Citrus Sinensis ID: 003431

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820

MTMTAEVEVHGGGELSSQNDLPNGNAIADSSCVFVEVSGNDVGSGGTDLNSTNSVELNGKLVVEESNQSTINNEENEIESEKQESLVLVSESCADQENQLLNLSAKEAELGDQKFESGGAESGTVVVSDSVDGDGAVSCKNYSSENAASLHTDLPAETACENGAVDMIHEIQVADCPEELGVEIDQNTDEASRPVAVAVAGVDLQLGMQIVRGSVTVESERGLDAGHCQYGVSETVVDDLVDPSQETAELDKPSGVAESFPFQIDPENLPVESLKTDPDVALNVSDTTAKPDVDFRDSVVTESSPSGEVDDMERDNEVGKLNVGSGKSSDSHPVDDAHVNEVGNGPVRDDLVSVFHNSDAKSETETGFDSVDAEEKVSILASDDQRTEPEVLQGGIDGVDERSISVDNAAVESCTSESVYEESTADVKAECEIENAYVLSFRDVPGNEALVPESEVVSGSVSSIPEDVNVENVGIQHAGGEKDDHRSKELEENMETEFTGEESDDLVCKEVLENARIQFTGGGSDDQAHKEVKEKGGIQFTSGESDDKTFQEVEGIQSTDGGTDDKTCKKVVVNGGIKFTSEEQNDKTCPEVKENRGIQLTGGEDGDRTFQDVEGIERSDRCETQTSTPEGSTVDASESRNIGVEVVKQPFYFLVKVPRYDDENLREQIKAAQSKVDEKTRSRDAIRDDIQTIRASYKEYAEKLEAAISDERSARESLKSKRQEIDSVQSRINMMKNAISVDDIDGSIRNMEHRIAHETLPLKEEKQIIREIKQLKQRREQISSSIGEHDEVQLAFDQKDQIEEKMKVVLSSMFSSFLIF

ccccEEEEEEcccccccccccccccccccccEEEEEEcccccccccccccccccEEEccEEEEEccccccccccHHHHHHHHHcccEEEEHHHHHHHHcccccHHHHHccccccccccccccccEEEEccccccccccccccccccccccccccccHHHccccccccccccccccccccccccccccccccccHHHHHccccccccccEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHcccccccccccHHHHHHHHHHHHHHccccccccccccHHHHHcccccccccccccccccccccccccccccccccccEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHccccccc

cccEEEEEEccccccccccccccccEEEcccEEEEEEcccEEccccccccccccEEEEcEEEEcccccccccccHccccHHccccEEEEEccHHHHHccccccccEEEEcccccccccccccccEEEEcccccccEEEEEEccccccEEEEccccccHHcccccccHHHcccccccccccccccccccHHHccccccccccHHcccccEEEEccccccccccccccccccccccccccccccccccccEEEcccccccccEEEccccccccccccccccccccccccccccEEEEcccEEEcccccccHHHEEEcccccccccccccccccccccccccccccccccHHHHHHHcccccccHHccccccccccHHHHHHcccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccEEEEEEcccccccccccEEEccccEcccccccccccccccccccccccccccccccccccccccccccccEEEEEccccccccccccccccccHHcccccccEEEcccccccccccccccEEccccccccccccEEEccccEEcEEccccccccccccccccEEEcccccccccccHcccccccHHcccccccccccccccccccccEEEccccEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccc

MTMTAEVEvhgggelssqndlpngnaiadsSCVFVEVsgndvgsggtdlnstnsveLNGKLVVEESnqstinneeneiesekQESLVLVSESCADQENQLLNLSAKeaelgdqkfesggaesgtvvvsdsvdgdgavscknyssenaaslhtdlpaetacengavdmIHEIqvadcpeelgveidqntdeasrPVAVAVAGVDLQLGMQIVRGSVTvesergldaghcqygvsetvvddlvdpsqetaeldkpsgvaesfpfqidpenlpveslktdpdvalnvsdttakpdvdfrdsvvtesspsgevddmerdnevgklnvgsgkssdshpvddahvnevgngpvrddLVSVFhnsdaksetetgfdsvdaeEKVSIlasddqrtepevlqggidgvdersisVDNAAvesctsesvyeestadVKAECEIENAYVLsfrdvpgnealvpesevvsgsvssipedvnvenvgiqhaggekddhRSKELEEnmeteftgeesddLVCKEVLENARIqftgggsddqAHKEVKekggiqftsgesddktFQEVEgiqstdggtddktcKKVVVNGGikftseeqndktcpevkenrgiqltggedgdrtfqdvegiersdrcetqtstpegstvdasesrnigvevvkqpfyflvkvpryddenLREQIKAAQSKVdektrsrdaIRDDIQTIRASYKEYAEKLEAAISDERSARESLKSKRQEIDSVQSRINMMKNAisvddidgsirnmehriahetlplKEEKQIIREIKQLKQRREQISSSIGEHDEVQLAFDQKDQIEEKMKVVLSSMFSSFLIF

mtmtaevevhgggelssqndlPNGNAIADSSCVFVEVSGNDVgsggtdlnstnsvELNGKLVVeesnqstinneeneieseKQESLVLVSESCADQENQLLNLSAKEAELGDQKFESGGAESGTVVVSDSVDGDGAVSCKNYSSENAASLHTDLPAETACENGAVDMIHEIQVADCPEELGVEIDQNTDEASRPVAVAVAGVDLQLGMQIVRGSVTVESERGLDAGHCQYGVSETVVDDLVDPSQETaeldkpsgvaESFPFQIDPENLPVESLKTDPDVALNVSdttakpdvdfrdsvvtesspsgevddmerdnEVGKLNVGsgkssdshpvDDAHVNEVGNGPVRDDLVSVFHNSDaksetetgfdsvdaEEKVSilasddqrtepevlqggidgvdersISVDNAAvesctsesvyeestadvKAECEIENAYVLSFRDVPGNEALVPESEVVsgsvssipedvnvenvgiqhaggekddhrsKELEENmeteftgeesdDLVCKEVLENARIQftgggsddqahKEVKEKGgiqftsgesddktfQEVEGiqstdggtddktckKVVVNGgikftseeqndktcpevkenrgiqltggedgdrtfQDVEGiersdrcetqtstpegstvdasesrnigvevvkqpfyfLVKVPRYDDENLREQIKAaqskvdektrsrdairddIQTIRASYKEYAEKLEAAISdersareslkskrqeIDSVQSRINMMKNAISVDDIDGSIRNMEHRIahetlplkeekQIIREIKQLKQRREQIsssigehdevqLAFDQKDQIEEKMKVVLSSMFSSFLIF

MTMTAEVEVHGGGELSSQNDLPNGNAIADSSCVFVEVSGNDVGSGGTDLNSTNSVELNGKLVVeesnqstinneeneiesekqesLVLVSESCADQENQLLNLSAKEAELGDQKFESGGAEsgtvvvsdsvdgdgavsCKNYSSENAASLHTDLPAETACENGAVDMIHEIQVADCPEELGVEIDQNTDEASRPVAVAVAGVDLQLGMQIVRGSVTVESERGLDAGHCQYGVSETVVDDLVDPSQETAELDKPSGVAESFPFQIDPENLPVESLKTDPDVALNVSDTTAKPDVDFRDSVVTESSPSGEVDDMERDNEVGKLNVGSGKSSDSHPVDDAHVNEVGNGPVRDDLVSVFHNSDAKSETETGFDSVDAEEKVSILASDDQRTEPEVLQGGIDGVDERSISVDNAAVESCTSESVYEESTADVKAECEIENAYVLSFRDVPGNEALvpesevvsgsvssIPEDVNVENVGIQHAGGEKDDHRSKeleenmeteftgeeSDDLVCKEVLENARIQFTGGGSDDQAHKEVKEKGGIQFTSGESDDKTFQEVEGIQSTDGGTDDKTCKKVVVNGGIKFTSEEQNDKTCPEVKENRGIQLTGGEDGDRTFQDVEGIERSDRCETQTSTPEGSTVDASESRNIGVEVVKQPFYFLVKVPRYDDENLREQIKAAQSKVDEKTRSRDAIRDDIQTIRASYKEYAEKLEAAISDERSARESLKSKRQEIDSVQSRINMMKNAISVDDIDGSIRNMEHRIAHETLPLKEEKQIIREIKQLKQRREQISSSIGEHDEVQLAFDQKDQIEEKMKVVLSSMFSSFLIF

******************************SCVFVEV***********************************************************************************************************************ETACENGAVDMIHEIQVADCPEELGVEIDQNT**ASRPVAVAVAGVDLQLGMQIVRGSVTVESERGLDAGHCQYGVSETVVDDL****************************************************************************************************************************************************************************************ADVKAECEIENAYVLSFRDVPG************************************************************VCKEVLENARI**************************************************CKKVVVNGGIK***************************************************************IGVEVVKQPFYFLVKVPRYD***************************************************************************************************************************************************************

*********HGGG************AIADSSCVFVEVS*********************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************KQPFYFLVKVPRYDDENLREQIKAAQ**********************************************************************IDGSIRNM********************************************************VVLSSMFSSFLIF

*************ELSSQNDLPNGNAIADSSCVFVEVSGNDVGSGGTDLNSTNSVELNGKLVVEES********************VLVSESCADQENQLLNLSAKEAELGDQKFESGGAESGTVVVSDSVDGDGAVSCKNYSSENAASLHTDLPAETACENGAVDMIHEIQVADCPEELGVEIDQNTDEASRPVAVAVAGVDLQLGMQIVRGSVTVESERGLDAGHCQYGVSETVVDDLVDPSQETAELDKPSGVAESFPFQIDPENLPVESLKTDPDVALNVSDTTAKPDVDFRD**************MERDNEVGKLN***********VDDAHVNEVGNGPVRDDLVSVFHNS************VDAEEKVSILASDDQRTEPEVLQGGIDGVDERSISVDNAA****************VKAECEIENAYVLSFRDVPGNEALV**********SSIPEDVNVENVGIQ***************************DDLVCKEVLENARIQFTGGGSDDQAHKEVKEKGGIQFTSGESDDKTFQEVEGIQSTDGGTDDKTCKKVVVNGGIKFTSEEQNDKTCPEVKENRGIQLTGGEDGDRTFQDVEGI**********************SRNIGVEVVKQPFYFLVKVPRYDDENLREQIKA***********RDAIRDDIQTIRASYKEYAEKLEAAIS****************DSVQSRINMMKNAISVDDIDGSIRNMEHRIAHETLPLKEEKQIIREIKQLKQRREQISSSIGEHDEVQLAFDQKDQIEEKMKVVLSSMFSSFLIF

*TMTAEVEVHGGGELSSQNDLPNGNAIADSSCVFVEVSGNDVGSGGTDLNSTNSVELNGKLVVEE******************ESLVLVSESCADQEN*****SA**AEL**************VVVSDSVDGDGAVSCKNYSSENAASLHTDLPAET*CENGAVDMIHEIQVADCPEELGVEIDQNTDEASRPVAVAVAGVDLQLGMQIVRGSV***************************************GVAESFPFQI*************************KPDVDFRDSVVTESSPSGEVDDMERDN*********************************************************************************************************************ENAYVLSFRDV**************************************************************VC***********************************************IQSTDGGTDDKTCKKVVVNGGIKFTSEEQ****CP*************************************************RNIGVEVVKQPFYFLVKVPRYDDENLREQIKAAQSKVDEKTRSRDAIRDDIQTIRASYKEYAEKLEAAISDERSARESLKSKRQEIDSVQSRINMMKNAISVDDIDGSIRNMEHRIAHETLPLKEEKQIIREIKQLKQRREQISSSIGEHDEVQLAFDQKDQIEEKMKVVLSSMFSSFLIF

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

ooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MTMTAEVEVHGGGELSSQNDLPNGNAIADSSCVFVEVSGNDVGSGGTDLNSTNSVELNGKLVVxxxxxxxxxxxxxxxxxxxxxxxxxxxxSCADQENQLLNLSAKEAELGDQKFESGGAESGTVVVSDSVDGDGAVSCKNYSSENAASLHTDLPAETACENGAVDMIHEIQVADCPEELGVEIDQNTDEASRPVAVAVAGVDLQLGMQIVRGSVTVESERGLDAGHCQYGVSETVVDDLVDPSQETAELDKPSGVAESFPFQIDPENLPVESLKTDPDVALNVSDTTAKPDVDFRDSVVTESSPSGEVDDMERDNEVGKLNVGSGKSSDSHPVDDAHVNEVGNGPVRDDLVSVFHNSDAKSETETGFDSVDAEEKVSILASDDQRTEPEVLQGGIDGVDERSISVDNAAVESCTSESVYEESTADVKAECEIENAYVLSFRDVPGNEALVPESEVVSGSVSSIPEDVNVENVGIQHAGGEKDDHRSKELEENMETEFTGEESDDLVCKEVLENARIQFTGGGSDDQAHKEVKEKGGIQFTSGESDDKTFQEVEGIQSTDGGTDDKTCKKVVVNGGIKFTSEEQNDKTCPEVKENRGIQLTGGEDGDRTFQDVEGIERSDRCETQTSTPEGSTVDASESRNIGVEVVKQPFYFLVKVPRYDxxxxxxxxxxxxxxxxxxxxxRDAIRDDIQTIRASYKEYxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxISVDDIDGSIRNMEHRIAHETLPLKExxxxxxxxxxxxxxxxxxxxxIGEHDEVQLAFDQKDQIEEKMKVVLSSMFSSFLIF

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		820	2.2.26 [Sep-21-2011]
O23144		612	Proton pump-interactor 1	no	no	0.192	0.258	0.242	6e-10

>sp\|O23144\|PPI1_ARATH Proton pump-interactor 1 OS=Arabidopsis thaliana GN=PPI1 PE=1 SV=2	Back alignment and function desciption

 Score = 67.0 bits (162), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 41/169 (24%), Positives = 95/169 (56%), Gaps = 11/169 (6%)

Query: 652 YFLVKVPRYDDENLREQIKAAQSKVDEKTRSRDAIRDDIQTIRASYKEYAEKLEAAISDE 711
           ++LVK   Y D  ++ ++  A  ++++  ++R  + D ++  RA   E  + L+   S+ 
Sbjct: 79  FYLVKYRSYADPKIKAKLDLADKELEKLNKARTGVLDKLRAKRAERSELFDLLDPLKSER 138

Query: 712 RSARESLKSKRQEIDSVQSRINMMKN---------AI--SVDDIDGSIRNMEHRIAHETL 760
           +        KR+E++ +Q  +  +++         AI  S ++++  I + ++RI HE++
Sbjct: 139 KGFNTMFDEKRKEMEPLQQALGKLRSNDGGSARGPAICSSEEELNSMIYSYQYRIQHESI 198

Query: 761 PLKEEKQIIREIKQLKQRREQISSSIGEHDEVQLAFDQKDQIEEKMKVV 809
           PL EEKQI++EI+ L+  R+++ ++     +++ +  QKD I+ ++K++
Sbjct: 199 PLTEEKQILKEIRLLEGTRDKVIANAAMRAKIKESMGQKDDIQGQVKLM 247

Promotes AHA1 plasma membrane ATPase activity by binding to a site different from the 14-3-3 binding site.
Arabidopsis thaliana (taxid: 3702)

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		820
359491929		1089	PREDICTED: uncharacterized protein LOC10	0.257	0.193	0.587	9e-61
449455738		1463	PREDICTED: uncharacterized protein LOC10	0.253	0.142	0.588	2e-60
297745622		1477	unnamed protein product [Vitis vinifera]	0.224	0.124	0.641	3e-60
449528207		909	PREDICTED: uncharacterized LOC101219495	0.253	0.228	0.588	5e-60
255539360		1553	conserved hypothetical protein [Ricinus	0.263	0.139	0.511	2e-52
186478714		1364	uncharacterized protein [Arabidopsis tha	0.223	0.134	0.568	1e-51
24430042		1498	Hypothetical protein [Arabidopsis thalia	0.223	0.122	0.568	2e-51
297845076		1186	hypothetical protein ARALYDRAFT_472337 [	0.223	0.154	0.562	2e-49
356577005		1501	PREDICTED: uncharacterized protein LOC10	0.210	0.115	0.594	1e-46
357438817		1290	hypothetical protein MTR_1g035040 [Medic	0.214	0.136	0.539	3e-46

>gi\|359491929\|ref\|XP_002273658.2\| PREDICTED: uncharacterized protein LOC100261635 [Vitis vinifera]	Back alignment and taxonomy information

 Score =  241 bits (616), Expect = 9e-61,   Method: Compositional matrix adjust.
 Identities = 127/216 (58%), Positives = 165/216 (76%), Gaps = 5/216 (2%)

Query: 595 NRGIQLTGGEDGDR-TFQDVEGIERSDRCETQTSTPEGSTVDASESRNIGVEVVKQPFYF 653
           N G Q+T  +  D+ T Q+     RS      +S+ E  + DA +S+N+ VEV K+PFYF
Sbjct: 757 NEGDQITSVDSDDKLTCQEA----RSVLGNGTSSSLEFLSTDALDSQNVPVEVGKRPFYF 812

Query: 654 LVKVPRYDDENLREQIKAAQSKVDEKTRSRDAIRDDIQTIRASYKEYAEKLEAAISDERS 713
           L++VPRYDDE +RE+IK AQ +VDEKT+SRDAIR +IQ  RA  KEY+EK EAA+S+ER+
Sbjct: 813 LIRVPRYDDEKVREEIKLAQLQVDEKTKSRDAIRSEIQIKRAVCKEYSEKFEAALSEERA 872

Query: 714 ARESLKSKRQEIDSVQSRINMMKNAISVDDIDGSIRNMEHRIAHETLPLKEEKQIIREIK 773
           AR+ LKSK QE+DSVQS IN +KNA+SV DIDG IR+MEH I HETLPLKEEKQ+IR+IK
Sbjct: 873 ARDLLKSKFQEMDSVQSVINRVKNAMSVKDIDGRIRHMEHAIEHETLPLKEEKQLIRDIK 932

Query: 774 QLKQRREQISSSIGEHDEVQLAFDQKDQIEEKMKVV 809
           QL+  REQ+SS++G  +EVQ A DQK Q+EE+ K++
Sbjct: 933 QLRNVREQLSSNMGRQEEVQQALDQKSQVEEQSKIL 968

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|449455738\|ref\|XP_004145608.1\| PREDICTED: uncharacterized protein LOC101219495 [Cucumis sativus]	Back alignment and taxonomy information

>gi\|297745622\|emb\|CBI40787.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|449528207\|ref\|XP_004171097.1\| PREDICTED: uncharacterized LOC101219495 [Cucumis sativus]	Back alignment and taxonomy information

>gi\|255539360\|ref\|XP_002510745.1\| conserved hypothetical protein [Ricinus communis] gi\|223551446\|gb\|EEF52932.1\| conserved hypothetical protein [Ricinus communis]	Back alignment and taxonomy information

>gi\|186478714\|ref\|NP_173521.2\| uncharacterized protein [Arabidopsis thaliana] gi\|332191928\|gb\|AEE30049.1\| uncharacterized protein [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|24430042\|gb\|AAD30594.2\|AC007369_4 Hypothetical protein [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|297845076\|ref\|XP_002890419.1\| hypothetical protein ARALYDRAFT_472337 [Arabidopsis lyrata subsp. lyrata] gi\|297336261\|gb\|EFH66678.1\| hypothetical protein ARALYDRAFT_472337 [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

>gi\|356577005\|ref\|XP_003556620.1\| PREDICTED: uncharacterized protein LOC100798700 [Glycine max]	Back alignment and taxonomy information

>gi\|357438817\|ref\|XP_003589685.1\| hypothetical protein MTR_1g035040 [Medicago truncatula] gi\|355478733\|gb\|AES59936.1\| hypothetical protein MTR_1g035040 [Medicago truncatula]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		820
TAIR\|locus:2037365		1364	AT1G20970 "AT1G20970" [Arabido	0.269	0.162	0.495	1.4e-53
TAIR\|locus:2124019		612	PPI1 "proton pump interactor 1	0.284	0.380	0.227	8.1e-12
TAIR\|locus:504955937		734	AT2G22795 "AT2G22795" [Arabido	0.7	0.782	0.216	2.7e-09
UNIPROTKB\|Q8IIG7		1070	PF11_0207 "Uncharacterized pro	0.168	0.128	0.277	7.5e-07
GENEDB_PFALCIPARUM\|PF14_0404		3543	PF14_0404 "hypothetical protei	0.328	0.075	0.240	9.4e-06
UNIPROTKB\|Q8IL45		3543	TREP "TRAP-related protein" [P	0.328	0.075	0.240	9.4e-06
TAIR\|locus:2087115		589	PPI2 "proton pump interactor 2	0.186	0.259	0.201	0.00051
TAIR\|locus:2064387		517	NET4B "AT2G30500" [Arabidopsis	0.171	0.272	0.229	0.00054
TAIR\|locus:2133847		763	AT4G26630 [Arabidopsis thalian	0.210	0.226	0.247	0.0007
ZFIN\|ZDB-GENE-030131-698		888	safb "scaffold attachment fact	0.192	0.177	0.236	0.00074

TAIR\|locus:2037365 AT1G20970 "AT1G20970" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 540 (195.1 bits), Expect = 1.4e-53, Sum P(2) = 1.4e-53
 Identities = 115/232 (49%), Positives = 164/232 (70%)

Query:   587 KTCPEVKENRGIQLT-----GGED--GDRTFQDVEG--IERSDRCETQTSTPEGSTVDAS 637
             KTC +  E++ +  T     G +D    +  ++ EG  ++R+D  +   ST E S +DAS
Sbjct:   713 KTCAQDLESKVVTSTDTIHTGAKDCVDSQPAENKEGNVVDRTD--DKVASTGEVSVLDAS 770

Query:   638 ESRNIGVEVVKQPFYFLVKVPRYDDENLREQIKAAQSKVDEKTRSRDAIRDDIQTIRASY 697
             E   +  E+ K+PFYFL +VPRYDDE L EQ+K A+ +VD+KT++RDA+R DIQ IRA  
Sbjct:   771 EGLTVAAEIEKRPFYFLPRVPRYDDEKLAEQLKHAEEQVDQKTQNRDALRADIQKIRAIC 830

Query:   698 KEYAEKLEAAISDERSARESLKSKRQEIDSVQSRINMMKNAISVDDIDGSIRNMEHRIAH 757
             K+Y    +A +++ERSAR+++ SKRQEI+++QS I+ +K+A SVDDID  +RNMEH + H
Sbjct:   831 KDYDISYKAVMAEERSARKAMHSKRQEIEALQSMISRVKSAASVDDIDSRVRNMEHTMQH 890

Query:   758 ETLPLKEEKQIIREIKQLKQRREQISSSIGEHDEVQLAFDQKDQIEEKMKVV 809
              TL L EEK  +REIKQLKQ REQISSS+G  DEV+ A D+K++ EE++KV+
Sbjct:   891 TTLSLNEEKGFMREIKQLKQLREQISSSMGTKDEVKQALDEKEKTEERLKVL 942

GO:0003674 "molecular_function" evidence=ND

GO:0005634 "nucleus" evidence=ISM

GO:0008150 "biological_process" evidence=ND

GO:0005773 "vacuole" evidence=IDA

GO:0005886 "plasma membrane" evidence=IDA

GO:0005829 "cytosol" evidence=RCA

TAIR\|locus:2124019 PPI1 "proton pump interactor 1" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:504955937 AT2G22795 "AT2G22795" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

UNIPROTKB\|Q8IIG7 PF11_0207 "Uncharacterized protein PF11_0207" [Plasmodium falciparum 3D7 (taxid:36329)]	Back alignment and assigned GO terms

GENEDB_PFALCIPARUM\|PF14_0404 PF14_0404 "hypothetical protein" [Plasmodium falciparum (taxid:5833)]	Back alignment and assigned GO terms

UNIPROTKB\|Q8IL45 TREP "TRAP-related protein" [Plasmodium falciparum 3D7 (taxid:36329)]	Back alignment and assigned GO terms

TAIR\|locus:2087115 PPI2 "proton pump interactor 2" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2064387 NET4B "AT2G30500" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2133847 AT4G26630 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-030131-698 safb "scaffold attachment factor B" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		820
COG1340		294	COG1340, COG1340, Uncharacterized archaeal coiled-	9e-06
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	6e-04
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	7e-04
TIGR02168		1179	TIGR02168, SMC_prok_B, chromosome segregation prot	7e-04
TIGR02168		1179	TIGR02168, SMC_prok_B, chromosome segregation prot	9e-04
TIGR02168		1179	TIGR02168, SMC_prok_B, chromosome segregation prot	0.002
TIGR02169		1164	TIGR02169, SMC_prok_A, chromosome segregation prot	0.003
TIGR02169		1164	TIGR02169, SMC_prok_A, chromosome segregation prot	0.003

>gnl\|CDD\|224259 COG1340, COG1340, Uncharacterized archaeal coiled-coil protein [Function unknown]	Back alignment and domain information

 Score = 48.1 bits (115), Expect = 9e-06
 Identities = 28/143 (19%), Positives = 70/143 (48%), Gaps = 3/143 (2%)

Query: 665 LREQIKAAQSKVDEKTRSRDAIRDDIQTIRASYKEYAEKLEAAISDERS-ARESLKSKRQ 723
           LR++      K DE       +R+  Q +R    E  E++   + ++R      L+  R+
Sbjct: 32  LRKEASELAEKRDELNAKVRELREKAQELREERDEINEEV-QELKEKRDEINAKLQELRK 90

Query: 724 EIDSVQSRIN-MMKNAISVDDIDGSIRNMEHRIAHETLPLKEEKQIIREIKQLKQRREQI 782
           E   ++ + N       S+  ++  I  +E +     L  +EE++++++IK+L++  E  
Sbjct: 91  EYRELKEKRNEFNLGGRSIKSLEREIERLEKKQQTSVLTPEEERELVQKIKELRKELEDA 150

Query: 783 SSSIGEHDEVQLAFDQKDQIEEK 805
             ++ E+++++    + D++++K
Sbjct: 151 KKALEENEKLKELKAEIDELKKK 173

Length = 294

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

>gnl\|CDD\|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

>gnl\|CDD\|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

>gnl\|CDD\|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>gnl\|CDD\|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		820
COG1340		294	Uncharacterized archaeal coiled-coil protein [Func	99.05
PRK11637		428	AmiB activator; Provisional	96.97
COG1340		294	Uncharacterized archaeal coiled-coil protein [Func	96.88
PF07888		546	CALCOCO1: Calcium binding and coiled-coil domain (	96.77
PRK11637		428	AmiB activator; Provisional	96.69
TIGR02169		1164	SMC_prok_A chromosome segregation protein SMC, pri	96.42
PF08317		325	Spc7: Spc7 kinetochore protein; InterPro: IPR01325	96.25
KOG0250		1074	consensus DNA repair protein RAD18 (SMC family pro	96.17
COG1579		239	Zn-ribbon protein, possibly nucleic acid-binding [	96.15
smart00787		312	Spc7 Spc7 kinetochore protein. This domain is foun	95.8
PRK03918		880	chromosome segregation protein; Provisional	95.64
KOG1029		1118	consensus Endocytic adaptor protein intersectin [S	95.52
PHA02562		562	46 endonuclease subunit; Provisional	95.52
PRK02224		880	chromosome segregation protein; Provisional	95.5
TIGR00606		1311	rad50 rad50. This family is based on the phylogeno	95.23
PF05667		594	DUF812: Protein of unknown function (DUF812); Inte	95.16
PF10186		302	Atg14: UV radiation resistance protein and autopha	95.08
PHA02562		562	46 endonuclease subunit; Provisional	94.99
KOG1029		1118	consensus Endocytic adaptor protein intersectin [S	94.96
PF04156		191	IncA: IncA protein; InterPro: IPR007285 Chlamydia	94.74
COG1579		239	Zn-ribbon protein, possibly nucleic acid-binding [	94.7
PRK03918		880	chromosome segregation protein; Provisional	94.69
PF12128		1201	DUF3584: Protein of unknown function (DUF3584); In	94.5
PF07926		132	TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro:	94.45
TIGR00606		1311	rad50 rad50. This family is based on the phylogeno	94.24
PF07888		546	CALCOCO1: Calcium binding and coiled-coil domain (	94.22
PF09789		319	DUF2353: Uncharacterized coiled-coil protein (DUF2	94.11
COG1196		1163	Smc Chromosome segregation ATPases [Cell division	94.1
PF07106		169	TBPIP: Tat binding protein 1(TBP-1)-interacting pr	94.05
PF09726		697	Macoilin: Transmembrane protein; InterPro: IPR0191	94.02
COG1196		1163	Smc Chromosome segregation ATPases [Cell division	93.91
COG4942		420	Membrane-bound metallopeptidase [Cell division and	93.86
PF10146		230	zf-C4H2: Zinc finger-containing protein ; InterPro	93.73
TIGR03185		650	DNA_S_dndD DNA sulfur modification protein DndD. T	93.7
PF08317		325	Spc7: Spc7 kinetochore protein; InterPro: IPR01325	93.68
PRK09039		343	hypothetical protein; Validated	93.57
COG2433		652	Uncharacterized conserved protein [Function unknow	93.43
PF15290		305	Syntaphilin: Golgi-localised syntaxin-1-binding cl	93.43
KOG0161		1930	consensus Myosin class II heavy chain [Cytoskeleto	93.4
COG5185		622	HEC1 Protein involved in chromosome segregation, i	93.36
PF10186		302	Atg14: UV radiation resistance protein and autopha	93.24
PF04156		191	IncA: IncA protein; InterPro: IPR007285 Chlamydia	93.06
PF09726		697	Macoilin: Transmembrane protein; InterPro: IPR0191	92.94
KOG0996		1293	consensus Structural maintenance of chromosome pro	92.61
PRK01156		895	chromosome segregation protein; Provisional	92.58
PF15233		134	SYCE1: Synaptonemal complex central element protei	92.3
KOG0612		1317	consensus Rho-associated, coiled-coil containing p	92.1
PF12128		1201	DUF3584: Protein of unknown function (DUF3584); In	92.04
PF00038		312	Filament: Intermediate filament protein; InterPro:	91.88
PF12718		143	Tropomyosin_1: Tropomyosin like; InterPro: IPR0005	91.86
PF15619		194	Lebercilin: Ciliary protein causing Leber congenit	91.84
smart00787		312	Spc7 Spc7 kinetochore protein. This domain is foun	91.79
KOG0964		1200	consensus Structural maintenance of chromosome pro	91.69
KOG0995		581	consensus Centromere-associated protein HEC1 [Cell	91.68
PF12325		120	TMF_TATA_bd: TATA element modulatory factor 1 TATA	91.62
PF07106		169	TBPIP: Tat binding protein 1(TBP-1)-interacting pr	91.59
KOG0977		546	consensus Nuclear envelope protein lamin, intermed	91.51
PRK09039		343	hypothetical protein; Validated	91.37
PF13851		201	GAS: Growth-arrest specific micro-tubule binding	91.3
KOG0161		1930	consensus Myosin class II heavy chain [Cytoskeleto	91.28
COG5185		622	HEC1 Protein involved in chromosome segregation, i	91.26
COG0419		908	SbcC ATPase involved in DNA repair [DNA replicatio	91.24
KOG0999		772	consensus Microtubule-associated protein Bicaudal-	91.17
PRK04863		1486	mukB cell division protein MukB; Provisional	91.02
TIGR01843		423	type_I_hlyD type I secretion membrane fusion prote	90.85
KOG0250		1074	consensus DNA repair protein RAD18 (SMC family pro	90.74
PF10168		717	Nup88: Nuclear pore component; InterPro: IPR019321	90.47
TIGR03007		498	pepcterm_ChnLen polysaccharide chain length determ	90.37
COG3883		265	Uncharacterized protein conserved in bacteria [Fun	90.23
PF04111		314	APG6: Autophagy protein Apg6; InterPro: IPR007243	90.22
PF11932		251	DUF3450: Protein of unknown function (DUF3450); In	90.18
PF09789		319	DUF2353: Uncharacterized coiled-coil protein (DUF2	90.17
COG4942		420	Membrane-bound metallopeptidase [Cell division and	90.14
PF10168		717	Nup88: Nuclear pore component; InterPro: IPR019321	90.08
PRK01156		895	chromosome segregation protein; Provisional	89.97
PF03962		188	Mnd1: Mnd1 family; InterPro: IPR005647 This family	89.96
TIGR01843		423	type_I_hlyD type I secretion membrane fusion prote	89.95
PF02403		108	Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal dom	89.95
PLN02939		977	transferase, transferring glycosyl groups	89.81
PRK04778		569	septation ring formation regulator EzrA; Provision	89.67
PF09304		107	Cortex-I_coil: Cortexillin I, coiled coil; InterPr	89.45
PF05384		159	DegS: Sensor protein DegS; InterPro: IPR008595 Thi	89.44
KOG0995		581	consensus Centromere-associated protein HEC1 [Cell	89.39
PF05667		594	DUF812: Protein of unknown function (DUF812); Inte	89.21
PF04111		314	APG6: Autophagy protein Apg6; InterPro: IPR007243	89.2
COG4026		290	Uncharacterized protein containing TOPRIM domain,	89.18
PF14197		69	Cep57_CLD_2: Centrosome localisation domain of PPC	89.09
PRK10884		206	SH3 domain-containing protein; Provisional	88.56
PRK04778		569	septation ring formation regulator EzrA; Provision	88.48
PF15290		305	Syntaphilin: Golgi-localised syntaxin-1-binding cl	88.46
KOG0288		459	consensus WD40 repeat protein TipD [General functi	88.28
KOG2391		365	consensus Vacuolar sorting protein/ubiquitin recep	87.94
TIGR01005		754	eps_transp_fam exopolysaccharide transport protein	87.92
KOG4643		1195	consensus Uncharacterized coiled-coil protein [Fun	87.84
KOG4673		961	consensus Transcription factor TMF, TATA element m	87.77
PF00261		237	Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop	87.74
COG2433		652	Uncharacterized conserved protein [Function unknow	87.49
PF08647		96	BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR01395	87.39
KOG0999		772	consensus Microtubule-associated protein Bicaudal-	87.24
PF10473		140	CENP-F_leu_zip: Leucine-rich repeats of kinetochor	87.22
PF08826		61	DMPK_coil: DMPK coiled coil domain like; InterPro:	87.03
KOG4673		961	consensus Transcription factor TMF, TATA element m	87.01
TIGR02971		327	heterocyst_DevB ABC exporter membrane fusion prote	86.94
PRK15422		79	septal ring assembly protein ZapB; Provisional	86.88
TIGR03185		650	DNA_S_dndD DNA sulfur modification protein DndD. T	86.82
PF10174		775	Cast: RIM-binding protein of the cytomatrix active	86.69
PF14662		193	CCDC155: Coiled-coil region of CCDC155	86.46
KOG0804		493	consensus Cytoplasmic Zn-finger protein BRAP2 (BRC	86.4
PF00261		237	Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop	86.35
TIGR01069		771	mutS2 MutS2 family protein. Function of MutS2 is u	86.11
PF11932		251	DUF3450: Protein of unknown function (DUF3450); In	85.51
PF13166		712	AAA_13: AAA domain	85.49
KOG0996		1293	consensus Structural maintenance of chromosome pro	85.4
PF13949		296	ALIX_LYPXL_bnd: ALIX V-shaped domain binding to HI	85.39
COG0419		908	SbcC ATPase involved in DNA repair [DNA replicatio	85.37
TIGR03007		498	pepcterm_ChnLen polysaccharide chain length determ	85.28
TIGR03794		421	NHPM_micro_HlyD NHPM bacteriocin system secretion	85.26
KOG0964		1200	consensus Structural maintenance of chromosome pro	85.0
smart00502		127	BBC B-Box C-terminal domain. Coiled coil region C-	84.85
TIGR03017		444	EpsF chain length determinant protein EpsF. Sequen	84.83
PF06005		72	DUF904: Protein of unknown function (DUF904); Inte	84.29
PF09730		717	BicD: Microtubule-associated protein Bicaudal-D; I	84.19
PRK10698		222	phage shock protein PspA; Provisional	84.17
TIGR01000		457	bacteriocin_acc bacteriocin secretion accessory pr	84.12
KOG0962		1294	consensus DNA repair protein RAD50, ABC-type ATPas	84.05
COG4372		499	Uncharacterized protein conserved in bacteria with	83.86
PF11559		151	ADIP: Afadin- and alpha -actinin-Binding; InterPro	83.81
KOG0933		1174	consensus Structural maintenance of chromosome pro	83.74
TIGR01005		754	eps_transp_fam exopolysaccharide transport protein	83.61
TIGR00634		563	recN DNA repair protein RecN. All proteins in this	83.4
KOG2911		439	consensus Uncharacterized conserved protein [Funct	83.34
PF13870		177	DUF4201: Domain of unknown function (DUF4201)	83.32
PF07889		126	DUF1664: Protein of unknown function (DUF1664); In	82.93
PLN03229		762	acetyl-coenzyme A carboxylase carboxyl transferase	82.91
PF09728		309	Taxilin: Myosin-like coiled-coil protein; InterPro	82.75
PF10146		230	zf-C4H2: Zinc finger-containing protein ; InterPro	82.74
PF06632		342	XRCC4: DNA double-strand break repair and V(D)J re	82.72
PF04012		221	PspA_IM30: PspA/IM30 family; InterPro: IPR007157 T	82.66
PF07926		132	TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro:	82.63
PF03962		188	Mnd1: Mnd1 family; InterPro: IPR005647 This family	82.59
PF15066		527	CAGE1: Cancer-associated gene protein 1 family	82.41
PF03961		451	DUF342: Protein of unknown function (DUF342); Inte	82.34
KOG4809		654	consensus Rab6 GTPase-interacting protein involved	82.07
TIGR00414		418	serS seryl-tRNA synthetase. This model represents	82.05
PLN02678		448	seryl-tRNA synthetase	81.86
PRK12704		520	phosphodiesterase; Provisional	81.7
PF12718		143	Tropomyosin_1: Tropomyosin like; InterPro: IPR0005	81.51
PRK05431		425	seryl-tRNA synthetase; Provisional	81.46
TIGR01000		457	bacteriocin_acc bacteriocin secretion accessory pr	81.24
PRK10698		222	phage shock protein PspA; Provisional	81.06
PF02403		108	Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal dom	81.05
KOG2751		447	consensus Beclin-like protein [Signal transduction	80.96
KOG4302		660	consensus Microtubule-associated protein essential	80.94
PF06005		72	DUF904: Protein of unknown function (DUF904); Inte	80.8
PF14662		193	CCDC155: Coiled-coil region of CCDC155	80.73
PF13949		296	ALIX_LYPXL_bnd: ALIX V-shaped domain binding to HI	80.58
COG4026		290	Uncharacterized protein containing TOPRIM domain,	80.57
PF04849		306	HAP1_N: HAP1 N-terminal conserved region; InterPro	80.42
KOG4571		294	consensus Activating transcription factor 4 [Trans	80.3
PRK10884		206	SH3 domain-containing protein; Provisional	80.21

>COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown]	Back alignment and domain information

Probab=99.05  E-value=1.6e-08  Score=105.96  Aligned_cols=149  Identities=18%  Similarity=0.358  Sum_probs=104.0

Q ss_pred             hHHHHHHHHHHHHHHHHhhhHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH----------
Q 003431          663 ENLREQIKAAQSKVDEKTRSRDAIRDDIQTIRASYKEYAEKLEAAISDERSARESLKSKRQEIDSVQSRI----------  732 (820)
Q Consensus       663 EkLKAKIDeAQkEIqKLNQaR~aIieEIKAKRAERsELIeQLKALRaE~RqlR~eldEKRKELdpLQEaL----------  732 (820)
                      .++..|+..+...+..+++.|..++.++.+.+++|+++..+.+.++++.+.+|..+++..+++..|+...          
T Consensus         9 ~E~e~K~~~lk~~~~e~~ekR~El~~~~~~~~ekRdeln~kvrE~~e~~~elr~~rdeineev~elK~kR~ein~kl~eL   88 (294)
T COG1340           9 DELELKRKQLKEEIEELKEKRDELRKEASELAEKRDELNAKVRELREKAQELREERDEINEEVQELKEKRDEINAKLQEL   88 (294)
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            3456666677777778888888888888888888887777777777777777766665555444444422          


Q ss_pred             ----HHhh---c-----CCChHhHHHHHHhhhhhhhcCCCChHHHHHHHHHHHHHHHHHHHHhhcccchhHHHHhh----
Q 003431          733 ----NMMK---N-----AISVDDIDGSIRNMEHRIAHETLPLKEEKQIIREIKQLKQRREQISSSIGEHDEVQLAF----  796 (820)
Q Consensus       733 ----~KLR---N-----ASSeEEIDarIKsLEyRIQHESLSLkEEKKLLKEIKQLKkTREKViANAAmQAKIQdSL----  796 (820)
                          ++++   +     ..+...|...|..|+|.+||..||+.+|++++++|++|++..+.+-+-.-..+++++.+    
T Consensus        89 ~~~~~~l~e~~~~~~~~~~~~~~ler~i~~Le~~~~T~~L~~e~E~~lvq~I~~L~k~le~~~k~~e~~~~~~el~aei~  168 (294)
T COG1340          89 RKEYRELKEKRNEFNLGGRSIKSLEREIERLEKKQQTSVLTPEEERELVQKIKELRKELEDAKKALEENEKLKELKAEID  168 (294)
T ss_pred             HHHHHHHHHHhhhhhccCCCHHHHHHHHHHHHHHHHhcCCChHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence                2222   1     26999999999999999999999999999999999999988776664433333333333    


Q ss_pred             ---hhhHHHHHHHHHHHH
Q 003431          797 ---DQKDQIEEKMKVVLS  811 (820)
Q Consensus       797 ---DQKEAIQdQVKlLkK  811 (820)
                         ..-..++++|..|.-
T Consensus       169 ~lk~~~~e~~eki~~la~  186 (294)
T COG1340         169 ELKKKAREIHEKIQELAN  186 (294)
T ss_pred             HHHHHHHHHHHHHHHHHH
Confidence               333345555555443

>PRK11637 AmiB activator; Provisional	Back alignment and domain information

>COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown]	Back alignment and domain information

>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT)	Back alignment and domain information

>PRK11637 AmiB activator; Provisional	Back alignment and domain information

>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association []	Back alignment and domain information

>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair]	Back alignment and domain information

>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only]	Back alignment and domain information

>smart00787 Spc7 Spc7 kinetochore protein	Back alignment and domain information

>PRK03918 chromosome segregation protein; Provisional	Back alignment and domain information

>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PHA02562 46 endonuclease subunit; Provisional	Back alignment and domain information

>PRK02224 chromosome segregation protein; Provisional	Back alignment and domain information

>TIGR00606 rad50 rad50	Back alignment and domain information

>PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function	Back alignment and domain information

>PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking	Back alignment and domain information

>PHA02562 46 endonuclease subunit; Provisional	Back alignment and domain information

>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion	Back alignment and domain information

>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only]	Back alignment and domain information

>PRK03918 chromosome segregation protein; Provisional	Back alignment and domain information

>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins	Back alignment and domain information

>PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT)	Back alignment and domain information

>TIGR00606 rad50 rad50	Back alignment and domain information

>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT)	Back alignment and domain information

>PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function	Back alignment and domain information

>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences	Back alignment and domain information

>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes	Back alignment and domain information

>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning]	Back alignment and domain information

>PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule	Back alignment and domain information

>TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD	Back alignment and domain information

>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association []	Back alignment and domain information

>PRK09039 hypothetical protein; Validated	Back alignment and domain information

>COG2433 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF15290 Syntaphilin: Golgi-localised syntaxin-1-binding clamp	Back alignment and domain information

>KOG0161 consensus Myosin class II heavy chain [Cytoskeleton]	Back alignment and domain information

>COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning]	Back alignment and domain information

>PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking	Back alignment and domain information

>PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion	Back alignment and domain information

>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes	Back alignment and domain information

>KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PRK01156 chromosome segregation protein; Provisional	Back alignment and domain information

>PF15233 SYCE1: Synaptonemal complex central element protein 1	Back alignment and domain information

>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins	Back alignment and domain information

>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope	Back alignment and domain information

>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells	Back alignment and domain information

>PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease	Back alignment and domain information

>smart00787 Spc7 Spc7 kinetochore protein	Back alignment and domain information

>KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes []	Back alignment and domain information

>PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences	Back alignment and domain information

>KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure]	Back alignment and domain information

>PRK09039 hypothetical protein; Validated	Back alignment and domain information

>PF13851 GAS: Growth-arrest specific micro-tubule binding	Back alignment and domain information

>KOG0161 consensus Myosin class II heavy chain [Cytoskeleton]	Back alignment and domain information

>COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning]	Back alignment and domain information

>COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair]	Back alignment and domain information

>KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PRK04863 mukB cell division protein MukB; Provisional	Back alignment and domain information

>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family	Back alignment and domain information

>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair]	Back alignment and domain information

>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs	Back alignment and domain information

>TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily	Back alignment and domain information

>COG3883 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells	Back alignment and domain information

>PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function	Back alignment and domain information

>PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function	Back alignment and domain information

>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning]	Back alignment and domain information

>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs	Back alignment and domain information

>PRK01156 chromosome segregation protein; Provisional	Back alignment and domain information

>PF03962 Mnd1: Mnd1 family; InterPro: IPR005647 This family of proteins includes meiotic nuclear division protein 1 (MND1) from Saccharomyces cerevisiae (Baker's yeast)	Back alignment and domain information

>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family	Back alignment and domain information

>PF02403 Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal domain; InterPro: IPR015866 The aminoacyl-tRNA synthetases (6	Back alignment and domain information

>PLN02939 transferase, transferring glycosyl groups	Back alignment and domain information

>PRK04778 septation ring formation regulator EzrA; Provisional	Back alignment and domain information

>PF09304 Cortex-I_coil: Cortexillin I, coiled coil; InterPro: IPR015383 This domain is predominantly found in the actin-bundling protein cortexillin I from Dictyostelium discoideum (Slime mold)	Back alignment and domain information

>PF05384 DegS: Sensor protein DegS; InterPro: IPR008595 This is a group of Bacillus DegS proteins	Back alignment and domain information

>KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function	Back alignment and domain information

>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells	Back alignment and domain information

>COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only]	Back alignment and domain information

>PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89	Back alignment and domain information

>PRK10884 SH3 domain-containing protein; Provisional	Back alignment and domain information

>PRK04778 septation ring formation regulator EzrA; Provisional	Back alignment and domain information

>PF15290 Syntaphilin: Golgi-localised syntaxin-1-binding clamp	Back alignment and domain information

>KOG0288 consensus WD40 repeat protein TipD [General function prediction only]	Back alignment and domain information

>KOG2391 consensus Vacuolar sorting protein/ubiquitin receptor VPS23 [Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>TIGR01005 eps_transp_fam exopolysaccharide transport protein family	Back alignment and domain information

>KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown]	Back alignment and domain information

>KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription]	Back alignment and domain information

>PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells	Back alignment and domain information

>COG2433 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF08647 BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR013956 BRE1 is an E3 ubiquitin ligase that has been shown to act as a transcriptional activator through direct activator interactions []	Back alignment and domain information

>KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ]	Back alignment and domain information

>PF08826 DMPK_coil: DMPK coiled coil domain like; InterPro: IPR014930 This domain is found in the myotonic dystrophy protein kinase (DMPK) and adopts a coiled coil structure	Back alignment and domain information

>KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription]	Back alignment and domain information

>TIGR02971 heterocyst_DevB ABC exporter membrane fusion protein, DevB family	Back alignment and domain information

>PRK15422 septal ring assembly protein ZapB; Provisional	Back alignment and domain information

>TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD	Back alignment and domain information

>PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion []	Back alignment and domain information

>PF14662 CCDC155: Coiled-coil region of CCDC155	Back alignment and domain information

>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only]	Back alignment and domain information

>PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells	Back alignment and domain information

>TIGR01069 mutS2 MutS2 family protein	Back alignment and domain information

>PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function	Back alignment and domain information

>PF13166 AAA_13: AAA domain	Back alignment and domain information

>KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PF13949 ALIX_LYPXL_bnd: ALIX V-shaped domain binding to HIV ; PDB: 2XS1_A 2XS8_A 2R03_A 2R02_A 2OEX_B 2OEV_A 2OJQ_A 2R05_A	Back alignment and domain information

>COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair]	Back alignment and domain information

>TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily	Back alignment and domain information

>TIGR03794 NHPM_micro_HlyD NHPM bacteriocin system secretion protein	Back alignment and domain information

>KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>smart00502 BBC B-Box C-terminal domain	Back alignment and domain information

>TIGR03017 EpsF chain length determinant protein EpsF	Back alignment and domain information

>PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation	Back alignment and domain information

>PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) []	Back alignment and domain information

>PRK10698 phage shock protein PspA; Provisional	Back alignment and domain information

>TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein	Back alignment and domain information

>KOG0962 consensus DNA repair protein RAD50, ABC-type ATPase/SMC superfamily [Replication, recombination and repair]	Back alignment and domain information

>COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown]	Back alignment and domain information

>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch	Back alignment and domain information

>KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>TIGR01005 eps_transp_fam exopolysaccharide transport protein family	Back alignment and domain information

>TIGR00634 recN DNA repair protein RecN	Back alignment and domain information

>KOG2911 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF13870 DUF4201: Domain of unknown function (DUF4201)	Back alignment and domain information

>PF07889 DUF1664: Protein of unknown function (DUF1664); InterPro: IPR012458 The members of this family are hypothetical plant proteins of unknown function	Back alignment and domain information

>PLN03229 acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; Provisional	Back alignment and domain information

>PF09728 Taxilin: Myosin-like coiled-coil protein; InterPro: IPR019132 Taxilin contains an extraordinarily long coiled-coil domain in its C-terminal half and is ubiquitously expressed	Back alignment and domain information

>PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule	Back alignment and domain information

>PF06632 XRCC4: DNA double-strand break repair and V(D)J recombination protein XRCC4; InterPro: IPR010585 This entry represents the DNA double-strand break repair and V(D)J recombination protein XRCC4, which is found in certain Metazoans, fungi and plants	Back alignment and domain information

>PF04012 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 This family includes PspA a protein that suppresses sigma54-dependent transcription	Back alignment and domain information

>PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT)	Back alignment and domain information

>PF03962 Mnd1: Mnd1 family; InterPro: IPR005647 This family of proteins includes meiotic nuclear division protein 1 (MND1) from Saccharomyces cerevisiae (Baker's yeast)	Back alignment and domain information

>PF15066 CAGE1: Cancer-associated gene protein 1 family	Back alignment and domain information

>PF03961 DUF342: Protein of unknown function (DUF342); InterPro: IPR005646 This family of bacterial proteins has no known function	Back alignment and domain information

>KOG4809 consensus Rab6 GTPase-interacting protein involved in endosome-to-TGN transport [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>TIGR00414 serS seryl-tRNA synthetase	Back alignment and domain information

>PLN02678 seryl-tRNA synthetase	Back alignment and domain information

>PRK12704 phosphodiesterase; Provisional	Back alignment and domain information

>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells	Back alignment and domain information

>PRK05431 seryl-tRNA synthetase; Provisional	Back alignment and domain information

>TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein	Back alignment and domain information

>PRK10698 phage shock protein PspA; Provisional	Back alignment and domain information

>PF02403 Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal domain; InterPro: IPR015866 The aminoacyl-tRNA synthetases (6	Back alignment and domain information

>KOG2751 consensus Beclin-like protein [Signal transduction mechanisms]	Back alignment and domain information

>KOG4302 consensus Microtubule-associated protein essential for anaphase spindle elongation [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton]	Back alignment and domain information

>PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation	Back alignment and domain information

>PF14662 CCDC155: Coiled-coil region of CCDC155	Back alignment and domain information

>PF13949 ALIX_LYPXL_bnd: ALIX V-shaped domain binding to HIV ; PDB: 2XS1_A 2XS8_A 2R03_A 2R02_A 2OEX_B 2OEV_A 2OJQ_A 2R05_A	Back alignment and domain information

>COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only]	Back alignment and domain information

>PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues	Back alignment and domain information

>KOG4571 consensus Activating transcription factor 4 [Transcription]	Back alignment and domain information

>PRK10884 SH3 domain-containing protein; Provisional	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		820
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	6e-09
3lvg_D		190	LCB, clathrin light chain B; SELF assembly, coated	7e-04

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

 Score = 58.7 bits (141), Expect = 6e-09
 Identities = 85/639 (13%), Positives = 181/639 (28%), Gaps = 200/639 (31%)

Query: 290 KPDVDFRD------SVVTESSPSGEVDDM--ERDNEVGKLNV-GSGKSSDSHPVDDAHVN 340
             + D +D      S+++      E+D +   +D   G L +  +  S     V    V 
Sbjct: 30  VDNFDCKDVQDMPKSILS----KEEIDHIIMSKDAVSGTLRLFWTLLSKQEEMVQKF-VE 84

Query: 341 EVGNGPVRDD---LVSVFHNSD-AKSETETGFDSVDAEEKVSILASDDQ--------RTE 388
           EV    +R +   L+S         S     +      E+   L +D+Q        R +
Sbjct: 85  EV----LRINYKFLMSPIKTEQRQPSMMTRMY-----IEQRDRLYNDNQVFAKYNVSRLQ 135

Query: 389 P-EVLQGGIDGV-DERSISVDNA--------AVESCTSESVYEESTADVKAECEIENA-Y 437
           P   L+  +  +   +++ +D          A++ C S  V          +C+++   +
Sbjct: 136 PYLKLRQALLELRPAKNVLIDGVLGSGKTWVALDVCLSYKV----------QCKMDFKIF 185

Query: 438 VLSFRDVPGNEALVPESEVVSGSVSSIPEDVNVENVGIQHAGGEKDDHRSKELEENMETE 497
            L+      N            S  ++ E +      I      + DH S      +   
Sbjct: 186 WLNL----KNC----------NSPETVLEMLQKLLYQIDPNWTSRSDHSSNI---KLRIH 228

Query: 498 FTGEESDDLVCKEVLENARIQFTGGGSDDQAHKEVKEKGGIQ----FTSGES------DD 547
               E   L+  +  EN  +        +  + +      +      T+           
Sbjct: 229 SIQAELRRLLKSKPYENCLLVL-----LNVQNAKAWNAFNLSCKILLTTRFKQVTDFLSA 283

Query: 548 KTFQEVEGIQSTDGGTDDKT---CKKVVVNGGIKFTSE-EQNDKTCPEVKENRGIQLTGG 603
            T   +     +   T D+      K +     +      +   T P       + +   
Sbjct: 284 ATTTHISLDHHSMTLTPDEVKSLLLKYL---DCRPQDLPREVLTTNPRR-----LSIIA- 334

Query: 604 EDGDRTFQDVEGIERSDR-----CETQTSTPEGSTVDASESRNIGVEVVKQPFYFL---- 654
                + +D  G+   D      C+  T+  E S ++  E         ++ F  L    
Sbjct: 335 ----ESIRD--GLATWDNWKHVNCDKLTTIIESS-LNVLEP-----AEYRKMFDRLSVFP 382

Query: 655 --VKVP--------RYDDENLREQIKAAQSKVDEKTRSRDAIRDDIQTIRASYKEYAEKL 704
               +P            ++    +      V++  +     +          KE    +
Sbjct: 383 PSAHIPTILLSLIWFDVIKSDVMVV------VNKLHKYSLVEKQ--------PKESTISI 428

Query: 705 EAAISDERSARESLKSK-RQEIDSVQSRINMMKNAISVDDIDGSI--------------- 748
            +   + +   E+  +  R  +D          + +    +D                  
Sbjct: 429 PSIYLELKVKLENEYALHRSIVDHYNIPKTFDSDDLIPPYLDQYFYSHIGHHLKNIEHPE 488

Query: 749 ------------RNMEHRIAHETLPLKEEKQIIREIKQLKQRREQISSS----------- 785
                       R +E +I H++        I+  ++QLK  +  I  +           
Sbjct: 489 RMTLFRMVFLDFRFLEQKIRHDSTAWNASGSILNTLQQLKFYKPYICDNDPKYERLVNAI 548

Query: 786 ------IGEH-------DEVQLAFDQKDQ--IEEKMKVV 809
                 I E+       D +++A   +D+   EE  K V
Sbjct: 549 LDFLPKIEENLICSKYTDLLRIALMAEDEAIFEEAHKQV 587

PyMOL of 1vt4

>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		820
1c1g_A		284	Tropomyosin; contractIle protein; 7.00A {Sus scrof	97.07
3na7_A		256	HP0958; flagellar biogenesis, flagellum export, C4	97.03
3na7_A		256	HP0958; flagellar biogenesis, flagellum export, C4	96.74
2dfs_A		1080	Myosin-5A; myosin-V, inhibited state, cryoelectron	95.47
3u59_A		101	Tropomyosin beta chain; muscle contraction, actin,	94.56
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	94.52
1i84_S		1184	Smooth muscle myosin heavy chain; muscle protein,	93.95
3u1c_A		101	Tropomyosin alpha-1 chain; anti-parallel coiled co	93.86
1i84_S		1184	Smooth muscle myosin heavy chain; muscle protein,	93.33
2jee_A		81	YIIU; FTSZ, septum, coiled-coil, cell division, ce	92.07
3ghg_A		562	Fibrinogen alpha chain; triple-stranded coiled coi	91.83
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	91.32
1wt6_A		81	Myotonin-protein kinase; coiled-coil, kinase activ	89.95
1m1j_B		464	Fibrinogen beta chain; coiled coils, disulfide rin	89.46
3ol1_A		119	Vimentin; structural genomics, PSI-2, protein stru	88.99
3vkg_A		3245	Dynein heavy chain, cytoplasmic; AAA+ protein, mol	88.8
1deq_A		390	Fibrinogen (alpha chain); coiled-coil, blood clott	88.14
3o0z_A		168	RHO-associated protein kinase 1; coiled-coil, tran	87.95
1ic2_A		81	Tropomyosin alpha chain, skeletal muscle; alpha-he	85.45
2dfs_A		1080	Myosin-5A; myosin-V, inhibited state, cryoelectron	85.39
1cii_A		602	Colicin IA; bacteriocin, ION channel formation, tr	85.25
1l8d_A		112	DNA double-strand break repair RAD50 ATPase; zinc	85.25
2fxo_A		129	Myosin heavy chain, cardiac muscle beta isoform; c	84.81
3hnw_A		138	Uncharacterized protein; coiled-coil, structural g	84.5
3cvf_A		79	Homer-3, homer protein homolog 3; coiled coil, alt	84.3
2v4h_A		110	NF-kappa-B essential modulator; transcription, met	84.25
1wle_A		501	Seryl-tRNA synthetase; ligase; HET: SRP; 1.65A {Bo	83.63
1l8d_A		112	DNA double-strand break repair RAD50 ATPase; zinc	82.88
3u1c_A		101	Tropomyosin alpha-1 chain; anti-parallel coiled co	82.82
3cve_A		72	Homer protein homolog 1; coiled coil, alternative	82.69
2dq0_A		455	Seryl-tRNA synthetase; coiled-coil, homodimer, str	81.69
3mq9_A		471	Bone marrow stromal antigen 2 fused to maltose-BI	81.39
2jee_A		81	YIIU; FTSZ, septum, coiled-coil, cell division, ce	81.24
3q8t_A		96	Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90	80.43

>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A	Back alignment and structure

Probab=97.07  E-value=0.04  Score=50.00  Aligned_cols=74  Identities=8%  Similarity=0.238  Sum_probs=50.9

Q ss_pred             hHHHHHHHHHHHHHHHHhhhHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhh
Q 003431          663 ENLREQIKAAQSKVDEKTRSRDAIRDDIQTIRASYKEYAEKLEAAISDERSARESLKSKRQEIDSVQSRINMMK  736 (820)
Q Consensus       663 EkLKAKIDeAQkEIqKLNQaR~aIieEIKAKRAERsELIeQLKALRaE~RqlR~eldEKRKELdpLQEaL~KLR  736 (820)
                      +.|+++|..+..+|..+......+..++..++..+..+...+..+..+...++..+.....++..++..+..+.
T Consensus         2 ~~~~~~~~~l~~~~~~~~~~~~~l~~~l~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   75 (284)
T 1c1g_A            2 DAIKKKMQMLKLDKENALDRADEAEADKKAAEDRSKQLEDELVSLQKKLKATEDELDKYSEALKDAQEKLELAE   75 (284)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             hHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            46788888888888888777777777777777777777777776666666666666555555555555444433

PyMOL of 1c1g

>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori}	Back alignment and structure

>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori}	Back alignment and structure

>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus}	Back alignment and structure

>3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus}	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A	Back alignment and structure

>3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A	Back alignment and structure

>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A	Back alignment and structure

>2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli}	Back alignment and structure

>3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G*	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>1wt6_A Myotonin-protein kinase; coiled-coil, kinase activation, DMPK, molecular replacement, transferase; 1.60A {Homo sapiens}	Back alignment and structure

>1m1j_B Fibrinogen beta chain; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: d.171.1.1 h.1.8.1 PDB: 1ei3_B*	Back alignment and structure

>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A*	Back alignment and structure

>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens}	Back alignment and structure

>1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1	Back alignment and structure

>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus}	Back alignment and structure

>1cii_A Colicin IA; bacteriocin, ION channel formation, transmembrane protein; 3.00A {Escherichia coli} SCOP: f.1.1.1 h.4.3.1	Back alignment and structure

>1l8d_A DNA double-strand break repair RAD50 ATPase; zinc finger, DNA repair, recombination, HOOK motif, replication; HET: DNA CIT; 2.20A {Pyrococcus furiosus} SCOP: h.4.12.1	Back alignment and structure

>2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A	Back alignment and structure

>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens}	Back alignment and structure

>3cvf_A Homer-3, homer protein homolog 3; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, phosphoprotein, polymorphism; 2.90A {Homo sapiens}	Back alignment and structure

>2v4h_A NF-kappa-B essential modulator; transcription, metal-binding, NEMO - IKK gamma - NFKB pathwa darpin, transcription regulation; 2.9A {Mus musculus}	Back alignment and structure

>1wle_A Seryl-tRNA synthetase; ligase; HET: SRP; 1.65A {Bos taurus}	Back alignment and structure

>1l8d_A DNA double-strand break repair RAD50 ATPase; zinc finger, DNA repair, recombination, HOOK motif, replication; HET: DNA CIT; 2.20A {Pyrococcus furiosus} SCOP: h.4.12.1	Back alignment and structure

>3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A	Back alignment and structure

>3cve_A Homer protein homolog 1; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, postsynaptic cell membrane, synapse; 1.75A {Rattus norvegicus}	Back alignment and structure

>2dq0_A Seryl-tRNA synthetase; coiled-coil, homodimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: SSA; 2.60A {Pyrococcus horikoshii} PDB: 2dq1_A* 2dq2_A 2zr2_A* 2zr3_A	Back alignment and structure

>3mq9_A Bone marrow stromal antigen 2 fused to maltose-BI periplasmic protein; HIV, antiviral protein; 2.80A {Escherichia coli}	Back alignment and structure

>2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli}	Back alignment and structure

>3q8t_A Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90A {Rattus norvegicus}	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		820
d1seta1		110	Seryl-tRNA synthetase (SerRS) {Thermus thermophilu	90.56
d1gqea_		362	Polypeptide chain release factor 2 (RF2) {Escheric	80.86

>d1seta1 a.2.7.1 (A:1-110) Seryl-tRNA synthetase (SerRS) {Thermus thermophilus, strain hb27 [TaxId: 274]}	Back information, alignment and structure

class: All alpha proteins
fold: Long alpha-hairpin
superfamily: tRNA-binding arm
family: Seryl-tRNA synthetase (SerRS)
domain: Seryl-tRNA synthetase (SerRS)
species: Thermus thermophilus, strain hb27 [TaxId: 274]

Probab=90.56  E-value=0.47  Score=39.58  Aligned_cols=53  Identities=9%  Similarity=0.216  Sum_probs=22.5

Q ss_pred             HHHHHHHHHHHHHhhhHHHHHHHHHH-HHHhHHHHHHHHHHHHHHHHHHHHHHH
Q 003431          667 EQIKAAQSKVDEKTRSRDAIRDDIQT-IRASYKEYAEKLEAAISDERSARESLK  719 (820)
Q Consensus       667 AKIDeAQkEIqKLNQaR~aIieEIKA-KRAERsELIeQLKALRaE~RqlR~eld  719 (820)
                      .+...++.+++.++..|..+..++.+ ++..+.+++.+++.|..+.+.+...+.
T Consensus        35 ~~rr~l~~~~e~l~~~rN~~sk~i~k~~~~~~~~l~~~~k~lk~~i~~le~~~~   88 (110)
T d1seta1          35 REVQELKKRLQEVQTERNQVAKRVPKAPPEEKEALIARGKALGEEAKRLEEALR   88 (110)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHGGGCCHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHhhccchHHHHHHHHHHHHHHHHHHHHHH
Confidence            33344444444555555554444422 223334444444444444444333333

PyMOL of d1seta1

>d1gqea_ e.38.1.1 (A:) Polypeptide chain release factor 2 (RF2) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure