVLF 596
             F+F+ +P+G LKLW+L     S    +++T +V L+AEFSS FG RIMC+DAS EDEV+ 
Sbjct:   508 FVFSCNPRGLLKLWKLSGSLES----AAETYDVSLLAEFSSGFGKRIMCVDASVEDEVIL 563

Query:   597 CGDLRGNLVLFPLLRDLLNDKSVALHVEVSPLNYFKGAHGISTVSTLSVAKLRSNQTEIR 656
             CGDLRGN+ LFPL +D+L+  SV+  +++  L YFKGAHGISTVS+LSVA+L SN+ EI 
Sbjct:   564 CGDLRGNITLFPLTKDMLHGVSVSSELKIPSLKYFKGAHGISTVSSLSVARLTSNKAEIC 623

Query:   657 STGGDGCICYLEYDKDRESLEFIGMKQVKELSLIQSV-SAENNSIDLASCNYAAGFASTD 715
             STG DGCICY EYD++ ++LEF+G+KQ+KEL+L+QSV      S D  + +YAAGFASTD
Sbjct:   624 STGADGCICYFEYDREMQTLEFMGLKQLKELNLVQSVCQGVQFSEDHPNNDYAAGFASTD 683

Query:   716 FIIWNLITEAKVVQIPCGGWRRPHSYFLGDVPEIKNCFAYVKANQL-----WRLRDLCSL 770
             FI+WNL  E KV QI CGGWRRPHS++LG++PE +NCFAYVK + +     W       +
Sbjct:   684 FILWNLTAETKVTQISCGGWRRPHSFYLGEIPEWQNCFAYVKDDVIHIHRHWVGGQKTKV 743

Query:   771 IWWILHQDLHNMKLYKHFLC 790
                 LH   H  +L  H LC
Sbjct:   744 FPLNLHTQFHGREL--HSLC 761
GO:0000166 "nucleotide binding" evidence=ISS
GO:0005737 "cytoplasm" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0080008 "Cul4-RING ubiquitin ligase complex" evidence=ISS
UNIPROTKB|A7Z052 WDR6 "WD repeat-containing protein 6" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|1307649 Wdr6 "WD repeat domain 6" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E9PDU5 WDR6 "WD repeat-containing protein 6" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q9NNW5 WDR6 "WD repeat-containing protein 6" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2RQM6 WDR6 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:1930140 Wdr6 "WD repeat domain 6" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1SKI8 WDR6 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
POMBASE|SPBC1306.02 rtt10 "WD repeat protein, human WDR6 family, involved in endocytic recycling" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
SGD|S000006104 RTT10 "WD40 domain-containing protein involved in endosomal recycling" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query821
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 5e-18
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 3e-14
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 2e-12
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 4e-12
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 8e-12
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 2e-10
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 3e-07
smart0032040 smart00320, WD40, WD40 repeats 1e-04
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 3e-04
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 5e-04
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information 
 Score = 85.1 bits (211), Expect = 5e-18
 Identities = 60/265 (22%), Positives = 95/265 (35%), Gaps = 50/265 (18%)

Query: 132 SHWVFDVCFLKVCNGNRSLAIGCSDNSIRVWDISNSSII--LEVH-SPERCLLYSMKLWG 188
           +  V DV           LA G SD +IR+WD+     +  L  H S    + +S     
Sbjct: 51  TGPVRDV---AASADGTYLASGSSDKTIRLWDLETGECVRTLTGHTSYVSSVAFS----- 102

Query: 189 DNLEALRIASGTIY-NEIIVWKVDWE--------HVAPLLN---SPEGNHAHGSSSDFKC 236
                 RI S +     I VW V+          H   + +   SP+G     SS D   
Sbjct: 103 ---PDGRILSSSSRDKTIKVWDVETGKCLTTLRGHTDWVNSVAFSPDGTFVASSSQD-GT 158

Query: 237 FKLQDQQHTAVNLFRLV----GHEGSIFRIEWSSCGSKLVSVSDDRSARIWEVRAEYWKD 292
            KL D     +   + V    GH G +  + +S  G KL+S S D + ++W++       
Sbjct: 159 IKLWD-----LRTGKCVATLTGHTGEVNSVAFSPDGEKLLSSSSDGTIKLWDLSTGKCLG 213

Query: 293 SDSIEEVGSSVLYGHNARVWDCCLTDS--FIITAGEDCTCRVW-GSDGKQLKMIKEHIGR 349
                      L GH   V     +     + +  ED T RVW    G+ ++ +  H   
Sbjct: 214 ----------TLRGHENGVNSVAFSPDGYLLASGSEDGTIRVWDLRTGECVQTLSGHTNS 263

Query: 350 GIWRCLYDSLSSLLVTAGFDSAIKV 374
            +    +      L +   D  I++
Sbjct: 264 -VTSLAWSPDGKRLASGSADGTIRI 287

Length = 289
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 821
KOG0318603 consensus WD40 repeat stress protein/actin interac 100.0
KOG0319775 consensus WD40-repeat-containing subunit of the 18 100.0
KOG0974 967 consensus WD-repeat protein WDR6, WD repeat superf 100.0
KOG0271480 consensus Notchless-like WD40 repeat-containing pr 100.0
KOG0319775 consensus WD40-repeat-containing subunit of the 18 100.0
KOG0318603 consensus WD40 repeat stress protein/actin interac 100.0
KOG0291 893 consensus WD40-repeat-containing subunit of the 18 100.0
KOG0306 888 consensus WD40-repeat-containing subunit of the 18 100.0
KOG0306888 consensus WD40-repeat-containing subunit of the 18 100.0
KOG0271480 consensus Notchless-like WD40 repeat-containing pr 100.0
KOG0291 893 consensus WD40-repeat-containing subunit of the 18 100.0
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 100.0
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 100.0
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 100.0
KOG0286343 consensus G-protein beta subunit [General function 100.0
KOG0292 1202 consensus Vesicle coat complex COPI, alpha subunit 100.0
KOG0279315 consensus G protein beta subunit-like protein [Sig 100.0
KOG1408 1080 consensus WD40 repeat protein [Function unknown] 100.0
KOG0315311 consensus G-protein beta subunit-like protein (con 100.0
KOG0276 794 consensus Vesicle coat complex COPI, beta' subunit 100.0
KOG2106626 consensus Uncharacterized conserved protein, conta 100.0
KOG0286343 consensus G-protein beta subunit [General function 100.0
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 100.0
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 100.0
KOG0279315 consensus G protein beta subunit-like protein [Sig 100.0
KOG1063764 consensus RNA polymerase II elongator complex, sub 100.0
KOG0645312 consensus WD40 repeat protein [General function pr 100.0
KOG0296399 consensus Angio-associated migratory cell protein 100.0
KOG0285460 consensus Pleiotropic regulator 1 [RNA processing 100.0
KOG0295406 consensus WD40 repeat-containing protein [Function 100.0
KOG0315311 consensus G-protein beta subunit-like protein (con 100.0
KOG0292 1202 consensus Vesicle coat complex COPI, alpha subunit 100.0
KOG0263707 consensus Transcription initiation factor TFIID, s 100.0
KOG1539 910 consensus WD repeat protein [General function pred 100.0
KOG0285460 consensus Pleiotropic regulator 1 [RNA processing 100.0
KOG2048691 consensus WD40 repeat protein [General function pr 100.0
KOG0284464 consensus Polyadenylation factor I complex, subuni 99.98
KOG1063764 consensus RNA polymerase II elongator complex, sub 99.98
KOG0281499 consensus Beta-TrCP (transducin repeats containing 99.98
KOG0645312 consensus WD40 repeat protein [General function pr 99.97
KOG0295406 consensus WD40 repeat-containing protein [Function 99.97
KOG2106626 consensus Uncharacterized conserved protein, conta 99.97
KOG0263707 consensus Transcription initiation factor TFIID, s 99.97
KOG0281499 consensus Beta-TrCP (transducin repeats containing 99.97
KOG0296399 consensus Angio-associated migratory cell protein 99.97
KOG1539 910 consensus WD repeat protein [General function pred 99.97
KOG2048691 consensus WD40 repeat protein [General function pr 99.97
KOG0265338 consensus U5 snRNP-specific protein-like factor an 99.97
KOG1408 1080 consensus WD40 repeat protein [Function unknown] 99.97
KOG0265338 consensus U5 snRNP-specific protein-like factor an 99.97
KOG0277311 consensus Peroxisomal targeting signal type 2 rece 99.97
KOG0266456 consensus WD40 repeat-containing protein [General 99.96
KOG0293519 consensus WD40 repeat-containing protein [Function 99.96
KOG0284464 consensus Polyadenylation factor I complex, subuni 99.96
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.96
PLN00181793 protein SPA1-RELATED; Provisional 99.96
KOG0316307 consensus Conserved WD40 repeat-containing protein 99.96
KOG0313423 consensus Microtubule binding protein YTM1 (contai 99.95
KOG0316307 consensus Conserved WD40 repeat-containing protein 99.95
KOG0266456 consensus WD40 repeat-containing protein [General 99.95
KOG0282503 consensus mRNA splicing factor [Function unknown] 99.95
KOG0278334 consensus Serine/threonine kinase receptor-associa 99.95
PLN00181793 protein SPA1-RELATED; Provisional 99.95
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.95
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 99.95
KOG0313423 consensus Microtubule binding protein YTM1 (contai 99.95
KOG0293519 consensus WD40 repeat-containing protein [Function 99.94
KOG0310487 consensus Conserved WD40 repeat-containing protein 99.94
KOG0268433 consensus Sof1-like rRNA processing protein (conta 99.94
KOG0277311 consensus Peroxisomal targeting signal type 2 rece 99.94
KOG0275508 consensus Conserved WD40 repeat-containing protein 99.94
KOG0288459 consensus WD40 repeat protein TipD [General functi 99.94
KOG0282503 consensus mRNA splicing factor [Function unknown] 99.93
KOG0301 745 consensus Phospholipase A2-activating protein (con 99.93
KOG0772641 consensus Uncharacterized conserved protein, conta 99.93
KOG0308735 consensus Conserved WD40 repeat-containing protein 99.93
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 99.93
KOG0283712 consensus WD40 repeat-containing protein [Function 99.93
KOG0275508 consensus Conserved WD40 repeat-containing protein 99.93
KOG0278334 consensus Serine/threonine kinase receptor-associa 99.93
KOG0294362 consensus WD40 repeat-containing protein [Function 99.92
KOG0643327 consensus Translation initiation factor 3, subunit 99.92
KOG0973 942 consensus Histone transcription regulator HIRA, WD 99.92
KOG0310487 consensus Conserved WD40 repeat-containing protein 99.92
KOG0647347 consensus mRNA export protein (contains WD40 repea 99.92
KOG0299479 consensus U3 snoRNP-associated protein (contains W 99.92
KOG0772641 consensus Uncharacterized conserved protein, conta 99.92
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 99.92
KOG0289506 consensus mRNA splicing factor [General function p 99.92
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 99.92
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 99.92
KOG0308735 consensus Conserved WD40 repeat-containing protein 99.92
KOG0288459 consensus WD40 repeat protein TipD [General functi 99.92
KOG0283712 consensus WD40 repeat-containing protein [Function 99.92
KOG1407313 consensus WD40 repeat protein [Function unknown] 99.92
KOG0643327 consensus Translation initiation factor 3, subunit 99.91
PTZ00421493 coronin; Provisional 99.91
KOG0301745 consensus Phospholipase A2-activating protein (con 99.91
KOG0300481 consensus WD40 repeat-containing protein [Function 99.91
KOG1445 1012 consensus Tumor-specific antigen (contains WD repe 99.91
KOG0299479 consensus U3 snoRNP-associated protein (contains W 99.91
KOG0641350 consensus WD40 repeat protein [General function pr 99.91
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 99.91
KOG0294362 consensus WD40 repeat-containing protein [Function 99.91
KOG0268433 consensus Sof1-like rRNA processing protein (conta 99.91
KOG0300481 consensus WD40 repeat-containing protein [Function 99.91
KOG0289506 consensus mRNA splicing factor [General function p 99.91
PTZ00420568 coronin; Provisional 99.91
KOG1036323 consensus Mitotic spindle checkpoint protein BUB3, 99.9
KOG0647347 consensus mRNA export protein (contains WD40 repea 99.9
KOG1407313 consensus WD40 repeat protein [Function unknown] 99.9
PTZ00421493 coronin; Provisional 99.9
KOG0640430 consensus mRNA cleavage stimulating factor complex 99.9
KOG1036323 consensus Mitotic spindle checkpoint protein BUB3, 99.9
KOG2096420 consensus WD40 repeat protein [General function pr 99.9
KOG0640430 consensus mRNA cleavage stimulating factor complex 99.89
PTZ00420568 coronin; Provisional 99.89
KOG0641350 consensus WD40 repeat protein [General function pr 99.89
KOG1332299 consensus Vesicle coat complex COPII, subunit SEC1 99.89
KOG0973 942 consensus Histone transcription regulator HIRA, WD 99.88
KOG0639705 consensus Transducin-like enhancer of split protei 99.88
KOG1332299 consensus Vesicle coat complex COPII, subunit SEC1 99.88
KOG0264422 consensus Nucleosome remodeling factor, subunit CA 99.88
KOG0646476 consensus WD40 repeat protein [General function pr 99.88
KOG1963 792 consensus WD40 repeat protein [General function pr 99.88
KOG2096420 consensus WD40 repeat protein [General function pr 99.87
KOG0646476 consensus WD40 repeat protein [General function pr 99.87
KOG0264422 consensus Nucleosome remodeling factor, subunit CA 99.87
KOG0639705 consensus Transducin-like enhancer of split protei 99.87
KOG4283397 consensus Transcription-coupled repair protein CSA 99.87
KOG2445361 consensus Nuclear pore complex component (sc Seh1) 99.86
KOG0269839 consensus WD40 repeat-containing protein [Function 99.86
KOG0321 720 consensus WD40 repeat-containing protein L2DTL [Fu 99.85
KOG1963792 consensus WD40 repeat protein [General function pr 99.85
KOG2055514 consensus WD40 repeat protein [General function pr 99.85
KOG4283397 consensus Transcription-coupled repair protein CSA 99.84
KOG0269 839 consensus WD40 repeat-containing protein [Function 99.84
KOG2445361 consensus Nuclear pore complex component (sc Seh1) 99.84
KOG14451012 consensus Tumor-specific antigen (contains WD repe 99.83
KOG2055514 consensus WD40 repeat protein [General function pr 99.83
KOG0321 720 consensus WD40 repeat-containing protein L2DTL [Fu 99.83
KOG1009434 consensus Chromatin assembly complex 1 subunit B/C 99.83
KOG1034385 consensus Transcriptional repressor EED/ESC/FIE, r 99.82
KOG0302440 consensus Ribosome Assembly protein [General funct 99.82
KOG4378673 consensus Nuclear protein COP1 [Signal transductio 99.82
KOG1274 933 consensus WD40 repeat protein [General function pr 99.82
KOG0267 825 consensus Microtubule severing protein katanin p80 99.81
KOG0302440 consensus Ribosome Assembly protein [General funct 99.81
KOG1034385 consensus Transcriptional repressor EED/ESC/FIE, r 99.81
KOG0650733 consensus WD40 repeat nucleolar protein Bop1, invo 99.8
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 99.8
KOG0270463 consensus WD40 repeat-containing protein [Function 99.8
KOG0267 825 consensus Microtubule severing protein katanin p80 99.8
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.8
KOG1273405 consensus WD40 repeat protein [General function pr 99.8
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.8
KOG0650733 consensus WD40 repeat nucleolar protein Bop1, invo 99.8
KOG1274 933 consensus WD40 repeat protein [General function pr 99.8
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 99.79
KOG1524737 consensus WD40 repeat-containing protein CHE-2 [Ge 99.79
KOG4328498 consensus WD40 protein [Function unknown] 99.78
KOG4328498 consensus WD40 protein [Function unknown] 99.78
KOG4378673 consensus Nuclear protein COP1 [Signal transductio 99.77
KOG1273405 consensus WD40 repeat protein [General function pr 99.76
KOG15171387 consensus Guanine nucleotide binding protein MIP1 99.74
KOG0642577 consensus Cell-cycle nuclear protein, contains WD- 99.74
KOG2919406 consensus Guanine nucleotide-binding protein [Gene 99.74
KOG0303472 consensus Actin-binding protein Coronin, contains 99.74
KOG1007370 consensus WD repeat protein TSSC1, WD repeat super 99.74
KOG1007370 consensus WD repeat protein TSSC1, WD repeat super 99.73
COG2319466 FOG: WD40 repeat [General function prediction only 99.73
KOG0307 1049 consensus Vesicle coat complex COPII, subunit SEC3 99.71
KOG0270463 consensus WD40 repeat-containing protein [Function 99.71
KOG1188376 consensus WD40 repeat protein [General function pr 99.71
KOG2919406 consensus Guanine nucleotide-binding protein [Gene 99.71
KOG0290364 consensus Conserved WD40 repeat-containing protein 99.71
KOG1188376 consensus WD40 repeat protein [General function pr 99.71
KOG0290364 consensus Conserved WD40 repeat-containing protein 99.71
COG2319466 FOG: WD40 repeat [General function prediction only 99.68
KOG0649325 consensus WD40 repeat protein [General function pr 99.66
KOG0303472 consensus Actin-binding protein Coronin, contains 99.66
KOG0642577 consensus Cell-cycle nuclear protein, contains WD- 99.65
KOG0322323 consensus G-protein beta subunit-like protein GNB1 99.65
KOG0322323 consensus G-protein beta subunit-like protein GNB1 99.65
KOG4227609 consensus WD40 repeat protein [General function pr 99.65
KOG4227609 consensus WD40 repeat protein [General function pr 99.65
KOG2110391 consensus Uncharacterized conserved protein, conta 99.62
KOG1009434 consensus Chromatin assembly complex 1 subunit B/C 99.62
KOG1524737 consensus WD40 repeat-containing protein CHE-2 [Ge 99.61
KOG1587555 consensus Cytoplasmic dynein intermediate chain [C 99.6
KOG1334559 consensus WD40 repeat protein [General function pr 99.59
KOG0644 1113 consensus Uncharacterized conserved protein, conta 99.59
KOG0649325 consensus WD40 repeat protein [General function pr 99.59
KOG0307 1049 consensus Vesicle coat complex COPII, subunit SEC3 99.59
KOG1523361 consensus Actin-related protein Arp2/3 complex, su 99.59
KOG1272545 consensus WD40-repeat-containing subunit of the 18 99.58
KOG0644 1113 consensus Uncharacterized conserved protein, conta 99.58
KOG2110391 consensus Uncharacterized conserved protein, conta 99.58
KOG1310758 consensus WD40 repeat protein [General function pr 99.58
KOG15171387 consensus Guanine nucleotide binding protein MIP1 99.56
KOG1587555 consensus Cytoplasmic dynein intermediate chain [C 99.56
KOG12401431 consensus Protein kinase containing WD40 repeats [ 99.53
PRK11028330 6-phosphogluconolactonase; Provisional 99.52
KOG1310758 consensus WD40 repeat protein [General function pr 99.52
KOG0974 967 consensus WD-repeat protein WDR6, WD repeat superf 99.51
PRK11028330 6-phosphogluconolactonase; Provisional 99.5
KOG2111346 consensus Uncharacterized conserved protein, conta 99.5
KOG1523361 consensus Actin-related protein Arp2/3 complex, su 99.48
KOG1334559 consensus WD40 repeat protein [General function pr 99.48
KOG12401431 consensus Protein kinase containing WD40 repeats [ 99.48
KOG1912 1062 consensus WD40 repeat protein [General function pr 99.47
KOG0771398 consensus Prolactin regulatory element-binding pro 99.46
KOG1912 1062 consensus WD40 repeat protein [General function pr 99.44
KOG2041 1189 consensus WD40 repeat protein [General function pr 99.43
KOG4497447 consensus Uncharacterized conserved protein WDR8, 99.42
KOG2394636 consensus WD40 protein DMR-N9 [General function pr 99.41
PRK01742429 tolB translocation protein TolB; Provisional 99.4
KOG2111346 consensus Uncharacterized conserved protein, conta 99.4
KOG1409404 consensus Uncharacterized conserved protein, conta 99.39
KOG2139445 consensus WD40 repeat protein [General function pr 99.37
KOG3881412 consensus Uncharacterized conserved protein [Funct 99.34
KOG1272545 consensus WD40-repeat-containing subunit of the 18 99.33
KOG0771398 consensus Prolactin regulatory element-binding pro 99.32
KOG3881412 consensus Uncharacterized conserved protein [Funct 99.31
KOG2321703 consensus WD40 repeat protein [General function pr 99.29
PRK01742429 tolB translocation protein TolB; Provisional 99.28
KOG4497447 consensus Uncharacterized conserved protein WDR8, 99.28
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 99.28
KOG2139445 consensus WD40 repeat protein [General function pr 99.27
KOG2394636 consensus WD40 protein DMR-N9 [General function pr 99.26
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 99.22
KOG1354433 consensus Serine/threonine protein phosphatase 2A, 99.19
PF04762928 IKI3: IKI3 family; InterPro: IPR006849 Members of 99.18
PRK03629429 tolB translocation protein TolB; Provisional 99.18
KOG0280339 consensus Uncharacterized conserved protein [Amino 99.16
KOG1409404 consensus Uncharacterized conserved protein, conta 99.15
KOG2315566 consensus Predicted translation initiation factor 99.12
KOG1354433 consensus Serine/threonine protein phosphatase 2A, 99.09
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.05
PRK03629429 tolB translocation protein TolB; Provisional 99.04
PRK04922433 tolB translocation protein TolB; Provisional 99.03
KOG0309 1081 consensus Conserved WD40 repeat-containing protein 99.03
PRK05137435 tolB translocation protein TolB; Provisional 99.03
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.02
KOG2041 1189 consensus WD40 repeat protein [General function pr 99.01
PRK02889427 tolB translocation protein TolB; Provisional 99.01
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 98.99
PRK04922433 tolB translocation protein TolB; Provisional 98.97
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 98.97
KOG4547541 consensus WD40 repeat-containing protein [General 98.96
KOG0280339 consensus Uncharacterized conserved protein [Amino 98.95
PRK02889427 tolB translocation protein TolB; Provisional 98.92
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 98.91
KOG2321703 consensus WD40 repeat protein [General function pr 98.91
KOG4547541 consensus WD40 repeat-containing protein [General 98.9
COG4946668 Uncharacterized protein related to the periplasmic 98.9
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 98.86
KOG10642439 consensus RAVE (regulator of V-ATPase assembly) co 98.85
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 98.85
KOG10642439 consensus RAVE (regulator of V-ATPase assembly) co 98.83
PRK05137435 tolB translocation protein TolB; Provisional 98.82
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 98.82
KOG2314698 consensus Translation initiation factor 3, subunit 98.8
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 98.79
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 98.76
KOG4714319 consensus Nucleoporin [Nuclear structure] 98.76
KOG2315566 consensus Predicted translation initiation factor 98.76
KOG3914390 consensus WD repeat protein WDR4 [Function unknown 98.75
COG5354561 Uncharacterized protein, contains Trp-Asp (WD) rep 98.75
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 98.75
KOG0309 1081 consensus Conserved WD40 repeat-containing protein 98.73
KOG2314698 consensus Translation initiation factor 3, subunit 98.7
PRK01029428 tolB translocation protein TolB; Provisional 98.68
KOG41901034 consensus Uncharacterized conserved protein [Funct 98.64
PRK04792448 tolB translocation protein TolB; Provisional 98.64
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 98.63
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 98.62
PRK00178430 tolB translocation protein TolB; Provisional 98.62
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 98.55
KOG41901034 consensus Uncharacterized conserved protein [Funct 98.54
PRK00178430 tolB translocation protein TolB; Provisional 98.5
KOG4714319 consensus Nucleoporin [Nuclear structure] 98.49
KOG3914390 consensus WD repeat protein WDR4 [Function unknown 98.48
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 98.48
KOG4649354 consensus PQQ (pyrrolo-quinoline quinone) repeat p 98.47
COG5354561 Uncharacterized protein, contains Trp-Asp (WD) rep 98.47
PRK01029428 tolB translocation protein TolB; Provisional 98.47
COG4946668 Uncharacterized protein related to the periplasmic 98.45
KOG1275 1118 consensus PAB-dependent poly(A) ribonuclease, subu 98.43
KOG4532344 consensus WD40-like repeat containing protein [Gen 98.41
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 98.4
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 98.39
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 98.37
COG5170460 CDC55 Serine/threonine protein phosphatase 2A, reg 98.37
PLN029191057 haloacid dehalogenase-like hydrolase family protei 98.36
COG5170460 CDC55 Serine/threonine protein phosphatase 2A, reg 98.34
KOG4532344 consensus WD40-like repeat containing protein [Gen 98.34
KOG2695425 consensus WD40 repeat protein [General function pr 98.33
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 98.31
PRK04792448 tolB translocation protein TolB; Provisional 98.29
PLN029191057 haloacid dehalogenase-like hydrolase family protei 98.27
KOG2695425 consensus WD40 repeat protein [General function pr 98.26
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 98.1
KOG18321516 consensus HIV-1 Vpr-binding protein [Cell cycle co 98.1
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 98.08
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 98.08
KOG3621726 consensus WD40 repeat-containing protein [General 98.0
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 97.96
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 97.93
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 97.91
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 97.89
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 97.89
KOG0882558 consensus Cyclophilin-related peptidyl-prolyl cis- 97.86
PF08596395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 97.82
PF11768545 DUF3312: Protein of unknown function (DUF3312); In 97.81
KOG0882558 consensus Cyclophilin-related peptidyl-prolyl cis- 97.77
KOG4649354 consensus PQQ (pyrrolo-quinoline quinone) repeat p 97.77
KOG2066 846 consensus Vacuolar assembly/sorting protein VPS41 97.77
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 97.7
PF11768545 DUF3312: Protein of unknown function (DUF3312); In 97.7
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 97.7
KOG1275 1118 consensus PAB-dependent poly(A) ribonuclease, subu 97.68
KOG2066 846 consensus Vacuolar assembly/sorting protein VPS41 97.67
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 97.65
PRK04043419 tolB translocation protein TolB; Provisional 97.62
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 97.59
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 97.53
PRK02888635 nitrous-oxide reductase; Validated 97.48
PRK04043419 tolB translocation protein TolB; Provisional 97.47
KOG1645463 consensus RING-finger-containing E3 ubiquitin liga 97.4
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 97.4
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 97.36
KOG1645463 consensus RING-finger-containing E3 ubiquitin liga 97.34
PF04841410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 97.33
KOG3621 726 consensus WD40 repeat-containing protein [General 97.33
PRK02888635 nitrous-oxide reductase; Validated 97.32
smart0032040 WD40 WD40 repeats. Note that these repeats are per 97.32
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 97.25
KOG18321516 consensus HIV-1 Vpr-binding protein [Cell cycle co 97.17
KOG18971096 consensus Damage-specific DNA binding complex, sub 97.17
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 97.1
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 97.08
PF08596395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 97.07
KOG18971096 consensus Damage-specific DNA binding complex, sub 97.0
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 96.91
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 96.86
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 96.82
smart0032040 WD40 WD40 repeats. Note that these repeats are per 96.81
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 96.74
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 96.67
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 96.62
COG3204316 Uncharacterized protein conserved in bacteria [Fun 96.52
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 96.38
KOG1008783 consensus Uncharacterized conserved protein, conta 96.22
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 96.2
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 96.16
KOG4640665 consensus Anaphase-promoting complex (APC), subuni 95.79
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 95.77
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 95.7
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 95.53
PF05694461 SBP56: 56kDa selenium binding protein (SBP56); Int 95.51
KOG2395644 consensus Protein involved in vacuole import and d 95.36
KOG2079 1206 consensus Vacuolar assembly/sorting protein VPS8 [ 95.34
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 95.28
COG3386307 Gluconolactonase [Carbohydrate transport and metab 95.02
KOG1008 783 consensus Uncharacterized conserved protein, conta 94.9
PF04841410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 94.84
KOG2079 1206 consensus Vacuolar assembly/sorting protein VPS8 [ 94.83
TIGR03075527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 94.81
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 94.68
PRK13616591 lipoprotein LpqB; Provisional 94.61
PF10168717 Nup88: Nuclear pore component; InterPro: IPR019321 94.52
PHA02713557 hypothetical protein; Provisional 94.46
KOG2444238 consensus WD40 repeat protein [General function pr 94.41
PF14727418 PHTB1_N: PTHB1 N-terminus 94.31
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 94.25
KOG4640665 consensus Anaphase-promoting complex (APC), subuni 94.15
PF15390671 DUF4613: Domain of unknown function (DUF4613) 93.95
KOG2395644 consensus Protein involved in vacuole import and d 93.93
PHA02713557 hypothetical protein; Provisional 93.68
PF08728 717 CRT10: CRT10; InterPro: IPR014839 CRT10 is a trans 93.33
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 93.06
COG3490366 Uncharacterized protein conserved in bacteria [Fun 92.81
KOG2444238 consensus WD40 repeat protein [General function pr 92.8
PF15390671 DUF4613: Domain of unknown function (DUF4613) 92.36
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 92.19
KOG1916 1283 consensus Nuclear protein, contains WD40 repeats [ 91.93
PF05694461 SBP56: 56kDa selenium binding protein (SBP56); Int 91.66
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 91.38
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 91.29
PF1031343 DUF2415: Uncharacterised protein domain (DUF2415); 91.26
PF12234631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 90.82
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 90.54
KOG18981205 consensus Splicing factor 3b, subunit 3 [RNA proce 90.54
KOG4499310 consensus Ca2+-binding protein Regucalcin/SMP30 [I 90.52
COG0823425 TolB Periplasmic component of the Tol biopolymer t 90.26
PF07995331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 90.16
KOG3630 1405 consensus Nuclear pore complex, Nup214/CAN compone 89.84
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 89.55
COG3490366 Uncharacterized protein conserved in bacteria [Fun 89.52
PRK13684334 Ycf48-like protein; Provisional 89.31
COG3823262 Glutamine cyclotransferase [Posttranslational modi 89.26
PF10168 717 Nup88: Nuclear pore component; InterPro: IPR019321 88.84
PF12234 631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 88.47
COG3391381 Uncharacterized conserved protein [Function unknow 87.8
PF1031343 DUF2415: Uncharacterised protein domain (DUF2415); 87.26
KOG18981205 consensus Splicing factor 3b, subunit 3 [RNA proce 86.65
KOG3630 1405 consensus Nuclear pore complex, Nup214/CAN compone 86.6
PF08728717 CRT10: CRT10; InterPro: IPR014839 CRT10 is a trans 85.98
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 85.77
KOG1900 1311 consensus Nuclear pore complex, Nup155 component ( 85.37
PHA03098534 kelch-like protein; Provisional 85.03
KOG1916 1283 consensus Nuclear protein, contains WD40 repeats [ 84.81
PF02333381 Phytase: Phytase; InterPro: IPR003431 Phytase (3.1 84.4
COG3391381 Uncharacterized conserved protein [Function unknow 84.33
COG0823425 TolB Periplasmic component of the Tol biopolymer t 83.85
KOG2377657 consensus Uncharacterized conserved protein [Funct 83.6
PF14781136 BBS2_N: Ciliary BBSome complex subunit 2, N-termin 82.36
PF14781136 BBS2_N: Ciliary BBSome complex subunit 2, N-termin 81.81
KOG2247615 consensus WD40 repeat-containing protein [General 81.7
PLN00033398 photosystem II stability/assembly factor; Provisio 81.43
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 81.39
PF14655415 RAB3GAP2_N: Rab3 GTPase-activating protein regulat 80.76
PHA02790480 Kelch-like protein; Provisional 80.75
PF14727418 PHTB1_N: PTHB1 N-terminus 80.12
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information 
Probab=100.00  E-value=3.1e-48  Score=380.53  Aligned_cols=520  Identities=18%  Similarity=0.254  Sum_probs=376.5

Q ss_pred             eeeeeeEEEEEeccCCCCCCcceEEeec-CCeEEEEECCCCe--eeeEEEeeccccEEeEEeccccCCCCCCccceeeEE
Q 003423           15 QYLGEISALCFVHLPSHLSSLPFLLAGS-GSQVLLYDLEAGT--LIRPFQVFHGIRLHGISCNFINCTEGSVSTRVTFEV   91 (821)
Q Consensus        15 ~~~~~Vt~l~~~~~p~~~~~~~~l~~g~-~~~i~iwd~~t~~--~~~~~~~~~~~~i~~i~~~~~~~~~~~~~~~~~~~l   91 (821)
                      +|..++|-..|+  |.    +.|+++|. .|.|+|||....+  +..+++++.+ +|..|+|+.+.           .++
T Consensus        57 EH~~~vtVAkyS--Ps----G~yiASGD~sG~vRIWdtt~~~hiLKnef~v~aG-~I~Di~Wd~ds-----------~RI  118 (603)
T KOG0318|consen   57 EHAHQVTVAKYS--PS----GFYIASGDVSGKVRIWDTTQKEHILKNEFQVLAG-PIKDISWDFDS-----------KRI  118 (603)
T ss_pred             cccceeEEEEeC--CC----ceEEeecCCcCcEEEEeccCcceeeeeeeeeccc-ccccceeCCCC-----------cEE
Confidence            388899999999  98    77999998 6999999987633  3355667666 89999999553           366


Q ss_pred             EEEcCC---eEEEEEEeecCCCCCCCCCccccccceeeeccCCCCcEEEEEEeecCCCCCEEEEEECCCcEEEEEccCCc
Q 003423           92 ALFGEK---RVKLFELNFELSPNSQYQPETCVNLSLVQSLPRLSHWVFDVCFLKVCNGNRSLAIGCSDNSIRVWDISNSS  168 (821)
Q Consensus        92 ~~~g~~---~v~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~h~~~I~~~~~~~~~~~~~~l~t~~~d~~i~iwd~~~~~  168 (821)
                      ++.|+|   ..+++-++.+               .-.-.+.||...|++++|-|.  ..-.++||+.|++|.+|+-..-+
T Consensus       119 ~avGEGrerfg~~F~~DSG---------------~SvGei~GhSr~ins~~~Kps--RPfRi~T~sdDn~v~ffeGPPFK  181 (603)
T KOG0318|consen  119 AAVGEGRERFGHVFLWDSG---------------NSVGEITGHSRRINSVDFKPS--RPFRIATGSDDNTVAFFEGPPFK  181 (603)
T ss_pred             EEEecCccceeEEEEecCC---------------CccceeeccceeEeeeeccCC--CceEEEeccCCCeEEEeeCCCee
Confidence            665543   2333333332               235568899999999999982  33579999999999999865555


Q ss_pred             eeEEEccCcceeEEEEeeccCCccCeEEEEEeeCCEEEEEEcccCCcccCCCCCCCcccCCCCCCcceeeecccccceee
Q 003423          169 IILEVHSPERCLLYSMKLWGDNLEALRIASGTIYNEIIVWKVDWEHVAPLLNSPEGNHAHGSSSDFKCFKLQDQQHTAVN  248 (821)
Q Consensus       169 ~~~~~~~~~~~~~~s~~~~~~s~~~~~l~sg~~dg~i~vwd~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  248 (821)
                      ...++..|.+ .+.+++|   +||+.++|+.+.||+|.+||-.                                 +++.
T Consensus       182 Fk~s~r~Hsk-FV~~VRy---sPDG~~Fat~gsDgki~iyDGk---------------------------------tge~  224 (603)
T KOG0318|consen  182 FKSSFREHSK-FVNCVRY---SPDGSRFATAGSDGKIYIYDGK---------------------------------TGEK  224 (603)
T ss_pred             eeeccccccc-ceeeEEE---CCCCCeEEEecCCccEEEEcCC---------------------------------CccE
Confidence            4445555554 6788888   7999999999999999999988                                 5666


Q ss_pred             EEEEe---cCCCcEEEEEEcCCCCEEEEEeCCCeEEEEecccCcccCCCCceeeeceEEeccc--eeEEEEEEcCCEEEE
Q 003423          249 LFRLV---GHEGSIFRIEWSSCGSKLVSVSDDRSARIWEVRAEYWKDSDSIEEVGSSVLYGHN--ARVWDCCLTDSFIIT  323 (821)
Q Consensus       249 ~~~~~---~h~~~I~~l~~s~~~~~l~s~s~Dg~i~iwd~~~~~~~~~~~~~~~~~~~~~~h~--~~i~~v~~~~~~l~s  323 (821)
                      +..+.   +|++.|++|+|+||+..++|+|.|.++||||+.+.+.     .+..    ..+.+  ..-..+.|....|++
T Consensus       225 vg~l~~~~aHkGsIfalsWsPDs~~~~T~SaDkt~KIWdVs~~sl-----v~t~----~~~~~v~dqqvG~lWqkd~lIt  295 (603)
T KOG0318|consen  225 VGELEDSDAHKGSIFALSWSPDSTQFLTVSADKTIKIWDVSTNSL-----VSTW----PMGSTVEDQQVGCLWQKDHLIT  295 (603)
T ss_pred             EEEecCCCCccccEEEEEECCCCceEEEecCCceEEEEEeeccce-----EEEe----ecCCchhceEEEEEEeCCeEEE
Confidence            66776   8999999999999999999999999999999999876     4322    22222  333456667899999


Q ss_pred             EeCCCeEEEEcC-CCceeeEeecccCCCeEEEEEecCCCEEEEEeCCCcEEEEEcCCcCCCcc--cCC---ccccccCCC
Q 003423          324 AGEDCTCRVWGS-DGKQLKMIKEHIGRGIWRCLYDSLSSLLVTAGFDSAIKVHQFQAFLPGSL--ESH---PEAKEFNGR  397 (821)
Q Consensus       324 ~~~dg~i~iwd~-~~~~~~~~~~h~~~~i~~l~~~~~~~~l~tg~~dg~I~iwd~~~~~~~~~--~~~---~~~~~~~~~  397 (821)
                      .+.+|+|.+++. +...+..+.+|.. +|++++.++++++|++|+.||.|.-|+........+  +.|   ...+.....
T Consensus       296 VSl~G~in~ln~~d~~~~~~i~GHnK-~ITaLtv~~d~~~i~SgsyDG~I~~W~~~~g~~~~~~g~~h~nqI~~~~~~~~  374 (603)
T KOG0318|consen  296 VSLSGTINYLNPSDPSVLKVISGHNK-SITALTVSPDGKTIYSGSYDGHINSWDSGSGTSDRLAGKGHTNQIKGMAASES  374 (603)
T ss_pred             EEcCcEEEEecccCCChhheeccccc-ceeEEEEcCCCCEEEeeccCceEEEEecCCccccccccccccceEEEEeecCC
Confidence            999999999999 7789999999998 799999999999999999999999999954322222  222   122223333


Q ss_pred             cceEEeecCCcccceecc---------CCCCcceEEEEeecCCeEEEEecCCcEEEEEecCCCcceeeEeeeccCCcceE
Q 003423          398 TEIFSIKIPNFSEQIRLT---------DSKSEYVRCLHLTSEDTLYIATNHGYLYHTKLCDMDSVNWNKILQVSEGMPII  468 (821)
Q Consensus       398 ~~~~~~~~~~~~~~~~~~---------~~~~~~i~~l~f~~~~~~l~~~~~g~~~~~~i~~~~~~~~~~~~~~~~~~~i~  468 (821)
                      .+++.....+........         ..-..+..+++..+++.+++.+..+.+..++  +..     .+...+......
T Consensus       375 ~~~~t~g~Dd~l~~~~~~~~~~t~~~~~~lg~QP~~lav~~d~~~avv~~~~~iv~l~--~~~-----~~~~~~~~y~~s  447 (603)
T KOG0318|consen  375 GELFTIGWDDTLRVISLKDNGYTKSEVVKLGSQPKGLAVLSDGGTAVVACISDIVLLQ--DQT-----KVSSIPIGYESS  447 (603)
T ss_pred             CcEEEEecCCeEEEEecccCcccccceeecCCCceeEEEcCCCCEEEEEecCcEEEEe--cCC-----cceeeccccccc
Confidence            445544433332221110         0112345688888887555555545544322  111     122222333444


Q ss_pred             EEeccCCCCCCCCCCCcEEEEecCCccEEEEEecCCCCCCcceeEEeeccCccceeeeeEEeecCCCeEEEEECCCCcEE
Q 003423          469 CMDLLSNEPKYPCGIDDWVALGDGKGNMTIVRVVGDVHTPQLSFTFTWSAGIERQLLGTYWCKSLGHRFIFTADPKGRLK  548 (821)
Q Consensus       469 ~~~~~~~~~~~s~~~~~~l~~g~~~g~i~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~dg~i~  548 (821)
                      ++++.        |++..+++|+.||++++|.+.........+.  .-+.   ..+.  ...++|++.||++++..+++.
T Consensus       448 ~vAv~--------~~~~~vaVGG~Dgkvhvysl~g~~l~ee~~~--~~h~---a~iT--~vaySpd~~yla~~Da~rkvv  512 (603)
T KOG0318|consen  448 AVAVS--------PDGSEVAVGGQDGKVHVYSLSGDELKEEAKL--LEHR---AAIT--DVAYSPDGAYLAAGDASRKVV  512 (603)
T ss_pred             eEEEc--------CCCCEEEEecccceEEEEEecCCcccceeee--eccc---CCce--EEEECCCCcEEEEeccCCcEE
Confidence            55553        4669999999999999999988664322111  1111   1122  245889999999999999999


Q ss_pred             EeeecCCCCcccccCCccceeeeeEEEecccCceEEEEEeecCCCEEEEEcCCCcEEEEecCcccccccccccccccCcc
Q 003423          549 LWQLCDPFSSVCYESSKTNNVFLVAEFSSCFGARIMCLDASFEDEVLFCGDLRGNLVLFPLLRDLLNDKSVALHVEVSPL  628 (821)
Q Consensus       549 iwd~~~~~~~~~~~~~~~~~~~~~~~~~~~h~~~I~~l~~s~~~~~L~sgs~dG~i~iw~~~~~~~~~~~~~~~~~~~~~  628 (821)
                      +||+...+.             ....+ .-|.++|.|++|+|++.+||+|+-|-+|.||++++..            .. 
T Consensus       513 ~yd~~s~~~-------------~~~~w-~FHtakI~~~aWsP~n~~vATGSlDt~Viiysv~kP~------------~~-  565 (603)
T KOG0318|consen  513 LYDVASREV-------------KTNRW-AFHTAKINCVAWSPNNKLVATGSLDTNVIIYSVKKPA------------KH-  565 (603)
T ss_pred             EEEcccCce-------------eccee-eeeeeeEEEEEeCCCceEEEeccccceEEEEEccChh------------hh-
Confidence            999988732             11122 3489999999999999999999999999999998531            11 


Q ss_pred             cccccccCCcceEEEEEEecCCCceEEEEecCCCeEEEEEee
Q 003423          629 NYFKGAHGISTVSTLSVAKLRSNQTEIRSTGGDGCICYLEYD  670 (821)
Q Consensus       629 ~~~~~~h~~~~Vt~i~~~~~~~~~~~l~t~g~Dg~i~iw~~~  670 (821)
                      -..+++| ...|+++.|.   + +..++|+|.|.+||+|++.
T Consensus       566 i~iknAH-~~gVn~v~wl---d-e~tvvSsG~Da~iK~W~v~  602 (603)
T KOG0318|consen  566 IIIKNAH-LGGVNSVAWL---D-ESTVVSSGQDANIKVWNVT  602 (603)
T ss_pred             eEecccc-ccCceeEEEe---c-CceEEeccCcceeEEeccc
Confidence            2445699 4569999999   3 4789999999999999874

>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG1408 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG0645 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] Back     alignment and domain information
>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>KOG0645 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG1408 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>KOG0294 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] Back     alignment and domain information
>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] Back     alignment and domain information
>KOG0300 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0641 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0294 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0300 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2096 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0641 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1963 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2096 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0269 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown] Back     alignment and domain information
>KOG1963 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0269 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown] Back     alignment and domain information
>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair] Back     alignment and domain information
>KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription] Back     alignment and domain information
>KOG0302 consensus Ribosome Assembly protein [General function prediction only] Back     alignment and domain information
>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0302 consensus Ribosome Assembly protein [General function prediction only] Back     alignment and domain information
>KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription] Back     alignment and domain information
>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG0270 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG1273 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only] Back     alignment and domain information
>KOG4328 consensus WD40 protein [Function unknown] Back     alignment and domain information
>KOG4328 consensus WD40 protein [Function unknown] Back     alignment and domain information
>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG1273 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0642 consensus Cell-cycle nuclear protein, contains WD-40 repeats [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only] Back     alignment and domain information
>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton] Back     alignment and domain information
>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown] Back     alignment and domain information
>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown] Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0270 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1188 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only] Back     alignment and domain information
>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown] Back     alignment and domain information
>KOG1188 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown] Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG0649 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton] Back     alignment and domain information
>KOG0642 consensus Cell-cycle nuclear protein, contains WD-40 repeats [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0322 consensus G-protein beta subunit-like protein GNB1L, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG0322 consensus G-protein beta subunit-like protein GNB1L, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG4227 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4227 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair] Back     alignment and domain information
>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only] Back     alignment and domain information
>KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton] Back     alignment and domain information
>KOG1334 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only] Back     alignment and domain information
>KOG0649 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton] Back     alignment and domain information
>KOG1272 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only] Back     alignment and domain information
>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton] Back     alignment and domain information
>KOG1334 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>KOG1912 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1912 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only] Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG1409 consensus Uncharacterized conserved protein, contains WD40 repeats and FYVE domains [Function unknown] Back     alignment and domain information
>KOG2139 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG3881 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1272 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3881 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only] Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG2139 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only] Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG1354 consensus Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0280 consensus Uncharacterized conserved protein [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1409 consensus Uncharacterized conserved protein, contains WD40 repeats and FYVE domains [Function unknown] Back     alignment and domain information
>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1354 consensus Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG4547 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0280 consensus Uncharacterized conserved protein [Amino acid transport and metabolism] Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4547 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1064 consensus RAVE (regulator of V-ATPase assembly) complex subunit RAV1/DMX protein, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>KOG1064 consensus RAVE (regulator of V-ATPase assembly) complex subunit RAV1/DMX protein, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG4714 consensus Nucleoporin [Nuclear structure] Back     alignment and domain information
>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG3914 consensus WD repeat protein WDR4 [Function unknown] Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG4190 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>KOG4190 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG4714 consensus Nucleoporin [Nuclear structure] Back     alignment and domain information
>KOG3914 consensus WD repeat protein WDR4 [Function unknown] Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>KOG4649 consensus PQQ (pyrrolo-quinoline quinone) repeat protein [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>KOG1275 consensus PAB-dependent poly(A) ribonuclease, subunit PAN2 [Replication, recombination and repair] Back     alignment and domain information
>KOG4532 consensus WD40-like repeat containing protein [General function prediction only] Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG4532 consensus WD40-like repeat containing protein [General function prediction only] Back     alignment and domain information
>KOG2695 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>KOG2695 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG3621 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4649 consensus PQQ (pyrrolo-quinoline quinone) repeat protein [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>KOG1275 consensus PAB-dependent poly(A) ribonuclease, subunit PAN2 [Replication, recombination and repair] Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>KOG3621 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1897 consensus Damage-specific DNA binding complex, subunit DDB1 [Replication, recombination and repair] Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>KOG1897 consensus Damage-specific DNA binding complex, subunit DDB1 [Replication, recombination and repair] Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>KOG1008 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>KOG4640 consensus Anaphase-promoting complex (APC), subunit 4 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>KOG2395 consensus Protein involved in vacuole import and degradation [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2079 consensus Vacuolar assembly/sorting protein VPS8 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1008 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>KOG2079 consensus Vacuolar assembly/sorting protein VPS8 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>KOG2444 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF14727 PHTB1_N: PTHB1 N-terminus Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>KOG4640 consensus Anaphase-promoting complex (APC), subunit 4 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF15390 DUF4613: Domain of unknown function (DUF4613) Back     alignment and domain information
>KOG2395 consensus Protein involved in vacuole import and degradation [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PF08728 CRT10: CRT10; InterPro: IPR014839 CRT10 is a transcriptional regulator of ribonucleotide reductase (RNR) genes [] Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2444 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF15390 DUF4613: Domain of unknown function (DUF4613) Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>KOG1916 consensus Nuclear protein, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>KOG1898 consensus Splicing factor 3b, subunit 3 [RNA processing and modification] Back     alignment and domain information
>KOG4499 consensus Ca2+-binding protein Regucalcin/SMP30 [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>KOG3630 consensus Nuclear pore complex, Nup214/CAN component [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>COG3823 Glutamine cyclotransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins Back     alignment and domain information
>KOG1898 consensus Splicing factor 3b, subunit 3 [RNA processing and modification] Back     alignment and domain information
>KOG3630 consensus Nuclear pore complex, Nup214/CAN component [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF08728 CRT10: CRT10; InterPro: IPR014839 CRT10 is a transcriptional regulator of ribonucleotide reductase (RNR) genes [] Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>KOG1900 consensus Nuclear pore complex, Nup155 component (D Nup154, sc Nup157/Nup170) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>KOG1916 consensus Nuclear protein, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF02333 Phytase: Phytase; InterPro: IPR003431 Phytase (3 Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG2377 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF14781 BBS2_N: Ciliary BBSome complex subunit 2, N-terminal Back     alignment and domain information
>PF14781 BBS2_N: Ciliary BBSome complex subunit 2, N-terminal Back     alignment and domain information
>KOG2247 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PLN00033 photosystem II stability/assembly factor; Provisional Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>PF14727 PHTB1_N: PTHB1 N-terminus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query821
2ymu_A577 Structure Of A Highly Repetitive Propeller Structur 1e-07
2ymu_A577 Structure Of A Highly Repetitive Propeller Structur 4e-06
1erj_A393 Crystal Structure Of The C-Terminal Wd40 Domain Of 7e-06
2cnx_A315 Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2. 2e-05
2co0_A315 Wdr5 And Unmodified Histone H3 Complex At 2.25 Angs 2e-05
3emh_A318 Structural Basis Of Wdr5-Mll Interaction Length = 3 4e-05
4a7j_A318 Symmetric Dimethylation Of H3 Arginine 2 Is A Novel 4e-05
2h68_A312 Histone H3 Recognition And Presentation By The Wdr5 4e-05
2g9a_A311 Structural Basis For The Specific Recognition Of Me 4e-05
2g99_A308 Structural Basis For The Specific Recognition Of Me 4e-05
2xl2_A334 Wdr5 In Complex With An Rbbp5 Peptide Recruited To 4e-05
2h9l_A329 Wdr5delta23 Length = 329 4e-05
2h9m_A313 Wdr5 In Complex With Unmodified H3k4 Peptide Length 5e-05
3smr_A312 Crystal Structure Of Human Wd Repeat Domain 5 With 5e-05
2h13_A317 Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length 5e-05
3psl_A318 Fine-Tuning The Stimulation Of Mll1 Methyltransfera 5e-05
2gnq_A336 Structure Of Wdr5 Length = 336 5e-05
3n0d_A315 Crystal Structure Of Wdr5 Mutant (W330f) Length = 3 5e-05
3n0e_A315 Crystal Structure Of Wdr5 Mutant (W330y) Length = 3 5e-05
3mxx_A315 Crystal Structure Of Wdr5 Mutant (S62a) Length = 31 1e-04
1nex_B464 Crystal Structure Of Scskp1-Sccdc4-Cpd Peptide Comp 4e-04
3mks_B464 Crystal Structure Of Yeast Cdc4SKP1 IN COMPLEX WITH 7e-04
>pdb|2YMU|A Chain A, Structure Of A Highly Repetitive Propeller Structure Length = 577 Back     alignment and structure 
Iteration: 1

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 63/292 (21%), Positives = 123/292 (42%), Gaps = 53/292 (18%)
Query: 121 NLSLVQSLPRLSHWVFDVCFLKVCNGNRSLAIGCSDNSIRVWDIS----------NSSII 170
           N  L+Q+L   S  V+ V F       +++A    D ++++W+ +          +SS+ 
Sbjct: 169 NGQLLQTLTGHSSSVWGVAF---SPDGQTIASASDDKTVKLWNRNGQLLQTLTGHSSSVR 225
Query: 171 LEVHSPERCLLYS------MKLWGDNLEALRIASGTIYN-EIIVWKVDWEHVAPLLNSPE 223
               SP+   + S      +KLW  N + L+  +G   +   + ++ D + +A       
Sbjct: 226 GVAFSPDGQTIASASDDKTVKLWNRNGQLLQTLTGHSSSVNGVAFRPDGQTIA------- 278
Query: 224 GNHAHGSSSDFKCFKLQDQQHTAVNLFRLVGHEGSIFRIEWSSCGSKLVSVSDDRSARIW 283
                 S+SD K  KL ++      L  L GH  S++ + +S  G  + S SDD++ ++W
Sbjct: 279 ------SASDDKTVKLWNRNGQL--LQTLTGHSSSVWGVAFSPDGQTIASASDDKTVKLW 330
Query: 284 EVRAEYWKDSDSIEEVGSSVLYGHNARVWDCCLT--DSFIITAGEDCTCRVWGSDGKQLK 341
               ++ +            L GH++ VW    +     I +A +D T ++W  +G+ L+
Sbjct: 331 NRNGQHLQ-----------TLTGHSSSVWGVAFSPDGQTIASASDDKTVKLWNRNGQLLQ 379
Query: 342 MIKEHIG--RGIWRCLYDSLSSLLVTAGFDSAIKVHQFQAFLPGSLESHPEA 391
            +  H    RG+    +      + +A  D  +K+      L  +L  H  +
Sbjct: 380 TLTGHSSSVRGV---AFSPDGQTIASASDDKTVKLWNRNGQLLQTLTGHSSS 428
>pdb|2YMU|A Chain A, Structure Of A Highly Repetitive Propeller Structure Length = 577 Back     alignment and structure
>pdb|1ERJ|A Chain A, Crystal Structure Of The C-Terminal Wd40 Domain Of Tup1 Length = 393 Back     alignment and structure
>pdb|2CNX|A Chain A, Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2.1 Angstrom Length = 315 Back     alignment and structure
>pdb|2CO0|A Chain A, Wdr5 And Unmodified Histone H3 Complex At 2.25 Angstrom Length = 315 Back     alignment and structure
>pdb|3EMH|A Chain A, Structural Basis Of Wdr5-Mll Interaction Length = 318 Back     alignment and structure
>pdb|4A7J|A Chain A, Symmetric Dimethylation Of H3 Arginine 2 Is A Novel Histone Mark That Supports Euchromatin Maintenance Length = 318 Back     alignment and structure
>pdb|2H68|A Chain A, Histone H3 Recognition And Presentation By The Wdr5 Module Of The Mll1 Complex Length = 312 Back     alignment and structure
>pdb|2G9A|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 311 Back     alignment and structure
>pdb|2G99|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 308 Back     alignment and structure
>pdb|2XL2|A Chain A, Wdr5 In Complex With An Rbbp5 Peptide Recruited To Novel Site Length = 334 Back     alignment and structure
>pdb|2H9L|A Chain A, Wdr5delta23 Length = 329 Back     alignment and structure
>pdb|2H9M|A Chain A, Wdr5 In Complex With Unmodified H3k4 Peptide Length = 313 Back     alignment and structure
>pdb|3SMR|A Chain A, Crystal Structure Of Human Wd Repeat Domain 5 With Compound Length = 312 Back     alignment and structure
>pdb|2H13|A Chain A, Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length = 317 Back     alignment and structure
>pdb|3PSL|A Chain A, Fine-Tuning The Stimulation Of Mll1 Methyltransferase Activity By A Histone H3 Based Peptide Mimetic Length = 318 Back     alignment and structure
>pdb|2GNQ|A Chain A, Structure Of Wdr5 Length = 336 Back     alignment and structure
>pdb|3N0D|A Chain A, Crystal Structure Of Wdr5 Mutant (W330f) Length = 315 Back     alignment and structure
>pdb|3N0E|A Chain A, Crystal Structure Of Wdr5 Mutant (W330y) Length = 315 Back     alignment and structure
>pdb|3MXX|A Chain A, Crystal Structure Of Wdr5 Mutant (S62a) Length = 315 Back     alignment and structure
>pdb|1NEX|B Chain B, Crystal Structure Of Scskp1-Sccdc4-Cpd Peptide Complex Length = 464 Back     alignment and structure
>pdb|3MKS|B Chain B, Crystal Structure Of Yeast Cdc4SKP1 IN COMPLEX WITH AN ALLOSTERIC Inhibitor Scf-I2 Length = 464 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query821
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 100.0
2ymu_A577 WD-40 repeat protein; unknown function, two domain 100.0
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 100.0
2ymu_A577 WD-40 repeat protein; unknown function, two domain 100.0
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 100.0
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 100.0
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 100.0
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 100.0
2oaj_A902 Protein SNI1; WD40 repeat, beta propeller, endocyt 100.0
2oaj_A902 Protein SNI1; WD40 repeat, beta propeller, endocyt 100.0
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 100.0
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 100.0
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 100.0
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 100.0
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 100.0
3ow8_A321 WD repeat-containing protein 61; structural genomi 100.0
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 100.0
3ow8_A321 WD repeat-containing protein 61; structural genomi 100.0
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 100.0
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 100.0
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 100.0
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 100.0
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 100.0
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 100.0
4g56_B357 MGC81050 protein; protein arginine methyltransfera 100.0
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 100.0
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 100.0
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 100.0
4g56_B357 MGC81050 protein; protein arginine methyltransfera 100.0
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 100.0
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 100.0
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 100.0
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 100.0
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 100.0
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 100.0
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 100.0
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 100.0
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 100.0
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 100.0
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 100.0
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 100.0
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 100.0
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 100.0
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 100.0
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 100.0
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 100.0
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 100.0
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 100.0
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 100.0
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 100.0
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 100.0
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 100.0
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 100.0
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 100.0
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 100.0
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 100.0
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 100.0
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 100.0
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 100.0
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 100.0
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 100.0
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 100.0
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 99.98
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 99.98
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 99.98
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 99.98
4e54_B435 DNA damage-binding protein 2; beta barrel, double 99.98
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 99.97
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 99.97
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 99.97
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 99.97
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 99.97
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 99.97
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 99.97
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 99.97
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 99.97
2pm7_B297 Protein transport protein SEC13, protein transport 99.97
2pm7_B297 Protein transport protein SEC13, protein transport 99.97
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 99.97
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 99.97
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 99.97
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 99.97
2j04_A588 TAU60, YPL007P, hypothetical protein YPL007C; beta 99.97
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 99.97
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 99.97
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 99.97
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 99.97
4e54_B435 DNA damage-binding protein 2; beta barrel, double 99.97
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 99.97
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 99.97
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 99.97
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 99.97
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 99.96
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 99.96
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 99.96
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 99.96
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 99.96
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 99.96
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 99.96
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 99.96
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 99.96
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 99.96
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 99.96
3jrp_A379 Fusion protein of protein transport protein SEC13 99.96
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.96
2j04_A588 TAU60, YPL007P, hypothetical protein YPL007C; beta 99.96
1k32_A 1045 Tricorn protease; protein degradation, substrate g 99.95
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.95
3jrp_A379 Fusion protein of protein transport protein SEC13 99.95
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 99.95
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.95
3jro_A753 Fusion protein of protein transport protein SEC13 99.95
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 99.95
2xyi_A430 Probable histone-binding protein CAF1; transcripti 99.94
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 99.94
3jro_A753 Fusion protein of protein transport protein SEC13 99.94
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 99.94
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.93
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.93
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.93
1k32_A 1045 Tricorn protease; protein degradation, substrate g 99.93
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.93
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.93
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.93
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.93
2xyi_A430 Probable histone-binding protein CAF1; transcripti 99.92
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.92
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.92
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.9
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 99.88
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 99.85
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.85
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.84
1xfd_A723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.83
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.8
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.8
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.79
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.79
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.79
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.78
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.78
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.78
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.78
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.76
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.75
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.74
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.73
1xfd_A723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.73
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.72
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.72
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.71
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.71
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.7
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.69
1z68_A719 Fibroblast activation protein, alpha subunit; sepr 99.68
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.67
1z68_A719 Fibroblast activation protein, alpha subunit; sepr 99.64
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.64
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.62
4a5s_A740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.61
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.59
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.57
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.56
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 99.52
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.52
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 99.51
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.49
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.49
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 99.48
4a5s_A740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.47
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 99.46
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.44
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.41
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 99.4
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 99.4
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.39
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.38
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 99.36
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 99.36
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 99.35
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 99.35
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 99.35
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 99.33
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 99.32
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.32
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.28
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 99.27
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.25
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 99.24
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 99.24
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 99.22
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 99.18
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 99.18
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 99.17
4a2l_A795 BT_4663, two-component system sensor histidine kin 99.15
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 99.15
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 99.14
4a2l_A795 BT_4663, two-component system sensor histidine kin 99.13
1xip_A388 Nucleoporin NUP159; beta-propeller, transport prot 99.1
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 99.08
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 99.06
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 99.04
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 99.04
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 98.98
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 98.96
1xip_A388 Nucleoporin NUP159; beta-propeller, transport prot 98.96
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 98.96
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 98.95
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 98.94
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 98.92
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 98.92
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 98.89
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 98.88
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 98.88
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 98.88
3ei3_A1158 DNA damage-binding protein 1; UV-damage, DDB, nucl 98.81
2qe8_A343 Uncharacterized protein; structural genomics, join 98.79
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 98.78
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 98.78
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 98.77
3v9f_A781 Two-component system sensor histidine kinase/RESP 98.74
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 98.73
1kb0_A677 Quinohemoprotein alcohol dehydrogenase; beta-prope 98.72
3v9f_A781 Two-component system sensor histidine kinase/RESP 98.72
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 98.69
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 98.67
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 98.65
1yiq_A689 Quinohemoprotein alcohol dehydrogenase; electron t 98.62
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 98.61
1yiq_A689 Quinohemoprotein alcohol dehydrogenase; electron t 98.6
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 98.6
2hz6_A369 Endoplasmic reticulum to nucleus signalling 1 isof 98.57
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 98.57
3ei3_A1158 DNA damage-binding protein 1; UV-damage, DDB, nucl 98.53
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 98.53
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 98.52
1kb0_A677 Quinohemoprotein alcohol dehydrogenase; beta-prope 98.52
2ece_A462 462AA long hypothetical selenium-binding protein; 98.5
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 98.48
2qe8_A343 Uncharacterized protein; structural genomics, join 98.47
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 98.39
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 98.36
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 98.34
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 98.32
2hz6_A369 Endoplasmic reticulum to nucleus signalling 1 isof 98.31
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 98.29
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 98.29
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 98.26
2ece_A462 462AA long hypothetical selenium-binding protein; 98.25
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 98.2
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 98.18
1kv9_A668 Type II quinohemoprotein alcohol dehydrogenase; el 98.14
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 98.07
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 97.92
1kv9_A668 Type II quinohemoprotein alcohol dehydrogenase; el 97.91
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 97.88
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 97.88
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 97.85
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 97.82
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 97.8
2fp8_A322 Strictosidine synthase; six bladed beta propeller 97.7
2p4o_A306 Hypothetical protein; putative lactonase, structur 97.67
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 97.63
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 97.58
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 97.5
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 97.48
2fp8_A322 Strictosidine synthase; six bladed beta propeller 97.36
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 97.33
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 97.33
2p4o_A306 Hypothetical protein; putative lactonase, structur 97.24
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 97.17
3v65_B386 Low-density lipoprotein receptor-related protein; 97.09
2xzh_A365 Clathrin heavy chain 1; endocytosis, endocytosis i 97.09
2xe4_A751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 97.05
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 97.02
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 97.01
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 96.94
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 96.93
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 96.93
3v65_B386 Low-density lipoprotein receptor-related protein; 96.84
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 96.84
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 96.76
3p5b_L400 Low density lipoprotein receptor variant; B-propel 96.62
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 96.6
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 96.59
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 96.58
2xe4_A751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 96.46
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 96.35
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 96.17
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 96.09
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 96.0
1bpo_A494 Protein (clathrin); clathrin endocytosis beta-prop 95.99
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 95.99
3p5b_L400 Low density lipoprotein receptor variant; B-propel 95.82
3pbp_A452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 95.6
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 95.32
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 95.27
2xzh_A365 Clathrin heavy chain 1; endocytosis, endocytosis i 95.19
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 95.15
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 95.06
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 94.83
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 94.81
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 94.68
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 94.59
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 94.3
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 94.12
3pbp_A452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 94.02
4a0p_A628 LRP6, LRP-6, low-density lipoprotein receptor-rela 93.88
1bpo_A494 Protein (clathrin); clathrin endocytosis beta-prop 93.78
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 93.67
3kya_A496 Putative phosphatase; structural genomics, joint c 93.12
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 92.98
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 92.85
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 92.78
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 92.63
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 92.62
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 92.59
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 92.33
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 92.17
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 91.46
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 90.22
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 90.09
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 89.97
4a0p_A628 LRP6, LRP-6, low-density lipoprotein receptor-rela 89.67
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 89.3
3das_A347 Putative oxidoreductase; aldose sugar dehydrogenas 89.01
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 88.36
1suu_A312 DNA gyrase subunit A; topoisomerase,DNA gyrase, be 88.19
1cru_A454 Protein (soluble quinoprotein glucose dehydrogena; 87.92
3kya_A496 Putative phosphatase; structural genomics, joint c 87.69
3l6v_A370 GYRA, DNA gyrase subunit A; gyrase A C-terminal do 87.69
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 83.32
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 82.09
3uc1_A327 DNA gyrase subunit A; DNA binding protein, topoiso 81.53
1zi0_A307 DNA gyrase subunit A; beta pinwheel, topoisomerase 80.49
2g8s_A353 Glucose/sorbosone dehydrogenases; bladed beta-prop 80.21
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
Probab=100.00  E-value=4.2e-53  Score=483.22  Aligned_cols=528  Identities=16%  Similarity=0.214  Sum_probs=380.4

Q ss_pred             CCCCcceeeccce-------eeeeeEEEEEeccCCCCCCcceEEeec-CCeEEEEECCCCe--eeeEEEeeccccEEeEE
Q 003423            3 KKDLSEWRLDVGQ-------YLGEISALCFVHLPSHLSSLPFLLAGS-GSQVLLYDLEAGT--LIRPFQVFHGIRLHGIS   72 (821)
Q Consensus         3 ~~~i~~w~~~~~~-------~~~~Vt~l~~~~~p~~~~~~~~l~~g~-~~~i~iwd~~t~~--~~~~~~~~~~~~i~~i~   72 (821)
                      ++++++|++.+++       |..+|++++|+  ||    +++|++|. |+.|+|||+.+++  ....+..+.+ +|.+++
T Consensus        38 ~~~v~l~~~~~~~~~~~~~~h~~~v~~~~~s--pd----g~~lasg~~d~~v~lWd~~~~~~~~~~~~~~~~~-~v~~v~  110 (611)
T 1nr0_A           38 GTSVYTVPVGSLTDTEIYTEHSHQTTVAKTS--PS----GYYCASGDVHGNVRIWDTTQTTHILKTTIPVFSG-PVKDIS  110 (611)
T ss_dssp             TTEEEEEETTCSSCCEEECCCSSCEEEEEEC--TT----SSEEEEEETTSEEEEEESSSTTCCEEEEEECSSS-CEEEEE
T ss_pred             CCEEEEecCCCcccCeEecCCCCceEEEEEC--CC----CcEEEEEeCCCCEEEeECCCCcceeeEeecccCC-ceEEEE
Confidence            4578999998654       77899999999  99    78888877 8999999997654  3455665554 799999


Q ss_pred             eccccCCCCCCccceeeEEEEEc-C----CeEEEEEEeecCCCCCCCCCccccccceeeeccCCCCcEEEEEEeecCCCC
Q 003423           73 CNFINCTEGSVSTRVTFEVALFG-E----KRVKLFELNFELSPNSQYQPETCVNLSLVQSLPRLSHWVFDVCFLKVCNGN  147 (821)
Q Consensus        73 ~~~~~~~~~~~~~~~~~~l~~~g-~----~~v~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~h~~~I~~~~~~~~~~~~  147 (821)
                      |+|++           ..+++.+ +    +.|++|+..                 +....+.+|.+.|++++|+|   ++
T Consensus       111 fs~dg-----------~~l~~~~~~~~~~~~v~~wd~~-----------------~~~~~l~gh~~~v~~v~f~p---~~  159 (611)
T 1nr0_A          111 WDSES-----------KRIAAVGEGRERFGHVFLFDTG-----------------TSNGNLTGQARAMNSVDFKP---SR  159 (611)
T ss_dssp             ECTTS-----------CEEEEEECCSSCSEEEEETTTC-----------------CBCBCCCCCSSCEEEEEECS---SS
T ss_pred             ECCCC-----------CEEEEEECCCCceeEEEEeeCC-----------------CCcceecCCCCCceEEEECC---CC
Confidence            99763           3555544 3    367777732                 23456789999999999999   87


Q ss_pred             C-EEEEEECCCcEEEEEccCCceeEEEccCcceeEEEEeeccCCccCeEEEEEeeCCEEEEEEcccCCcccCCCCCCCcc
Q 003423          148 R-SLAIGCSDNSIRVWDISNSSIILEVHSPERCLLYSMKLWGDNLEALRIASGTIYNEIIVWKVDWEHVAPLLNSPEGNH  226 (821)
Q Consensus       148 ~-~l~t~~~d~~i~iwd~~~~~~~~~~~~~~~~~~~s~~~~~~s~~~~~l~sg~~dg~i~vwd~~~~~~~~~~~~~~~~~  226 (821)
                      . .|++|+.|++|++||..+++....+..|.. .+.+++|   +|++.+||+|+.|+.|++||..               
T Consensus       160 ~~~l~s~s~D~~v~lwd~~~~~~~~~l~~H~~-~V~~v~f---spdg~~las~s~D~~i~lwd~~---------------  220 (611)
T 1nr0_A          160 PFRIISGSDDNTVAIFEGPPFKFKSTFGEHTK-FVHSVRY---NPDGSLFASTGGDGTIVLYNGV---------------  220 (611)
T ss_dssp             SCEEEEEETTSCEEEEETTTBEEEEEECCCSS-CEEEEEE---CTTSSEEEEEETTSCEEEEETT---------------
T ss_pred             CeEEEEEeCCCeEEEEECCCCeEeeeeccccC-ceEEEEE---CCCCCEEEEEECCCcEEEEECC---------------
Confidence            6 699999999999999998888888877654 5778888   6899999999999999999987               


Q ss_pred             cCCCCCCcceeeecccccceeeEEEEe-------cCCCcEEEEEEcCCCCEEEEEeCCCeEEEEecccCcccCCCCceee
Q 003423          227 AHGSSSDFKCFKLQDQQHTAVNLFRLV-------GHEGSIFRIEWSSCGSKLVSVSDDRSARIWEVRAEYWKDSDSIEEV  299 (821)
Q Consensus       227 ~~~~~~~~~~~~~~~~~~~~~~~~~~~-------~h~~~I~~l~~s~~~~~l~s~s~Dg~i~iwd~~~~~~~~~~~~~~~  299 (821)
                                        ....+..+.       +|.+.|.+++|+|++++|+|++.|++|++||+.+++.     ...+
T Consensus       221 ------------------~g~~~~~~~~~~~~~~~h~~~V~~v~~spdg~~l~s~s~D~~v~lWd~~~~~~-----~~~~  277 (611)
T 1nr0_A          221 ------------------DGTKTGVFEDDSLKNVAHSGSVFGLTWSPDGTKIASASADKTIKIWNVATLKV-----EKTI  277 (611)
T ss_dssp             ------------------TCCEEEECBCTTSSSCSSSSCEEEEEECTTSSEEEEEETTSEEEEEETTTTEE-----EEEE
T ss_pred             ------------------CCcEeeeeccccccccccCCCEEEEEECCCCCEEEEEeCCCeEEEEeCCCCce-----eeee
Confidence                              444455553       7999999999999999999999999999999988755     3211


Q ss_pred             eceEEeccceeEEEEEEcCCEEEEEeCCCeEEEEcC-CCceeeEeecccCCCeEEEEEecCCCEEEEEeCCCcEEEEEcC
Q 003423          300 GSSVLYGHNARVWDCCLTDSFIITAGEDCTCRVWGS-DGKQLKMIKEHIGRGIWRCLYDSLSSLLVTAGFDSAIKVHQFQ  378 (821)
Q Consensus       300 ~~~~~~~h~~~i~~v~~~~~~l~s~~~dg~i~iwd~-~~~~~~~~~~h~~~~i~~l~~~~~~~~l~tg~~dg~I~iwd~~  378 (821)
                        ..-..+...+..+.|.+..+++++.|+++++|+. .++....+.+|.. .|++++|+|++++|++++.|+.|++||+.
T Consensus       278 --~~~~~~~~~~~~~~~~~~~l~s~s~d~~i~~~~~~~~~~~~~~~gh~~-~v~~l~~spdg~~l~s~s~D~~v~~Wd~~  354 (611)
T 1nr0_A          278 --PVGTRIEDQQLGIIWTKQALVSISANGFINFVNPELGSIDQVRYGHNK-AITALSSSADGKTLFSADAEGHINSWDIS  354 (611)
T ss_dssp             --ECCSSGGGCEEEEEECSSCEEEEETTCCEEEEETTTTEEEEEECCCSS-CEEEEEECTTSSEEEEEETTSCEEEEETT
T ss_pred             --cCCCCccceeEEEEEcCCEEEEEeCCCcEEEEeCCCCCcceEEcCCCC-CEEEEEEeCCCCEEEEEeCCCcEEEEECC
Confidence              0112344567788888899999999999999999 5677778889988 69999999999999999999999999996


Q ss_pred             CcCC-Ccc-cCCc---cccccCCCcceEEeecCCcccceeccCC--------------CCcceEEEEeecCCeEEEEecC
Q 003423          379 AFLP-GSL-ESHP---EAKEFNGRTEIFSIKIPNFSEQIRLTDS--------------KSEYVRCLHLTSEDTLYIATNH  439 (821)
Q Consensus       379 ~~~~-~~~-~~~~---~~~~~~~~~~~~~~~~~~~~~~~~~~~~--------------~~~~i~~l~f~~~~~~l~~~~~  439 (821)
                      .... ..+ .+|.   ..+.+.+...++.....   ..+..+..              ....+..++|+|++..++++.+
T Consensus       355 ~~~~~~~~~~~h~~~v~~~~~s~~~~l~s~s~d---~~v~~w~~~~~~~~~~~~~~~~~~~~~~~~~~s~dg~~~~~~~~  431 (611)
T 1nr0_A          355 TGISNRVFPDVHATMITGIKTTSKGDLFTVSWD---DHLKVVPAGGSGVDSSKAVANKLSSQPLGLAVSADGDIAVAACY  431 (611)
T ss_dssp             TCCEEECSSCSCSSCEEEEEECTTSCEEEEETT---TEEEEECSSSSSSCTTSCCEEECSSCEEEEEECTTSSCEEEEES
T ss_pred             CCceeeecccCCcceEEEEEECCCCcEEEEEcC---CceEEeecCCccccccceeeeecCCCCcEEEEeCCCcEEEEEeC
Confidence            5321 111 1221   11222222222222211   11111111              1123556677777655554444


Q ss_pred             CcEEEEEecCCCcceeeEeeeccCCcceEEEeccCCCCCCCCCCCcEEEEecCCccEEEEEecCCCCCCcceeEEeeccC
Q 003423          440 GYLYHTKLCDMDSVNWNKILQVSEGMPIICMDLLSNEPKYPCGIDDWVALGDGKGNMTIVRVVGDVHTPQLSFTFTWSAG  519 (821)
Q Consensus       440 g~~~~~~i~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~s~~~~~~l~~g~~~g~i~i~~~~~~~~~~~~~~~~~~~~~  519 (821)
                      +.+.   +|+...     +........+.++.+.+        +++++++|+.|+.|++|++.+.....   .....+  
T Consensus       432 ~~v~---~~~~~~-----~~~~~~~~~v~~va~sp--------dg~~lasgs~D~~v~lwd~~~~~~~~---~~~~~h--  490 (611)
T 1nr0_A          432 KHIA---IYSHGK-----LTEVPISYNSSCVALSN--------DKQFVAVGGQDSKVHVYKLSGASVSE---VKTIVH--  490 (611)
T ss_dssp             SEEE---EEETTE-----EEEEECSSCEEEEEECT--------TSCEEEEEETTSEEEEEEEETTEEEE---EEEEEC--
T ss_pred             ceEE---EEeCCc-----eeeeecCCCceEEEEeC--------CCCEEEEeCCCCeEEEEEccCCceee---eeccCC--
Confidence            4443   332211     11112345566777654        56999999999999999987643210   011111  


Q ss_pred             ccceeeeeEEeecCCCeEEEEECCCCcEEEeeecCCCCcccccCCccceeeeeEE-EecccCceEEEEEeecCCCEEEEE
Q 003423          520 IERQLLGTYWCKSLGHRFIFTADPKGRLKLWQLCDPFSSVCYESSKTNNVFLVAE-FSSCFGARIMCLDASFEDEVLFCG  598 (821)
Q Consensus       520 ~~~~~~~~~~~~~~~~~~l~~~~~dg~i~iwd~~~~~~~~~~~~~~~~~~~~~~~-~~~~h~~~I~~l~~s~~~~~L~sg  598 (821)
                       ...+.  ..+++|++++|++++.|++|++|++....             ++... ....|...|++++|+|++++||+|
T Consensus       491 -~~~v~--~v~fspdg~~las~s~d~~v~~w~~~~~~-------------~~~~~~~~~~H~~~V~~v~fspdg~~lasg  554 (611)
T 1nr0_A          491 -PAEIT--SVAFSNNGAFLVATDQSRKVIPYSVANNF-------------ELAHTNSWTFHTAKVACVSWSPDNVRLATG  554 (611)
T ss_dssp             -SSCEE--EEEECTTSSEEEEEETTSCEEEEEGGGTT-------------EESCCCCCCCCSSCEEEEEECTTSSEEEEE
T ss_pred             -CCceE--EEEECCCCCEEEEEcCCCCEEEEEcCCCC-------------ceeeeeeeeecccceeEEEECCCCCEEEEE
Confidence             12222  24688999999999999999999987621             22221 113489999999999999999999


Q ss_pred             cCCCcEEEEecCcccccccccccccccCcccccccccCCcceEEEEEEecCCCceEEEEecCCCeEEEEEe
Q 003423          599 DLRGNLVLFPLLRDLLNDKSVALHVEVSPLNYFKGAHGISTVSTLSVAKLRSNQTEIRSTGGDGCICYLEY  669 (821)
Q Consensus       599 s~dG~i~iw~~~~~~~~~~~~~~~~~~~~~~~~~~~h~~~~Vt~i~~~~~~~~~~~l~t~g~Dg~i~iw~~  669 (821)
                      +.||+|++|++...           ....+..+ ..|....|++++|.|   ++. |+|+|.||+|++|++
T Consensus       555 s~D~~v~lW~~~~~-----------~~~~~~~~-~~h~~~~v~~v~fs~---d~~-l~s~~~D~~i~lW~~  609 (611)
T 1nr0_A          555 SLDNSVIVWNMNKP-----------SDHPIIIK-GAHAMSSVNSVIWLN---ETT-IVSAGQDSNIKFWNV  609 (611)
T ss_dssp             ETTSCEEEEETTCT-----------TSCCEEET-TSSTTSCEEEEEEEE---TTE-EEEEETTSCEEEEEC
T ss_pred             ECCCcEEEEECCCc-----------ccccchhh-ccCcccCeeEEEEcC---CCE-EEEecCCCCEEEEec
Confidence            99999999998742           00111223 256567899999995   445 999999999999997
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3ei3_A DNA damage-binding protein 1; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Homo sapiens} PDB: 3ei1_A* 3ei2_A* 3ei4_A* 4a0l_A* 3e0c_A* 3i7k_A* 3i7h_A* 3i7l_A* 3i7n_A* 3i7o_A* 3i7p_A* 3i89_A* 3i8c_A* 3i8e_A* 2b5l_A 2b5m_A 2hye_A* 4a11_A* 4a0k_C* 4a0a_A* ... Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3ei3_A DNA damage-binding protein 1; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Homo sapiens} PDB: 3ei1_A* 3ei2_A* 3ei4_A* 4a0l_A* 3e0c_A* 3i7k_A* 3i7h_A* 3i7l_A* 3i7n_A* 3i7o_A* 3i7p_A* 3i89_A* 3i8c_A* 3i8e_A* 2b5l_A 2b5m_A 2hye_A* 4a11_A* 4a0k_C* 4a0a_A* ... Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>1bpo_A Protein (clathrin); clathrin endocytosis beta-propeller coated-PITS, membrane PR; 2.60A {Rattus norvegicus} SCOP: a.118.1.4 b.69.6.1 Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>1bpo_A Protein (clathrin); clathrin endocytosis beta-propeller coated-PITS, membrane PR; 2.60A {Rattus norvegicus} SCOP: a.118.1.4 b.69.6.1 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>1suu_A DNA gyrase subunit A; topoisomerase,DNA gyrase, beta-propeller, beta-pinwheel, ISO; HET: DNA; 1.75A {Borrelia burgdorferi} SCOP: b.68.10.1 Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3l6v_A GYRA, DNA gyrase subunit A; gyrase A C-terminal domain, GYRA C-terminal domain, DNA wrapping, beta-strand-bearing proline, ATP-binding; HET: DNA; 2.19A {Xanthomonas campestris PV} Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>3uc1_A DNA gyrase subunit A; DNA binding protein, topoisomerase, isomerase; HET: DNA; 1.65A {Mycobacterium tuberculosis} Back     alignment and structure
>1zi0_A DNA gyrase subunit A; beta pinwheel, topoisomerase, spiralling beta pinwheel, DNA wrapping, isomerase, DNA bindng protein; HET: DNA; 2.60A {Escherichia coli} Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 821
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 1e-11
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 8e-09
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 6e-11
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 2e-10
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 3e-10
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 8e-05
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 7e-04
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 5e-08
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 7e-06
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 8e-04
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 6e-08
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 5e-05
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 6e-05
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 0.002
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 8e-08
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 2e-06
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 1e-05
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 2e-07
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 0.003
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 2e-06
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 2e-04
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 0.001
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 1e-05
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 7e-05
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 0.002
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 1e-05
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 2e-04
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 2e-05
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 1e-04
d2bbkh_355 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 5e-04
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 7e-04
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 0.001
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 0.004
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 0.002
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 0.004
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure

class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Platelet-activating factor acetylhydrolase IB subunit alpha
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 64.4 bits (155), Expect = 1e-11
 Identities = 50/331 (15%), Positives = 102/331 (30%), Gaps = 47/331 (14%)

Query: 18  GEISALCFVHLPSHLSSLPFLLAGSGSQVLLYDLEAGTLIRPFQVFHGIRLHGISCNFIN 77
             ++ + F  + S + S     A   + + ++D E G   R  +            +   
Sbjct: 18  SPVTRVIFHPVFSVMVS-----ASEDATIKVWDYETGDFERTLKGHTDSVQDISFDHSGK 72

Query: 78  CTEGSVSTRVTFEVALFGEKRVKLFELNFELSPNSQYQPETCVNLSLVQSLPRLSHWVFD 137
                 +          G + ++    +     +    P     +S  +        V  
Sbjct: 73  LLASCSADMTIKLWDFQGFECIRTMHGHDHNVSSVSIMPNGDHIVSASRDKTIKMWEVQT 132

Query: 138 VCFLKVCNGNRS-------------LAIGCSDNSIRVWDISNSSIILEVHSPERCLLYSM 184
              +K   G+R              +A   +D ++RVW ++      E+      +   +
Sbjct: 133 GYCVKTFTGHREWVRMVRPNQDGTLIASCSNDQTVRVWVVATKECKAELREHRHVV-ECI 191

Query: 185 KLWGDNLEALRIASGTIYNEIIVWKVDWEHVAPLLNSPEGNHAHGSSSDFKCFKLQDQQH 244
               ++                    +        +   G      S D K  K+ D   
Sbjct: 192 SWAPES--------------SYSSISEATGSETKKSGKPGPFLLSGSRD-KTIKMWDVS- 235

Query: 245 TAVNLFRLVGHEGSIFRIEWSSCGSKLVSVSDDRSARIWEVRAEYWKDSDSIEEVGSSVL 304
           T + L  LVGH+  +  + + S G  ++S +DD++ R+W        D  +   +    L
Sbjct: 236 TGMCLMTLVGHDNWVRGVLFHSGGKFILSCADDKTLRVW--------DYKNKRCM--KTL 285

Query: 305 YGHNARVWDCCL--TDSFIITAGEDCTCRVW 333
             H   V       T  +++T   D T +VW
Sbjct: 286 NAHEHFVTSLDFHKTAPYVVTGSVDQTVKVW 316
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 355 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query821
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 100.0
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 100.0
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 100.0
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 100.0
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 100.0
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 100.0
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 100.0
d1tbga_340 beta1-subunit of the signal-transducing G protein 100.0
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 99.98
d1tbga_340 beta1-subunit of the signal-transducing G protein 99.98
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 99.97
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.97
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 99.97
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 99.97
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 99.97
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 99.97
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.96
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.95
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.95
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.94
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.94
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.94
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.94
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.94
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.93
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.92
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.91
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.9
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.89
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.87
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.86
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.82
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.81
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.79
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.76
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.7
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.69
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.68
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.68
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.59
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.58
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.57
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.56
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.52
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.43
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.14
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.12
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 99.07
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.06
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 99.01
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 98.97
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 98.64
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 98.53
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 98.5
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 98.42
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 98.36
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 98.33
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 98.29
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 98.28
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 98.19
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 98.14
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 98.14
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 98.01
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 97.91
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 97.82
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 97.74
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 97.49
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 97.36
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 97.17
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 97.06
d1utca2327 Clathrin heavy-chain terminal domain {Rat (Rattus 96.46
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 95.92
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 95.8
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 95.37
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 95.34
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 94.73
d1h6la_353 Thermostable phytase (3-phytase) {Bacillus amyloli 94.35
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 94.24
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 93.95
d1utca2327 Clathrin heavy-chain terminal domain {Rat (Rattus 93.85
d1w6sa_596 Methanol dehydrogenase, heavy chain {Methylobacter 93.51
d1wp5a_323 Topoisomerase IV subunit A, ParC, C-terminal domai 92.52
d1flga_582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 87.87
d1h6la_353 Thermostable phytase (3-phytase) {Bacillus amyloli 87.15
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 86.94
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 83.23
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Groucho/tle1, C-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=3e-33  Score=292.29  Aligned_cols=280  Identities=13%  Similarity=0.185  Sum_probs=234.9

Q ss_pred             eeeeeeEEEEEeccCCCCCCcceEEeecCCeEEEEECCCCeee---eEEE-eeccccEEeEEeccccCCCCCCccceeeE
Q 003423           15 QYLGEISALCFVHLPSHLSSLPFLLAGSGSQVLLYDLEAGTLI---RPFQ-VFHGIRLHGISCNFINCTEGSVSTRVTFE   90 (821)
Q Consensus        15 ~~~~~Vt~l~~~~~p~~~~~~~~l~~g~~~~i~iwd~~t~~~~---~~~~-~~~~~~i~~i~~~~~~~~~~~~~~~~~~~   90 (821)
                      .|..+|+|++|+  |+    +++|++|.|+.|+|||++++...   .... ..+...|.+++|+|++          ..+
T Consensus        49 ~H~~~V~~v~fs--~~----g~~latg~dg~V~iWd~~~~~~~~~~~~~~~~~h~~~I~~v~~s~dg----------~~l  112 (337)
T d1gxra_          49 NHGEVVCAVTIS--NP----TRHVYTGGKGCVKVWDISHPGNKSPVSQLDCLNRDNYIRSCKLLPDG----------CTL  112 (337)
T ss_dssp             CCSSCCCEEEEC--SS----SSEEEEECBSEEEEEETTSTTCCSCSEEEECSCTTSBEEEEEECTTS----------SEE
T ss_pred             CCCCcEEEEEEC--CC----CCEEEEEECCEEEEEEccCCcccceeEEeeecCCCCcEEEEEEcCCC----------CEE
Confidence            478999999999  98    78999999999999999876433   2222 1234479999999763          245


Q ss_pred             EEEEcCCeEEEEEEeecCCCCCCCCCccccccceeeeccCCCCcEEEEEEeecCCCCCEEEEEECCCcEEEEEccCCcee
Q 003423           91 VALFGEKRVKLFELNFELSPNSQYQPETCVNLSLVQSLPRLSHWVFDVCFLKVCNGNRSLAIGCSDNSIRVWDISNSSII  170 (821)
Q Consensus        91 l~~~g~~~v~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~h~~~I~~~~~~~~~~~~~~l~t~~~d~~i~iwd~~~~~~~  170 (821)
                      +++..|+.|++||+....             .+....+.+|...|.+++|+|   ++.++++++.|+.|++||+.+++..
T Consensus       113 ~s~~~dg~i~iwd~~~~~-------------~~~~~~~~~~~~~v~~~~~~~---~~~~l~s~~~d~~i~~~~~~~~~~~  176 (337)
T d1gxra_         113 IVGGEASTLSIWDLAAPT-------------PRIKAELTSSAPACYALAISP---DSKVCFSCCSDGNIAVWDLHNQTLV  176 (337)
T ss_dssp             EEEESSSEEEEEECCCC---------------EEEEEEECSSSCEEEEEECT---TSSEEEEEETTSCEEEEETTTTEEE
T ss_pred             EEeecccccccccccccc-------------ccccccccccccccccccccc---ccccccccccccccccccccccccc
Confidence            556678999999987543             356677889999999999999   9999999999999999999999887


Q ss_pred             EEEccCcceeEEEEeeccCCccCeEEEEEeeCCEEEEEEcccCCcccCCCCCCCcccCCCCCCcceeeecccccceeeEE
Q 003423          171 LEVHSPERCLLYSMKLWGDNLEALRIASGTIYNEIIVWKVDWEHVAPLLNSPEGNHAHGSSSDFKCFKLQDQQHTAVNLF  250 (821)
Q Consensus       171 ~~~~~~~~~~~~s~~~~~~s~~~~~l~sg~~dg~i~vwd~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  250 (821)
                      .....+.. .+.++++   ++++..+++|+.||.|++||+.                                 +.+.+.
T Consensus       177 ~~~~~~~~-~v~~l~~---s~~~~~~~~~~~d~~v~i~d~~---------------------------------~~~~~~  219 (337)
T d1gxra_         177 RQFQGHTD-GASCIDI---SNDGTKLWTGGLDNTVRSWDLR---------------------------------EGRQLQ  219 (337)
T ss_dssp             EEECCCSS-CEEEEEE---CTTSSEEEEEETTSEEEEEETT---------------------------------TTEEEE
T ss_pred             cccccccc-ccccccc---cccccccccccccccccccccc---------------------------------cceeec
Confidence            77766554 3566766   5788999999999999999998                                 455555


Q ss_pred             EEecCCCcEEEEEEcCCCCEEEEEeCCCeEEEEecccCcccCCCCceeeeceEEeccceeEEEEEEc--CCEEEEEeCCC
Q 003423          251 RLVGHEGSIFRIEWSSCGSKLVSVSDDRSARIWEVRAEYWKDSDSIEEVGSSVLYGHNARVWDCCLT--DSFIITAGEDC  328 (821)
Q Consensus       251 ~~~~h~~~I~~l~~s~~~~~l~s~s~Dg~i~iwd~~~~~~~~~~~~~~~~~~~~~~h~~~i~~v~~~--~~~l~s~~~dg  328 (821)
                      .+ .|.+.|.+++|+|++++|++++.|+.+++||++....           .....|...|++++|+  +++|++++.||
T Consensus       220 ~~-~~~~~i~~l~~~~~~~~l~~~~~d~~i~i~d~~~~~~-----------~~~~~~~~~i~~v~~s~~g~~l~s~s~Dg  287 (337)
T d1gxra_         220 QH-DFTSQIFSLGYCPTGEWLAVGMESSNVEVLHVNKPDK-----------YQLHLHESCVLSLKFAYCGKWFVSTGKDN  287 (337)
T ss_dssp             EE-ECSSCEEEEEECTTSSEEEEEETTSCEEEEETTSSCE-----------EEECCCSSCEEEEEECTTSSEEEEEETTS
T ss_pred             cc-ccccceEEEEEcccccccceecccccccccccccccc-----------ccccccccccceEEECCCCCEEEEEeCCC
Confidence            54 5899999999999999999999999999999998765           5778899999999998  47999999999


Q ss_pred             eEEEEcC-CCceeeEeecccCCCeEEEEEecCCCEEEEEeCCCcEEEEEc
Q 003423          329 TCRVWGS-DGKQLKMIKEHIGRGIWRCLYDSLSSLLVTAGFDSAIKVHQF  377 (821)
Q Consensus       329 ~i~iwd~-~~~~~~~~~~h~~~~i~~l~~~~~~~~l~tg~~dg~I~iwd~  377 (821)
                      .|++||. .++.+..+. |.. .|++++|+|++++|++|+.||.|++||+
T Consensus       288 ~i~iwd~~~~~~~~~~~-~~~-~v~~~~~s~d~~~l~t~s~D~~I~vWdl  335 (337)
T d1gxra_         288 LLNAWRTPYGASIFQSK-ESS-SVLSCDISVDDKYIVTGSGDKKATVYEV  335 (337)
T ss_dssp             EEEEEETTTCCEEEEEE-CSS-CEEEEEECTTSCEEEEEETTSCEEEEEE
T ss_pred             eEEEEECCCCCEEEEcc-CCC-CEEEEEEeCCCCEEEEEeCCCeEEEEEE
Confidence            9999999 677776655 555 6999999999999999999999999997
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1wp5a_ b.68.10.1 (A:) Topoisomerase IV subunit A, ParC, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure