Citrus Sinensis ID: 003435

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820

MWWKLEVYWRGRGFLIVLDDVWDEDGENMEKALSWLNVGGSGSCVLVTTRSGRVASMMGTVPTQHLTCLSSEDSWVLFKHFAFGSVEDESTELEEIGQKIVAKCKGLPIAIKTIGSILRSKDKEEWLSVADCDLWTLLEFKSHVLPVLKRSYDNLPWHLKQCFAYCSIFPKDYWINKEKLVRLWVAEGFIRLDSGSEDLEETADDYFMELLQHSFFDNIVRGIFGEVVMCKVHDYIHFLAQLAAGVEYSIVSIRDSQNIHTDIRHCTLVGDLSSSTIPRARKLRTLLFLTVKMENLSFPCQEFQCLRVLDLGQSGIIKLPDSIGTLKHLRYLDLSHTYIRKIPGSISKLKHLQTLDLSNCYNLEELPKGICQLTNLRTLDISSCYSLTHMPLGIGKLRPLRKLPAFILGKQRFCAGLGELKLLDLRGRLEIKNLENLKNVVDAEEAKLHDKVHIRSLGLSWSRNAQMRDDKAQALIEFLRPPHNLKVLDLKGYRGSVFPSWLNSGVPNLVKVSLVDCTCQELPPLGQLPNLKDLYVKGMSAVQIIGYKFYGNDAIRGFPSLKLLQLFDMPNLMEWKGQMTEGTDEFDGMQEPFPCLEKLVVEGCSMLNTLPFIRNLKNLALCNSNDKLVCSLSRFPSLSSLVVDNFPELNCLSDKTGNLNSLVKLTVNECDNLESLFVFMQSFSSLRHLSILHCDKLESLPMSLEKFCSLQKLDIVECPRLVHIPDIMGQHSSLLELSIEGCPMLKLSLKSIEFLGQLQRLVIKKCPQLERQRLMNALHESFDPIAQMEVVSMTTLNLMADEVPTETDAGASLREKNKHG

cHHHHHHHHcccEEEEEEcccccccHHHHHHHHHHHcccccccEEEEEEccHHHHcccccccEEEcccccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHccccHHHHHHHHHHHccccHHHHHHHHcccccccccccccccHHHHccccccccccHHHHcccccccccccccHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHccccccccccccccEEEEEEcHHHHHHHHHHHHccEEEEEcccccccccccEEEEEEccccccccccccccEEEEEcccccccccccccccccEEEEEcccccccccccccccccccccccccccccccccccccccccccEEccccccccccccHHccccccccEEEcccccccccccccccccccccccccEEEcccccccccccccccccccEEEEEcccccccccHHHHccccccccccEEEEEEccccccccHHHHHHHHcccccccccEEEEEccccccccccccccccccEEEEEEccccccccccccccccccEEEccccccEEEccEEcccccccccccccEEEccccccccccccccccccccccccccccccccEEEEccccccccccccccccEEEEEcccccccccccccccccEEEEEcccccccccccccccccccEEEEEcccccccHHHHccccccccEEEEEcccccccccccccccccccEEEEEcccccccccccccccccccEEEEEcccccccccccccccccccEEEEEcccccccccccccccccccccccEEEEcccccccccccccccccHHHHHHHHHccc

cHHHHHHHHcccEEEEEEEccccccHHHHHHHHHHHHccccccEEEEEEccHHHHHHHccccccccccccHHHHHHHHHHHHccccccccccHHHHHHHHHHHccccHHHHHHHHHHHccccHHHHHHHHHccHccccccccccHHHHHEcHHccccHHHHHHHEEEEccccccEcHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHEccccccccccEEEEHHHHHHHHHHHHcccHEEEEcccccccccccEEEEEEccccccccHcccHccEEEccccccccccHHHcccccccEEEEEcccccccccccccccccEEEEEccccccccccccccccccccEEEEcccccHHHccHHHccccccEEEEEccccccccccccccccccccEEEEEEEccccccccHHHHccccccccEEEccccccccHHHHHHHHccccccccEEEEEccccccccccHHHHHHHHccccccccEEEEEccccccccccccccccccEEEEEEcccccccccccccccccEEEEEcccccEEccHHHcccccccccccHcEEEEcccccHHHcccccccccccccccccccccccEEEEccccccccccccccccEEEEccccccccccccccccccEEEEccccccccccHcccccccccEEEEcccccHccccHHccccccccEEEEccccccccccccccccccccEEEEcccccHccccHcccccccccEEEEcccccHccccHHccccccccEEEEcccccHHcccccccccccccccccccEEEccccHHccHHcHHHccccHHHHEccccc

MWWKLEVYWRGRGFLIvlddvwdedgENMEKALSWLnvggsgscVLVTTRSgrvasmmgtvptqhltclssedsWVLFKHfafgsvedestELEEIGQKIVAKCKGLPIAIKTIGSIlrskdkeewlsVADCDLWTLLEFKSHVLPVLkrsydnlpwhlKQCFAYcsifpkdywinkEKLVRLWVAEGFirldsgsedleeTADDYFMELLQHSFFDNIVRGIFGEVVMCKVHDYIHFLAQLAAGVEYSIVSIrdsqnihtdirhctlvgdlssstiprARKLRTLLFLTVKMenlsfpcqefqclrvldlgqsgiiklpdsigtlkhlryldlshtyirkipgsisklkhlqtldlsncynleelpkgicqltnlrtldisscyslthmplgigklrplrklpafiLGKQRFCAGLGELKLLDLRgrleiknlenlknvvdaeeaklhdkvhirslglswsrnaqMRDDKAQALIEFlrpphnlkvldlkgyrgsvfpswlnsgvpnlvkvslvdctcqelpplgqlpnlkdlyVKGMSAVQIIGYkfygndairgfpslkllqlfdmpnlmewkgqmtegtdefdgmqepfpcLEKLVVEGcsmlntlpFIRNLKNLalcnsndklvcslsrfpslsslvvdnfpelnclsdktgnlNSLVKLTVNECDNLESLFVFMQSFSSLRHLSILHCDKLESLPMSLEKFCslqkldivecprlvhipdimgqHSSLLELSIEGCPMLKLSLKSIEFLGQLQRLVIKKCPQLERQRLMNALHESFDPIAQMEVVSMTTLNlmadevptetdagasLREKNKHG

mwwklevywrgrgFLIVLDDVWDEDGENMEKALswlnvggsgSCVLVTTRSGRVASMMGTVPTQHLTCLSSEDSWVLFKHFAFGSVEDESTELEEIGQKIVAKCKGLPIAIKTIGsilrskdkeEWLSVADCDLWTLLEFKSHVLPVLKRSYDNLPWHLKQCFAYCSIFPKDYWINKEKLVRLWVAEGFIRLDSGSEDLEETADDYFMELLQHSFFDNIVRGIFGEVVMCKVHDYIHFLAQLAAGVEYSIVSIRDSQNIHTDIRHCTlvgdlssstipraRKLRTLLFLTVKMENLSFPCQEFQCLRVLDLGQSGIIKLPDSIGTLKHLRYLDLSHTYIRKIPGSISKLKHLQTLDLSNCYNLEELPKGICQLTNLRTLDISSCYSLTHMPLGIGKLRPLRKLPAFILGKQRFCAGLGELKLLDLRGRLEIKnlenlknvvdaeeaklhdkvhirslglswsrnaQMRDDKAQALIEFLRPPHNLKVLDLKGYRGSVFPSWLNSGVPNLVKVSLVDCTCQELPPLGQLPNLKDLYVKGMSAVQIIGYKFYGNDAIRGFPSLKLLQLFDMPNLMEWKGQMTEGTDEFDGMQEPFPCLEKLVVEGCSMLNTLPFIRNLKNLALCNSNDKLVCSLSRFPSLSSLVVDNFPELNCLSDKTGNLNSLVKLTVNECDNLESLFVFMQSFSSLRHLSILHCDKLESLPMSLEKFCSLQKLDIVECPRLVHIPDIMGQHSSLLELSIEGCPMLKLSLKSIEFLGQLQRLVIKKCPQLERQRLMNALHESFDPIAQMEVVSMTTLNLMADEVPtetdagaslreknkhg

*WWKLEVYWRGRGFLIVLDDVWDEDGENMEKALSWLNVGGSGSCVLVTTRSGRVASMMGTVPTQHLTCLSSEDSWVLFKHFAFGSVEDESTELEEIGQKIVAKCKGLPIAIKTIGSILRSKDKEEWLSVADCDLWTLLEFKSHVLPVLKRSYDNLPWHLKQCFAYCSIFPKDYWINKEKLVRLWVAEGFIRLDSGSEDLEETADDYFMELLQHSFFDNIVRGIFGEVVMCKVHDYIHFLAQLAAGVEYSIVSIRDSQNIHTDIRHCTLVGDLSSSTIPRARKLRTLLFLTVKMENLSFPCQEFQCLRVLDLGQSGIIKLPDSIGTLKHLRYLDLSHTYIRKIPGSISKLKHLQTLDLSNCYNLEELPKGICQLTNLRTLDISSCYSLTHMPLGIGKLRPLRKLPAFILGKQRFCAGLGELKLLDLRGRLEIKNLENLKNVVDAEEAKLHDKVHIRSLGLSWSRNAQMRDDKAQALIEFLRPPHNLKVLDLKGYRGSVFPSWLNSGVPNLVKVSLVDCTCQELPPLGQLPNLKDLYVKGMSAVQIIGYKFYGNDAIRGFPSLKLLQLFDMPNLMEWKGQMTEGTDEFDGMQEPFPCLEKLVVEGCSMLNTLPFIRNLKNLALCNSNDKLVCSLSRFPSLSSLVVDNFPELNCLSDKTGNLNSLVKLTVNECDNLESLFVFMQSFSSLRHLSILHCDKLESLPMSLEKFCSLQKLDIVECPRLVHIPDIMGQHSSLLELSIEGCPMLKLSLKSIEFLGQLQRLVIKKCPQLERQRLMNALHESFDPIAQMEVVSMTTLNL**********************

MWWKLEVYWRGRGFLIVLDDVWDEDGENMEKALSWLNVGGSGSCVLVTTRSGRVASMMGTVPTQHLTCLSSEDSWVLFKHFAF**********EEIGQKIVAKCKGLPIAIKTIGSILRSKDKEEWLSVADCDLWTLLEFKSHVLPVLKRSYDNLPWHLKQCFAYCSIFPKDYWINKEKLVRLWVAEGFIRLDSGSEDLEETADDYFMELLQHSFFDNIVRGIFGEVVMCKVHDYIHFLAQLAAGVEYSIVSIRDSQNIHTDIRHCTLVGDLSSSTIPRARKLRTLLFLTVKMENLSFPCQEFQCLRVLDLGQSGIIKLPDSIGTLKHLRYLDLSHTYIRKIPGSISKLKHLQTLDLSNCYNLEELPKGICQLTNLRTLDISSCYSLTHMPLGIGKLRPLRKLPAFILGKQRF*****ELKLLDLRGRLEIKNLENLKNVVDAEEAKLHDKVHIRSLGLSWSRN*******AQALIEFLRPPHNLKVLDLKGYRGSVFPSWLNSGVPNLVKVSLVDCTCQELPPLGQLPNLKDLYVKGMSAVQIIGYKFYGNDAIRGFPSLKLLQLFDMPNLMEWKGQMTEGTDEFDGMQEPFPCLEKLVVEGCSMLNTLPFIRNLKNLALCNSNDKLVCSLSRFPSLSSLVVDNFPELNCLSDKTGNLNSLVKLTVNECDNLESLFVFMQSFSSLRHLSILHCDKLESLPMSLEKFCSLQKLDIVECPRLVHIPDIMGQHSSLLELSIEGCPMLKLSLKSIEFLGQLQRLVIKKCPQL****************AQMEVVSMTTLNLMA*************R******

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		820	2.2.26 [Sep-21-2011]
Q7XA40		992	Putative disease resistan	N/A	no	0.873	0.721	0.370	1e-110
Q7XA39		988	Putative disease resistan	N/A	no	0.852	0.707	0.371	1e-109
Q7XBQ9		970	Disease resistance protei	N/A	no	0.836	0.707	0.370	1e-108
Q7XA42		979	Putative disease resistan	N/A	no	0.885	0.741	0.351	1e-104
Q9LRR4		1054	Putative disease resistan	yes	no	0.797	0.620	0.350	3e-93
Q9LRR5		1424	Putative disease resistan	no	no	0.709	0.408	0.358	4e-86
Q38834		852	Disease resistance RPP13-	no	no	0.564	0.543	0.319	9e-54
Q39214		926	Disease resistance protei	no	no	0.735	0.651	0.300	2e-47
Q9STE7		847	Putative disease resistan	no	no	0.626	0.606	0.303	6e-45
Q9M667		835	Disease resistance protei	no	no	0.442	0.434	0.333	6e-39

>sp\|Q7XA40\|RGA3_SOLBU Putative disease resistance protein RGA3 OS=Solanum bulbocastanum GN=RGA3 PE=2 SV=2	Back alignment and function desciption

 Score =  400 bits (1027), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 277/748 (37%), Positives = 413/748 (55%), Gaps = 32/748 (4%)

Query: 4   KLEVYWRGRGFLIVLDDVWDEDGENMEKALSWLNVGGSGSCVLVTTRSGRVASMMGTVPT 63
           KL+    G+ + +VLDDVW+ED E  +   + L +G SG+ +L+TTR  ++ S+MGT+  
Sbjct: 246 KLQELLNGKRYFLVLDDVWNEDQEKWDNLRAVLKIGASGASILITTRLEKIGSIMGTLQL 305

Query: 64  QHLTCLSSEDSWVLFKHFAFGSVEDESTELEEIGQKIVAKCKGLPIAIKTIGSILRSKDK 123
             L+ LS ED W+LFK  AF    + S +L EIG++IV KC G+P+A KT+G +LR K +
Sbjct: 306 YQLSNLSQEDCWLLFKQRAFCHQTETSPKLMEIGKEIVKKCGGVPLAAKTLGGLLRFKRE 365

Query: 124 E-EWLSVADCDLWTLLEFKSHVLPVLKRSYDNLPWHLKQCFAYCSIFPKDYWINKEKLVR 182
           E EW  V D ++W L + ++ VLP L+ SY +LP  L+QCFAYC++FPKD  I KE L+ 
Sbjct: 366 ESEWEHVRDSEIWNLPQDENSVLPALRLSYHHLPLDLRQCFAYCAVFPKDTKIEKEYLIA 425

Query: 183 LWVAEGFIRLDSGSEDLEETADDYFMELLQHSFFDNIVRGIFGEVVMCKVHDYIHFLAQL 242
           LW+A  F+ L  G+ +LE+  ++ + EL   SFF  I   +       K+HD IH LA  
Sbjct: 426 LWMAHSFL-LSKGNMELEDVGNEVWNELYLRSFFQEI--EVKSGKTYFKMHDLIHDLATS 482

Query: 243 AAGVEYSIVSIRDSQNIHTDIRHCTLVGDLSSSTIPRARKLRTLLFLTVKMENLSFPCQE 302
                 S  SIR   N+  D     +V +         + + ++ F  V         + 
Sbjct: 483 MFSASASSRSIRQI-NVKDDEDMMFIVTNY--------KDMMSIGFSEVVSSYSPSLFKR 533

Query: 303 FQCLRVLDLGQSGIIKLPDSIGTLKHLRYLDLSHTYIRKIPGSISKLKHLQTLDLSNCYN 362
           F  LRVL+L  S   +LP S+G L HLRYLDLS   I  +P  + KL++LQTLDL NC +
Sbjct: 534 FVSLRVLNLSNSEFEQLPSSVGDLVHLRYLDLSGNKICSLPKRLCKLQNLQTLDLYNCQS 593

Query: 363 LEELPKGICQLTNLRTLDISSCYSLTHMPLGIGKLRPLRKLPAFILGKQRFCAGLGELKL 422
           L  LPK   +L +LR L +  C  LT MP  IG L  L+ L  F++G +R    LGEL+ 
Sbjct: 594 LSCLPKQTSKLCSLRNLVLDHC-PLTSMPPRIGLLTCLKTLGYFVVG-ERKGYQLGELRN 651

Query: 423 LDLRGRLEIKNLENLKNVVDAEEAKLHDKVHIRSLGLSWSRNAQMRDDKAQALIEFLRPP 482
           L+LRG + I +LE +KN ++A+EA L  K ++ SL +SW R  +   ++ + L E L+P 
Sbjct: 652 LNLRGAISITHLERVKNDMEAKEANLSAKANLHSLSMSWDRPNRYESEEVKVL-EALKPH 710

Query: 483 HNLKVLDLKGYRGSVFPSWLNSGV-PNLVKVSLVDC-TCQELPPLGQLPNLKDLYVKGMS 540
            NLK L++  + G   P W+N  V  N+V + +  C  C  LPP G+LP L+ L ++   
Sbjct: 711 PNLKYLEIIDFCGFCLPDWMNHSVLKNVVSILISGCENCSCLPPFGELPCLESLELQD-G 769

Query: 541 AVQIIGYKFYGNDAIRGFPSLKLLQLFDMPNLMEWKGQMTEGTDEFDGMQEPFPCLEKLV 600
           +V++   +  G    R FPSL+ L +    NL        +G     G  E FP LE++ 
Sbjct: 770 SVEVEYVEDSGFLTRRRFPSLRKLHIGGFCNL--------KGLQRMKG-AEQFPVLEEMK 820

Query: 601 VEGCSMLNTLPFIRNLKNLALCNSNDK-LVCSLSRFPSLSSL-VVDNFPELNCLSDKTGN 658
           +  C M    P + ++K L +    D   + S+S   +L+SL +  N    + L +   N
Sbjct: 821 ISDCPMF-VFPTLSSVKKLEIWGEADAGGLSSISNLSTLTSLKIFSNHTVTSLLEEMFKN 879

Query: 659 LNSLVKLTVNECDNLESLFVFMQSFSSLRHLSILHCDKLESLP-MSLEKFCSLQKLDIVE 717
           L +L+ L+V+  +NL+ L   + S ++L+ L I +C  LESLP   LE   SL +L +  
Sbjct: 880 LENLIYLSVSFLENLKELPTSLASLNNLKCLDIRYCYALESLPEEGLEGLSSLTELFVEH 939

Query: 718 CPRLVHIPDIMGQHSSLLELSIEGCPML 745
           C  L  +P+ +   ++L  L I GCP L
Sbjct: 940 CNMLKCLPEGLQHLTTLTSLKIRGCPQL 967

Disease resistance protein. Resistance proteins guard the plant against pathogens that contain an appropriate avirulence protein via a direct or indirect interaction with this avirulence protein. That triggers a defense system which restricts the pathogen growth.
Solanum bulbocastanum (taxid: 147425)

>sp\|Q7XA39\|RGA4_SOLBU Putative disease resistance protein RGA4 OS=Solanum bulbocastanum GN=RGA4 PE=2 SV=1	Back alignment and function description

>sp\|Q7XBQ9\|RGA2_SOLBU Disease resistance protein RGA2 OS=Solanum bulbocastanum GN=RGA2 PE=1 SV=1	Back alignment and function description

>sp\|Q7XA42\|RGA1_SOLBU Putative disease resistance protein RGA1 OS=Solanum bulbocastanum GN=RGA1 PE=2 SV=2	Back alignment and function description

>sp\|Q9LRR4\|R13L1_ARATH Putative disease resistance RPP13-like protein 1 OS=Arabidopsis thaliana GN=RPPL1 PE=3 SV=1	Back alignment and function description

>sp\|Q9LRR5\|DRL21_ARATH Putative disease resistance protein At3g14460 OS=Arabidopsis thaliana GN=At3g14460 PE=3 SV=1	Back alignment and function description

>sp\|Q38834\|R13L4_ARATH Disease resistance RPP13-like protein 4 OS=Arabidopsis thaliana GN=RPP13L4 PE=2 SV=2	Back alignment and function description

>sp\|Q39214\|RPM1_ARATH Disease resistance protein RPM1 OS=Arabidopsis thaliana GN=RPM1 PE=1 SV=1	Back alignment and function description

>sp\|Q9STE7\|R13L3_ARATH Putative disease resistance RPP13-like protein 3 OS=Arabidopsis thaliana GN=RPP13L3 PE=3 SV=1	Back alignment and function description

>sp\|Q9M667\|RPP13_ARATH Disease resistance protein RPP13 OS=Arabidopsis thaliana GN=RPP13 PE=2 SV=2	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		820
255568974		1177	leucine-rich repeat containing protein,	0.898	0.626	0.418	1e-145
225449965		1179	PREDICTED: putative disease resistance p	0.909	0.632	0.393	1e-129
147844250		1697	hypothetical protein VITISV_009093 [Viti	0.910	0.440	0.389	1e-129
255551388		1104	leucine-rich repeat containing protein,	0.935	0.694	0.371	1e-129
224065200		1109	nbs-lrr resistance protein [Populus tric	0.918	0.678	0.375	1e-128
224053298		1093	cc-nbs-lrr resistance protein [Populus t	0.909	0.682	0.397	1e-127
224069330		1085	cc-nbs-lrr resistance protein [Populus t	0.904	0.683	0.376	1e-126
224103271		1005	cc-nbs-lrr resistance protein [Populus t	0.851	0.694	0.381	1e-126
359479319		1357	PREDICTED: putative disease resistance p	0.931	0.563	0.379	1e-124
147798820		1385	hypothetical protein VITISV_007076 [Viti	0.931	0.551	0.379	1e-124

>gi\|255568974\|ref\|XP_002525457.1\| leucine-rich repeat containing protein, putative [Ricinus communis] gi\|223535270\|gb\|EEF36947.1\| leucine-rich repeat containing protein, putative [Ricinus communis]	Back alignment and taxonomy information

 Score =  523 bits (1348), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 323/772 (41%), Positives = 460/772 (59%), Gaps = 35/772 (4%)

Query: 11   GRGFLIVLDDVWDEDGENMEKALSWLNVGGSGSCVLVTTRSGRVASMMGTVPTQHLTCLS 70
            G  FL+VLDDVW ED    ++  + L  G  GS ++VT+RS RVA++M ++ T +L  LS
Sbjct: 270  GERFLLVLDDVWSEDYNKWDRLRTLLRGGAKGSKIIVTSRSARVAAIMSSLSTCYLAGLS 329

Query: 71   SEDSWVLFKHFAFG-SVEDESTELEEIGQKIVAKCKGLPIAIKTIGSILRSK-DKEEWLS 128
             +D W LF   AFG    +E+  +  IG++IV KC G P+A+ T+GS++ S+ D++EW+ 
Sbjct: 330  EDDCWTLFSKRAFGIGGAEETPRMVAIGKEIVKKCGGNPLAVNTLGSLMHSRRDEQEWIY 389

Query: 129  VADCDLWTLLEFKSHVLPVLKRSYDNLPWHLKQCFAYCSIFPKDYWINKEKLVRLWVAEG 188
            V D +LW L +    +LP L+ SY++LP +LK+CFAY ++FPKDY INK++L+++W+AEG
Sbjct: 390  VKDNELWKLPQECDGILPALRISYNHLPSYLKRCFAYAAVFPKDYEINKDRLIQMWIAEG 449

Query: 189  FIRLDSGSEDLEETADDYFMELLQHSFFDNIVRGIFGEVVMCKVHDYIHFLAQLAAGVEY 248
             + + +  E LE+  + YF  L+  SFF        G ++ CK+HD +H LAQ  AGVE 
Sbjct: 450  LVEISNCDEKLEDMGNTYFKYLVWRSFFQVARECEDGSIISCKIHDLMHDLAQFVAGVEC 509

Query: 249  SIVSIRDSQNIHTDIRHCTLVGDLSSSTIPR----ARKLRTLLFLTVKMENLSFPCQ--- 301
            S++    +Q I    RH +LV +  +  IP+    A+ L TLL LT K E +  P     
Sbjct: 510  SVLEAGSNQIIPKGTRHLSLVCNKVTENIPKCFYKAKNLHTLLALTEKQEAVQVPRSLFL 569

Query: 302  EFQCLRVLDLGQSGIIKLPDSIGTLKHLRYLDLSHTYIRKIPGSISKLKHLQTLDLSNCY 361
            +F+ L VL L  + I KLP+S+G L HLR LD+SHT I  +P SI+ L +LQTL+LS+C+
Sbjct: 570  KFRYLHVLILNSTCIRKLPNSLGKLIHLRLLDVSHTDIEALPKSITSLVNLQTLNLSHCF 629

Query: 362  NLEELPKGICQLTNLRTLDISSCYSLTHMPLGIGKLRPLRKLPAFILGKQRFCAGLGELK 421
             L+ELPK    L +LR   I  C+SL+ MP  IG+L  L+ L  FI+GK+  C  LGELK
Sbjct: 630  ELQELPKNTRNLISLRHTIIDHCHSLSKMPSRIGELTSLQTLSQFIVGKEYGCR-LGELK 688

Query: 422  LLDLRGRLEIKNLENLKNVVDAEEAKLHDKVHIRSLGLSWSRNAQMRDDKAQALIEFLRP 481
            LL+LRG L IK LEN+    DA+EA+L +K ++  L LSW R      D ++ ++E L+P
Sbjct: 689  LLNLRGELVIKKLENVMYRRDAKEARLQEKHNLSLLKLSWDRP----HDISEIVLEALKP 744

Query: 482  PHNLKVLDLKGYRGSVFPSWLNSGV-PNLVKVSLVDCT-CQELPPLGQLPNLKDLYVKGM 539
              NLK   LKGY G  FP+W+   +   LV++ L  C  C+ LPPLGQLP LK LY++GM
Sbjct: 745  HENLKRFHLKGYMGVKFPTWMMDAILSKLVEIKLKKCMRCEFLPPLGQLPVLKALYIRGM 804

Query: 540  SAVQIIGYKFYGNDAIRGFPSLKLLQLFDMPNLMEWKGQMTEGTDEFDGMQEPFPCLEKL 599
             AV  +G +FYGN  I GFP L+  ++  MPNL EW          FD  Q     ++KL
Sbjct: 805  DAVTYVGKEFYGNGVINGFPLLEHFEIHAMPNLEEWLN--------FDEGQ-ALTRVKKL 855

Query: 600  VVEGCSMLNTLPFIRN---LKNLALCNSNDKLVCSLSRFPSLSSLVVDNFPELNCLSDKT 656
            VV+GC  L  +P  RN   L+ L L +SN+ L+  L    SL++L +  F E+  L  + 
Sbjct: 856  VVKGCPKLRNMP--RNLSSLEELELSDSNEMLLRVLPSLTSLATLRISEFSEVISLEREV 913

Query: 657  GNLNSLVKLTVNECDNLESLFVFMQSFSSLRHLSILHCDKLESLPMSLEKFCSLQKLDIV 716
             NL +L  L +  CD L  L   + + +SL  L I  C  L SLP  ++   SL++L I+
Sbjct: 914  ENLTNLKSLHIKMCDKLVFLPRGISNLTSLGVLGIWSCSTLTSLP-EIQGLISLRELTIL 972

Query: 717  ECPRLVHIPDIMGQHSSLLE-LSIEGCP-MLKLSLKSIEFLGQLQRLVIKKC 766
             C  L  +  +  QH + LE L I GCP M+ L  + ++    LQ L I  C
Sbjct: 973  NCCMLSSLAGL--QHLTALEKLCIVGCPKMVHLMEEDVQNFTSLQSLTISHC 1022

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|225449965\|ref\|XP_002271203.1\| PREDICTED: putative disease resistance protein RGA4-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|147844250\|emb\|CAN82122.1\| hypothetical protein VITISV_009093 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|255551388\|ref\|XP_002516740.1\| leucine-rich repeat containing protein, putative [Ricinus communis] gi\|223544113\|gb\|EEF45638.1\| leucine-rich repeat containing protein, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|224065200\|ref\|XP_002301713.1\| nbs-lrr resistance protein [Populus trichocarpa] gi\|222843439\|gb\|EEE80986.1\| nbs-lrr resistance protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|224053298\|ref\|XP_002297751.1\| cc-nbs-lrr resistance protein [Populus trichocarpa] gi\|222845009\|gb\|EEE82556.1\| cc-nbs-lrr resistance protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|224069330\|ref\|XP_002302957.1\| cc-nbs-lrr resistance protein [Populus trichocarpa] gi\|222844683\|gb\|EEE82230.1\| cc-nbs-lrr resistance protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|224103271\|ref\|XP_002334072.1\| cc-nbs-lrr resistance protein [Populus trichocarpa] gi\|222839772\|gb\|EEE78095.1\| cc-nbs-lrr resistance protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|359479319\|ref\|XP_003632256.1\| PREDICTED: putative disease resistance protein At3g14460-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|147798820\|emb\|CAN67609.1\| hypothetical protein VITISV_007076 [Vitis vinifera]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		820
TAIR\|locus:2091672		1054	AT3G14470 [Arabidopsis thalian	0.859	0.668	0.326	3.9e-76
TAIR\|locus:2091662		1424	AT3G14460 [Arabidopsis thalian	0.536	0.308	0.370	2e-73
TAIR\|locus:2078012		852	ZAR1 "HOPZ-ACTIVATED RESISTANC	0.591	0.569	0.336	1.6e-54
TAIR\|locus:2077572		926	RPM1 "RESISTANCE TO P. SYRINGA	0.702	0.622	0.311	2.8e-50
UNIPROTKB\|O48647		1802	O48647 "XA1" [Oryza sativa (ta	0.558	0.254	0.293	4.6e-49
TAIR\|locus:504956483		847	AT3G46730 [Arabidopsis thalian	0.498	0.482	0.333	1.7e-46
TAIR\|locus:2075170		835	RPP13 "RECOGNITION OF PERONOSP	0.440	0.432	0.339	2.5e-40
TAIR\|locus:2169523		901	AT5G35450 [Arabidopsis thalian	0.697	0.634	0.271	2.5e-39
TAIR\|locus:2102857		847	AT3G46710 [Arabidopsis thalian	0.442	0.428	0.311	7.2e-39
TAIR\|locus:2201986		885	RFL1 "AT1G12210" [Arabidopsis	0.481	0.446	0.297	5.3e-37

TAIR\|locus:2091672 AT3G14470 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 767 (275.1 bits), Expect = 3.9e-76, P = 3.9e-76
 Identities = 256/783 (32%), Positives = 384/783 (49%)

Query:     4 KLEVYWRGRG--FLIVLDDVWDEDGENMEKALSWLNVGGSGSCVLVTTRSGRVASMMGTV 61
             KL+    G G  FL+VLDD+W+E+  + +           GS +LVTTRS RVAS+M  V
Sbjct:   267 KLKERLTGTGLPFLLVLDDLWNENFADWDLLRQPFIHAAQGSQILVTTRSQRVASIMCAV 326

Query:    62 PTQHLTCLSSEDSWVLFKHFAFGSVED-ESTELEEIGQKIVAKCKGLPIAIKTIGSILRS 120
                +L  LS  D W LF    FG+ E   + E+ ++ ++IV KC+GLP+A+KT+G +LR 
Sbjct:   327 HVHNLQPLSDGDCWSLFMKTVFGNQEPCLNREIGDLAERIVHKCRGLPLAVKTLGGVLRF 386

Query:   121 KDKE-EWLSVADCDLWTLLEFKSHVLPVLKRSYDNLPWHLKQCFAYCSIFPKDYWINKEK 179
             + K  EW  V    +W L   KS++LPVL+ SY  LP HLK+CFAYCSIFPK +   K+K
Sbjct:   387 EGKVIEWERVLSSRIWDLPADKSNLLPVLRVSYYYLPAHLKRCFAYCSIFPKGHAFEKDK 446

Query:   180 LVRLWVAEGFIRLDSGSEDLEETADDYFMELLQHSFFDNIVRGIFGEVVMCKVHDYIHFL 239
             +V LW+AEGF++    S++LEE  ++YF EL   S             +M   HD+I+ L
Sbjct:   447 VVLLWMAEGFLQQTRSSKNLEELGNEYFSELESRSLLQKTKT----RYIM---HDFINEL 499

Query:   240 AQLAAGVEYSIVSIRDSQNIHTD--IRHCTLVGD-----LSSSTIPRARKLRTLLFLTVK 292
             AQ A+G E+S     D   +      R+ + + D     +    +   + LRT  FL + 
Sbjct:   500 AQFASG-EFSS-KFEDGCKLQVSERTRYLSYLRDNYAEPMEFEALREVKFLRT--FLPLS 555

Query:   293 MENLSFPCQEFQC-----------LRVLDLGQSGIIKLP-DSIGTLKHLRYLDLSHTYIR 340
             + N S  C   Q            LRVL L    I +LP D    + H R+LDLS T + 
Sbjct:   556 LTNSSRSCCLDQMVSEKLLPTLTRLRVLSLSHYKIARLPPDFFKNISHARFLDLSRTELE 615

Query:   341 KIPGSISKLKHLQTLDLSNCYNLEELPKGICQLTNLRTLDISSCYSLTHMPLGIGKLRPL 400
             K+P S+  + +LQTL LS C +L+ELP  I  L NLR LD+     L  MP   G+L+ L
Sbjct:   616 KLPKSLCYMYNLQTLLLSYCSSLKELPTDISNLINLRYLDLIGT-KLRQMPRRFGRLKSL 674

Query:   401 RKLPAFILGKQRFCAGLGELK-LLDLRGRLEIKNLENLKNVVDAEEAKLHDKVHIRSLGL 459
             + L  F +      + + EL  L DL G+L+I  L+ + +V DA EA L+ K H+R +  
Sbjct:   675 QTLTTFFVSASDG-SRISELGGLHDLHGKLKIVELQRVVDVADAAEANLNSKKHLREIDF 733

Query:   460 SW---------SRNAQMRDDKAQALIEFLRPPHNLKVLDLKGYRGSVFPSWLNSGVPNLV 510
              W         + N     ++A+ + E LRP  +++ L ++ Y+G  FP WL+   P+  
Sbjct:   734 VWRTGSSSSENNTNPHRTQNEAE-VFEKLRPHRHIEKLAIERYKGRRFPDWLSD--PSFS 790

Query:   511 KVSLVDCT-CQELPPLGQLPNLKDLYVKGMSAVQIIGYKFYGNDAIRGFPSLKLLQLFDM 569
             ++  +    CQ    L  L  L  L  K +    ++G +  G      F   +L      
Sbjct:   791 RIVCIRLRECQYCTSLPSLGQLPCL--KELHISGMVGLQSIGRKFY--FSDQQLRDQDQQ 846

Query:   570 PNLMEWKGQMTEGTDEFDGMQEPFPCLEKLVVEGCSMLNTLPFIRNLKNLALCNSNDKLV 629
             P    ++   T   D     QE    L+  V  G    +  P ++ L  L  C    +L 
Sbjct:   847 P----FRSLETLRFDNLPDWQE---WLDVRVTRG----DLFPSLKKLFILR-C---PELT 891

Query:   630 CSLSRF-PSLSSLVVDNFPELNCLSDKTG-NLNSLVKLTV-NECDNLESLFVFMQSFSSL 686
              +L  F PSL SL +     L+   D    +  +L  L++ + CD L   F  +  F++L
Sbjct:   892 GTLPTFLPSLISLHIYKCGLLDFQPDHHEYSYRNLQTLSIKSSCDTLVK-FP-LNHFANL 949

Query:   687 RHLSILHCDKLESLPMSLEKFC---SLQKLDIVECPRLVHIPDIMGQHSSLLELSIEGCP 743
               L +  C  L SL +S E      +L+ L I +C  L  +P +     +L +++I  C 
Sbjct:   950 DKLEVDQCTSLYSLELSNEHLRGPNALRNLRINDCQNLQLLPKLNALPQNL-QVTITNCR 1008

Query:   744 MLK 746
              L+
Sbjct:  1009 YLR 1011

GO:0005576 "extracellular region" evidence=ISM

GO:0006952 "defense response" evidence=IEA;ISS

GO:0043531 "ADP binding" evidence=IEA

GO:0005515 "protein binding" evidence=IPI

GO:0009627 "systemic acquired resistance" evidence=RCA

GO:0009697 "salicylic acid biosynthetic process" evidence=RCA

TAIR\|locus:2091662 AT3G14460 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2078012 ZAR1 "HOPZ-ACTIVATED RESISTANCE 1" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2077572 RPM1 "RESISTANCE TO P. SYRINGAE PV MACULICOLA 1" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

UNIPROTKB\|O48647 O48647 "XA1" [Oryza sativa (taxid:4530)]	Back alignment and assigned GO terms

TAIR\|locus:504956483 AT3G46730 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2075170 RPP13 "RECOGNITION OF PERONOSPORA PARASITICA 13" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2169523 AT5G35450 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2102857 AT3G46710 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2201986 RFL1 "AT1G12210" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		820
pfam00931		285	pfam00931, NB-ARC, NB-ARC domain	4e-51
PLN03210		1153	PLN03210, PLN03210, Resistant to P	8e-10
COG4886		394	COG4886, COG4886, Leucine-rich repeat (LRR) protei	9e-10
PLN03210		1153	PLN03210, PLN03210, Resistant to P	1e-07
pfam13855		60	pfam13855, LRR_8, Leucine rich repeat	2e-07
pfam13855		60	pfam13855, LRR_8, Leucine rich repeat	2e-06
COG4886		394	COG4886, COG4886, Leucine-rich repeat (LRR) protei	3e-06
COG4886		394	COG4886, COG4886, Leucine-rich repeat (LRR) protei	6e-06
PLN03150		623	PLN03150, PLN03150, hypothetical protein; Provisio	1e-05
pfam12799		43	pfam12799, LRR_4, Leucine Rich repeats (2 copies)	5e-05
PLN00113		968	PLN00113, PLN00113, leucine-rich repeat receptor-l	1e-04
PLN03150		623	PLN03150, PLN03150, hypothetical protein; Provisio	2e-04
PLN00113		968	PLN00113, PLN00113, leucine-rich repeat receptor-l	2e-04
pfam12799		43	pfam12799, LRR_4, Leucine Rich repeats (2 copies)	0.002
pfam12799		43	pfam12799, LRR_4, Leucine Rich repeats (2 copies)	0.003

>gnl\|CDD\|216202 pfam00931, NB-ARC, NB-ARC domain	Back alignment and domain information

 Score =  180 bits (458), Expect = 4e-51
 Identities = 81/191 (42%), Positives = 113/191 (59%), Gaps = 6/191 (3%)

Query: 4   KLEVYWRGRGFLIVLDDVWDEDGENMEKALSWLNVGGSGSCVLVTTRSGRVASMMGTVPT 63
           K++     + FL+VLDDVW++   + +K       G +GS V+VTTRS  VA  MG    
Sbjct: 92  KIKEALLRKRFLLVLDDVWEK--NDWDKIGVPFPDGENGSRVIVTTRSESVAGRMGGTSK 149

Query: 64  QH-LTCLSSEDSWVLFKHFAFGSVEDESTELEEIGQKIVAKCKGLPIAIKTIGSILRSKD 122
            H +  L  E+SW LF +  F        ELEE+ ++IV KCKGLP+A+K +G +L  K 
Sbjct: 150 PHEVESLEPEESWELFSNKVFEKELPPCPELEEVAKEIVEKCKGLPLALKVLGGLLAFKS 209

Query: 123 K-EEWLSVADCDLWTLLEFKS--HVLPVLKRSYDNLPWHLKQCFAYCSIFPKDYWINKEK 179
             +EW  V +     L        VL +L  SYDNLP HLK+CF Y ++FP+DY I KE+
Sbjct: 210 TVQEWEHVLEQLNNELAGRDGLNEVLSILSLSYDNLPMHLKRCFLYLALFPEDYNIRKEQ 269

Query: 180 LVRLWVAEGFI 190
           L++LW+AEGF+
Sbjct: 270 LIKLWIAEGFV 280

Length = 285

>gnl\|CDD\|215633 PLN03210, PLN03210, Resistant to P	Back alignment and domain information

>gnl\|CDD\|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>gnl\|CDD\|215633 PLN03210, PLN03210, Resistant to P	Back alignment and domain information

>gnl\|CDD\|206026 pfam13855, LRR_8, Leucine rich repeat	Back alignment and domain information

>gnl\|CDD\|206026 pfam13855, LRR_8, Leucine rich repeat	Back alignment and domain information

>gnl\|CDD\|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>gnl\|CDD\|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>gnl\|CDD\|178695 PLN03150, PLN03150, hypothetical protein; Provisional	Back alignment and domain information

>gnl\|CDD\|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies)	Back alignment and domain information

>gnl\|CDD\|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|178695 PLN03150, PLN03150, hypothetical protein; Provisional	Back alignment and domain information

>gnl\|CDD\|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies)	Back alignment and domain information

>gnl\|CDD\|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies)	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		820
PLN03210		1153	Resistant to P. syringae 6; Provisional	100.0
KOG4658		889	consensus Apoptotic ATPase [Signal transduction me	100.0
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	100.0
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	100.0
KOG4194		873	consensus Membrane glycoprotein LIG-1 [Signal tran	100.0
KOG4194		873	consensus Membrane glycoprotein LIG-1 [Signal tran	100.0
KOG0472		565	consensus Leucine-rich repeat protein [Function un	99.97
KOG0444		1255	consensus Cytoskeletal regulator Flightless-I (con	99.97
KOG0472		565	consensus Leucine-rich repeat protein [Function un	99.96
PF00931		287	NB-ARC: NB-ARC domain; InterPro: IPR002182 This is	99.95
KOG0618		1081	consensus Serine/threonine phosphatase 2C containi	99.95
KOG0444		1255	consensus Cytoskeletal regulator Flightless-I (con	99.95
KOG0618		1081	consensus Serine/threonine phosphatase 2C containi	99.95
PLN03210		1153	Resistant to P. syringae 6; Provisional	99.93
KOG4237		498	consensus Extracellular matrix protein slit, conta	99.85
PRK15387		788	E3 ubiquitin-protein ligase SspH2; Provisional	99.81
KOG4237		498	consensus Extracellular matrix protein slit, conta	99.81
PRK15387		788	E3 ubiquitin-protein ligase SspH2; Provisional	99.8
PRK15370		754	E3 ubiquitin-protein ligase SlrP; Provisional	99.7
PRK15370		754	E3 ubiquitin-protein ligase SlrP; Provisional	99.69
KOG0617		264	consensus Ras suppressor protein (contains leucine	99.65
KOG0617		264	consensus Ras suppressor protein (contains leucine	99.58
cd00116		319	LRR_RI Leucine-rich repeats (LRRs), ribonuclease i	99.5
cd00116		319	LRR_RI Leucine-rich repeats (LRRs), ribonuclease i	99.49
KOG4658		889	consensus Apoptotic ATPase [Signal transduction me	99.3
PF14580		175	LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ	99.1
KOG0532		722	consensus Leucine-rich repeat (LRR) protein, conta	99.07
KOG0532		722	consensus Leucine-rich repeat (LRR) protein, conta	99.06
COG4886		394	Leucine-rich repeat (LRR) protein [Function unknow	99.01
PF14580		175	LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ	98.99
KOG3207		505	consensus Beta-tubulin folding cofactor E [Posttra	98.98
KOG3207		505	consensus Beta-tubulin folding cofactor E [Posttra	98.97
COG4886		394	Leucine-rich repeat (LRR) protein [Function unknow	98.93
KOG1259		490	consensus Nischarin, modulator of integrin alpha5	98.85
PLN03150		623	hypothetical protein; Provisional	98.8
PLN03150		623	hypothetical protein; Provisional	98.8
KOG1909		382	consensus Ran GTPase-activating protein [RNA proce	98.77
KOG1909		382	consensus Ran GTPase-activating protein [RNA proce	98.76
PF13855		61	LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF	98.73
KOG1259		490	consensus Nischarin, modulator of integrin alpha5	98.71
KOG0531		414	consensus Protein phosphatase 1, regulatory subuni	98.65
PF13855		61	LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF	98.65
KOG0531		414	consensus Protein phosphatase 1, regulatory subuni	98.59
KOG4341		483	consensus F-box protein containing LRR [General fu	98.39
KOG2120		419	consensus SCF ubiquitin ligase, Skp2 component [Po	98.35
KOG2120		419	consensus SCF ubiquitin ligase, Skp2 component [Po	98.33
KOG4341		483	consensus F-box protein containing LRR [General fu	98.28
PF12799		44	LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_	98.27
KOG2982		418	consensus Uncharacterized conserved protein [Funct	98.24
KOG1859		1096	consensus Leucine-rich repeat proteins [General fu	98.14
PRK15386		426	type III secretion protein GogB; Provisional	98.11
KOG4579		177	consensus Leucine-rich repeat (LRR) protein associ	98.07
KOG4579		177	consensus Leucine-rich repeat (LRR) protein associ	98.06
PF12799		44	LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_	98.06
PRK15386		426	type III secretion protein GogB; Provisional	98.06
KOG1859		1096	consensus Leucine-rich repeat proteins [General fu	98.03
KOG2982		418	consensus Uncharacterized conserved protein [Funct	97.97
PRK04841		903	transcriptional regulator MalT; Provisional	97.68
COG5238		388	RNA1 Ran GTPase-activating protein (RanGAP) involv	97.64
KOG3665		699	consensus ZYG-1-like serine/threonine protein kina	97.52
KOG1644		233	consensus U2-associated snRNP A' protein [RNA proc	97.4
KOG3665		699	consensus ZYG-1-like serine/threonine protein kina	97.35
KOG1644		233	consensus U2-associated snRNP A' protein [RNA proc	97.34
COG5238		388	RNA1 Ran GTPase-activating protein (RanGAP) involv	97.18
PF13306		129	LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_	97.18
PF13306		129	LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_	97.14
KOG2739		260	consensus Leucine-rich acidic nuclear protein [Cel	97.09
KOG2123		388	consensus Uncharacterized conserved protein [Funct	97.07
KOG2123		388	consensus Uncharacterized conserved protein [Funct	96.95
KOG2739		260	consensus Leucine-rich acidic nuclear protein [Cel	96.93
TIGR03015		269	pepcterm_ATPase putative secretion ATPase, PEP-CTE	96.73
PF00560		22	LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le	96.65
KOG1947		482	consensus Leucine rich repeat proteins, some prote	96.64
PRK06893		229	DNA replication initiation factor; Validated	96.16
PF00560		22	LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le	96.01
PRK00411		394	cdc6 cell division control protein 6; Reviewed	96.0
KOG0473		326	consensus Leucine-rich repeat protein [Function un	95.96
PRK00080		328	ruvB Holliday junction DNA helicase RuvB; Reviewed	95.84
PF05729		166	NACHT: NACHT domain	95.79
PF01637		234	Arch_ATPase: Archaeal ATPase; InterPro: IPR011579	95.62
TIGR00635		305	ruvB Holliday junction DNA helicase, RuvB subunit.	95.41
KOG0473		326	consensus Leucine-rich repeat protein [Function un	95.27
PF13504		17	LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO	95.24
KOG1947		482	consensus Leucine rich repeat proteins, some prote	95.08
KOG3864		221	consensus Uncharacterized conserved protein [Funct	94.94
COG3903		414	Predicted ATPase [General function prediction only	94.5
COG2909		894	MalT ATP-dependent transcriptional regulator [Tran	94.29
PF13173		128	AAA_14: AAA domain	93.71
PRK07471		365	DNA polymerase III subunit delta'; Validated	93.52
PF13504		17	LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO	93.37
TIGR03420		226	DnaA_homol_Hda DnaA regulatory inactivator Hda. Me	92.27
PRK09087		226	hypothetical protein; Validated	91.95
smart00370		26	LRR Leucine-rich repeats, outliers.	91.73
smart00369		26	LRR_TYP Leucine-rich repeats, typical (most popula	91.73
TIGR00678		188	holB DNA polymerase III, delta' subunit. At positi	90.33
TIGR02928		365	orc1/cdc6 family replication initiation protein. M	90.19
KOG3864		221	consensus Uncharacterized conserved protein [Funct	89.16
KOG0989		346	consensus Replication factor C, subunit RFC4 [Repl	88.95
PRK08727		233	hypothetical protein; Validated	88.94
PRK06645		507	DNA polymerase III subunits gamma and tau; Validat	88.06
TIGR02903		615	spore_lon_C ATP-dependent protease, Lon family. Me	87.15
PRK05564		313	DNA polymerase III subunit delta'; Validated	86.65
PRK09112		351	DNA polymerase III subunit delta'; Validated	86.45
PRK13342		413	recombination factor protein RarA; Reviewed	86.39
PF14516		331	AAA_35: AAA-like domain	86.27
PRK07003		830	DNA polymerase III subunits gamma and tau; Validat	85.92
PF00308		219	Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013	85.71
PRK08084		235	DNA replication initiation factor; Provisional	85.68
PRK06620		214	hypothetical protein; Validated	85.31
PRK14961		363	DNA polymerase III subunits gamma and tau; Provisi	85.01
PRK14963		504	DNA polymerase III subunits gamma and tau; Provisi	84.81
smart00370		26	LRR Leucine-rich repeats, outliers.	84.76
smart00369		26	LRR_TYP Leucine-rich repeats, typical (most popula	84.76
KOG4308		478	consensus LRR-containing protein [Function unknown	84.51
PRK08691		709	DNA polymerase III subunits gamma and tau; Validat	84.28
PRK12402		337	replication factor C small subunit 2; Reviewed	83.49
KOG4308		478	consensus LRR-containing protein [Function unknown	83.18
PRK07940		394	DNA polymerase III subunit delta'; Validated	82.92
PLN03025		319	replication factor C subunit; Provisional	82.48
smart00365		26	LRR_SD22 Leucine-rich repeat, SDS22-like subfamily	82.29
smart00364		26	LRR_BAC Leucine-rich repeats, bacterial type.	81.69
PRK05707		328	DNA polymerase III subunit delta'; Validated	81.41
PRK05642		234	DNA replication initiation factor; Validated	81.03
PRK08903		227	DnaA regulatory inactivator Hda; Validated	80.71
PRK14960		702	DNA polymerase III subunits gamma and tau; Provisi	80.43
PRK12323		700	DNA polymerase III subunits gamma and tau; Provisi	80.43

>PLN03210 Resistant to P	Back alignment and domain information

Probab=100.00  E-value=6e-59  Score=557.49  Aligned_cols=591  Identities=23%  Similarity=0.309  Sum_probs=407.7

Q ss_pred             HHHHHHcCCceEEEEEeCCCCCChhhHHHHHhhccCCCCCcEEEEecCchHHHhhhCCCCeEeCCCCChHhHHHHHHHHh
Q 003435            3 WKLEVYWRGRGFLIVLDDVWDEDGENMEKALSWLNVGGSGSCVLVTTRSGRVASMMGTVPTQHLTCLSSEDSWVLFKHFA   82 (820)
Q Consensus         3 ~~l~~~l~~~~~llvlDdv~~~~~~~~~~~~~~~~~~~~gs~iiiTtr~~~~~~~~~~~~~~~l~~l~~~~a~~Lf~~~~   82 (820)
                      ..+++.+++||+||||||||+  .+.|+.+.....+.++||+||||||+++++..++++.+|+|+.++++|||+||++.|
T Consensus       287 ~~~~~~L~~krvLLVLDdv~~--~~~l~~L~~~~~~~~~GsrIIiTTrd~~vl~~~~~~~~~~v~~l~~~ea~~LF~~~A  364 (1153)
T PLN03210        287 GAMEERLKHRKVLIFIDDLDD--QDVLDALAGQTQWFGSGSRIIVITKDKHFLRAHGIDHIYEVCLPSNELALEMFCRSA  364 (1153)
T ss_pred             HHHHHHHhCCeEEEEEeCCCC--HHHHHHHHhhCccCCCCcEEEEEeCcHHHHHhcCCCeEEEecCCCHHHHHHHHHHHh
Confidence            357889999999999999986  477999888777778999999999999999888888899999999999999999999


Q ss_pred             cCCCCCCChhHHHHHHHHHHHhcCChHHHHHHHHhhccCCHHHHHHhhhcchhchhccCcchhhHHHhhhcCCCh-hHHH
Q 003435           83 FGSVEDESTELEEIGQKIVAKCKGLPIAIKTIGSILRSKDKEEWLSVADCDLWTLLEFKSHVLPVLKRSYDNLPW-HLKQ  161 (820)
Q Consensus        83 ~~~~~~~~~~~~~~~~~i~~~c~glPlal~~~~~~l~~k~~~~w~~~~~~~~~~~~~~~~~i~~~l~~sy~~L~~-~~k~  161 (820)
                      |+... +.+++.+++++|+++|+|+|||++++|++|++|+.++|+.++++.....   +.+|+++|++||++|++ ..|.
T Consensus       365 f~~~~-~~~~~~~l~~~iv~~c~GLPLAl~vlgs~L~~k~~~~W~~~l~~L~~~~---~~~I~~~L~~SYd~L~~~~~k~  440 (1153)
T PLN03210        365 FKKNS-PPDGFMELASEVALRAGNLPLGLNVLGSYLRGRDKEDWMDMLPRLRNGL---DGKIEKTLRVSYDGLNNKKDKA  440 (1153)
T ss_pred             cCCCC-CcHHHHHHHHHHHHHhCCCcHHHHHHHHHHcCCCHHHHHHHHHHHHhCc---cHHHHHHHHHhhhccCccchhh
Confidence            97743 3567899999999999999999999999999999999999988644322   35699999999999976 5999


Q ss_pred             HHhhhcCCCCCcccCHHHHHHHHHHcCCcccCCCCCcHHHHHHHHHHHHhhcccccccccccCCcEEEEEecchHHHHHH
Q 003435          162 CFAYCSIFPKDYWINKEKLVRLWVAEGFIRLDSGSEDLEETADDYFMELLQHSFFDNIVRGIFGEVVMCKVHDYIHFLAQ  241 (820)
Q Consensus       162 ~fl~~a~f~~~~~i~~~~li~~w~~~gl~~~~~~~~~~~~~~~~~l~~L~~~~li~~~~~~~~~~~~~~~~h~~v~~~~~  241 (820)
                      ||+++|+||.+..++   .+..|.+.+.+..           +..+..|+++++++...       ..++||++++++++
T Consensus       441 ~Fl~ia~ff~~~~~~---~v~~~l~~~~~~~-----------~~~l~~L~~ksLi~~~~-------~~~~MHdLl~~~~r  499 (1153)
T PLN03210        441 IFRHIACLFNGEKVN---DIKLLLANSDLDV-----------NIGLKNLVDKSLIHVRE-------DIVEMHSLLQEMGK  499 (1153)
T ss_pred             hhheehhhcCCCCHH---HHHHHHHhcCCCc-----------hhChHHHHhcCCEEEcC-------CeEEhhhHHHHHHH
Confidence            999999999987543   3666776654432           12377899999997542       13799999999999


Q ss_pred             HhhcCce-------EEEeccC------CCCCCCceeEEEeecc------CCCCcccCCCCccEEEeeccccc-------c
Q 003435          242 LAAGVEY-------SIVSIRD------SQNIHTDIRHCTLVGD------LSSSTIPRARKLRTLLFLTVKME-------N  295 (820)
Q Consensus       242 ~~~~~~~-------~~~~~~~------~~~~~~~~~~l~l~~~------~~~~~~~~~~~L~~L~l~~n~~~-------~  295 (820)
                      .+++.+.       +.+....      ...-...++.+++.-.      +...+|.++++|+.|.+..+...       .
T Consensus       500 ~i~~~~~~~~~~r~~l~~~~di~~vl~~~~g~~~v~~i~l~~~~~~~~~i~~~aF~~m~~L~~L~~~~~~~~~~~~~~~~  579 (1153)
T PLN03210        500 EIVRAQSNEPGEREFLVDAKDICDVLEDNTGTKKVLGITLDIDEIDELHIHENAFKGMRNLLFLKFYTKKWDQKKEVRWH  579 (1153)
T ss_pred             HHHHhhcCCCCcceeEeCHHHHHHHHHhCcccceeeEEEeccCccceeeecHHHHhcCccccEEEEecccccccccceee
Confidence            9886542       1111100      0111234455554322      45677999999999999766422       3


Q ss_pred             cCccccCC-ceeEEEEeCCCCCcccCccccCcccccEEeccCccccccccccccCCcccEEeccCCCCccccchhccCCC
Q 003435          296 LSFPCQEF-QCLRVLDLGQSGIIKLPDSIGTLKHLRYLDLSHTYIRKIPGSISKLKHLQTLDLSNCYNLEELPKGICQLT  374 (820)
Q Consensus       296 l~~~~~~l-~~L~~L~L~~n~l~~lp~~~~~l~~L~~L~Ls~n~i~~lp~~~~~L~~L~~L~L~~n~~~~~lp~~~~~l~  374 (820)
                      +|..|..+ .+|+.|++.++.+..+|..| ...+|++|++++|.+..+|..+..+++|++|+|++|..++.+|. ++.++
T Consensus       580 lp~~~~~lp~~Lr~L~~~~~~l~~lP~~f-~~~~L~~L~L~~s~l~~L~~~~~~l~~Lk~L~Ls~~~~l~~ip~-ls~l~  657 (1153)
T PLN03210        580 LPEGFDYLPPKLRLLRWDKYPLRCMPSNF-RPENLVKLQMQGSKLEKLWDGVHSLTGLRNIDLRGSKNLKEIPD-LSMAT  657 (1153)
T ss_pred             cCcchhhcCcccEEEEecCCCCCCCCCcC-CccCCcEEECcCccccccccccccCCCCCEEECCCCCCcCcCCc-cccCC
Confidence            55556655 46999999999999999888 57899999999999999999999999999999999888888886 88999


Q ss_pred             CCcEEecCCCCCccccCcccCCCCCCCccCceeeCCccccccccccccCCCCCceeecccCCCCChhhhhhhcccccccc
Q 003435          375 NLRTLDISSCYSLTHMPLGIGKLRPLRKLPAFILGKQRFCAGLGELKLLDLRGRLEIKNLENLKNVVDAEEAKLHDKVHI  454 (820)
Q Consensus       375 ~L~~L~L~~n~~~~~~p~~~~~l~~L~~L~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~l~~~~~~~~~~~~~l~~~~~L  454 (820)
                      +|++|++++|.....+|..++++++|+.|++..+.         .++.+.                              
T Consensus       658 ~Le~L~L~~c~~L~~lp~si~~L~~L~~L~L~~c~---------~L~~Lp------------------------------  698 (1153)
T PLN03210        658 NLETLKLSDCSSLVELPSSIQYLNKLEDLDMSRCE---------NLEILP------------------------------  698 (1153)
T ss_pred             cccEEEecCCCCccccchhhhccCCCCEEeCCCCC---------CcCccC------------------------------
Confidence            99999999998888889888888777777543211         111100                              


Q ss_pred             ceeeEEeccCCccChhhHHHHhhccCCCCCCcEEEEecCC-CCCCCcccccCCCCccEEEecccccCCCCCCCCCCCCcc
Q 003435          455 RSLGLSWSRNAQMRDDKAQALIEFLRPPHNLKVLDLKGYR-GSVFPSWLNSGVPNLVKVSLVDCTCQELPPLGQLPNLKD  533 (820)
Q Consensus       455 ~~L~l~~~~~~~~~~~~~~~~~~~l~~~~~L~~L~L~~n~-~~~~~~~~~~~l~~L~~L~L~~n~~~~l~~l~~l~~L~~  533 (820)
                                            ..+ .+++|+.|++++|. +..+|.    ..++|+.|++++|.+..+|....+++|+.
T Consensus       699 ----------------------~~i-~l~sL~~L~Lsgc~~L~~~p~----~~~nL~~L~L~~n~i~~lP~~~~l~~L~~  751 (1153)
T PLN03210        699 ----------------------TGI-NLKSLYRLNLSGCSRLKSFPD----ISTNISWLDLDETAIEEFPSNLRLENLDE  751 (1153)
T ss_pred             ----------------------CcC-CCCCCCEEeCCCCCCcccccc----ccCCcCeeecCCCcccccccccccccccc
Confidence                                  000 23456666666553 222222    23466666666666666665334555555


Q ss_pred             eeeccCcCceEeCccccCCCcccCCCCcceeecCCCcccccccccccCCCccCCCCCCCCCcccEEEEcCCCCCCCCCCC
Q 003435          534 LYVKGMSAVQIIGYKFYGNDAIRGFPSLKLLQLFDMPNLMEWKGQMTEGTDEFDGMQEPFPCLEKLVVEGCSMLNTLPFI  613 (820)
Q Consensus       534 L~L~~n~~~~~~~~~~~~~~~~~~l~~L~~L~l~~~~~l~~~~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~l  613 (820)
                      |.+.++.......          .+..                        ..+.....+++|+.|++++|+....+|. 
T Consensus       752 L~l~~~~~~~l~~----------~~~~------------------------l~~~~~~~~~sL~~L~Ls~n~~l~~lP~-  796 (1153)
T PLN03210        752 LILCEMKSEKLWE----------RVQP------------------------LTPLMTMLSPSLTRLFLSDIPSLVELPS-  796 (1153)
T ss_pred             ccccccchhhccc----------cccc------------------------cchhhhhccccchheeCCCCCCccccCh-
Confidence            5554432111100          0000                        0000011234455555555544444332 


Q ss_pred             CCcCceEecccCCccccccCCCCCcceEEccCCCCCccccccCCCCCCccEEEEccCCCccchhhhcCCCCCcceEeecc
Q 003435          614 RNLKNLALCNSNDKLVCSLSRFPSLSSLVVDNFPELNCLSDKTGNLNSLVKLTVNECDNLESLFVFMQSFSSLRHLSILH  693 (820)
Q Consensus       614 ~~L~~L~l~~~~~~~~~~~~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~L~~n~~~~~~~~~~~~l~~L~~L~l~~  693 (820)
                                       ++.++++|+.|++++|...+.+|... ++++|+.|++++|..+..+|..   .++|++|++++
T Consensus       797 -----------------si~~L~~L~~L~Ls~C~~L~~LP~~~-~L~sL~~L~Ls~c~~L~~~p~~---~~nL~~L~Ls~  855 (1153)
T PLN03210        797 -----------------SIQNLHKLEHLEIENCINLETLPTGI-NLESLESLDLSGCSRLRTFPDI---STNISDLNLSR  855 (1153)
T ss_pred             -----------------hhhCCCCCCEEECCCCCCcCeeCCCC-CccccCEEECCCCCcccccccc---ccccCEeECCC
Confidence                             45556666666666665555555444 5566666666666555544432   24566666666


Q ss_pred             CcccccCccccCCCCcccEEEecCCCCCCccccccCCCCCccEEEeccCCCc
Q 003435          694 CDKLESLPMSLEKFCSLQKLDIVECPRLVHIPDIMGQHSSLLELSIEGCPML  745 (820)
Q Consensus       694 n~~~~~~~~~l~~l~~L~~L~L~~n~~~~~~~~~~~~l~~L~~L~l~~n~~~  745 (820)
                      |.+ ..+|..+..+++|++|++++|+.+..+|..+..+++|+.+++++|..+
T Consensus       856 n~i-~~iP~si~~l~~L~~L~L~~C~~L~~l~~~~~~L~~L~~L~l~~C~~L  906 (1153)
T PLN03210        856 TGI-EEVPWWIEKFSNLSFLDMNGCNNLQRVSLNISKLKHLETVDFSDCGAL  906 (1153)
T ss_pred             CCC-ccChHHHhcCCCCCEEECCCCCCcCccCcccccccCCCeeecCCCccc
Confidence            543 345555666666666666666555555555555666666666666543

syringae 6; Provisional

>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms]	Back alignment and domain information

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms]	Back alignment and domain information

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms]	Back alignment and domain information

>KOG0472 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton]	Back alignment and domain information

>KOG0472 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals []	Back alignment and domain information

>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms]	Back alignment and domain information

>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton]	Back alignment and domain information

>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms]	Back alignment and domain information

>PLN03210 Resistant to P	Back alignment and domain information

>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms]	Back alignment and domain information

>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms]	Back alignment and domain information

>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms]	Back alignment and domain information

>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms]	Back alignment and domain information

>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms]	Back alignment and domain information

>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A	Back alignment and domain information

>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton]	Back alignment and domain information

>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton]	Back alignment and domain information

>COG4886 Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A	Back alignment and domain information

>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG4886 Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>PLN03150 hypothetical protein; Provisional	Back alignment and domain information

>PLN03150 hypothetical protein; Provisional	Back alignment and domain information

>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms]	Back alignment and domain information

>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms]	Back alignment and domain information

>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A	Back alignment and domain information

>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms]	Back alignment and domain information

>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A	Back alignment and domain information

>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms]	Back alignment and domain information

>KOG4341 consensus F-box protein containing LRR [General function prediction only]	Back alignment and domain information

>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG4341 consensus F-box protein containing LRR [General function prediction only]	Back alignment and domain information

>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B	Back alignment and domain information

>KOG2982 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only]	Back alignment and domain information

>PRK15386 type III secretion protein GogB; Provisional	Back alignment and domain information

>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only]	Back alignment and domain information

>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only]	Back alignment and domain information

>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B	Back alignment and domain information

>PRK15386 type III secretion protein GogB; Provisional	Back alignment and domain information

>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only]	Back alignment and domain information

>KOG2982 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PRK04841 transcriptional regulator MalT; Provisional	Back alignment and domain information

>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification]	Back alignment and domain information

>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only]	Back alignment and domain information

>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification]	Back alignment and domain information

>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only]	Back alignment and domain information

>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification]	Back alignment and domain information

>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification]	Back alignment and domain information

>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A	Back alignment and domain information

>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A	Back alignment and domain information

>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>KOG2123 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG2123 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily	Back alignment and domain information

>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape []	Back alignment and domain information

>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only]	Back alignment and domain information

>PRK06893 DNA replication initiation factor; Validated	Back alignment and domain information

>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape []	Back alignment and domain information

>PRK00411 cdc6 cell division control protein 6; Reviewed	Back alignment and domain information

>KOG0473 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed	Back alignment and domain information

>PF05729 NACHT: NACHT domain	Back alignment and domain information

>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP	Back alignment and domain information

>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit	Back alignment and domain information

>KOG0473 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D	Back alignment and domain information

>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only]	Back alignment and domain information

>KOG3864 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>COG3903 Predicted ATPase [General function prediction only]	Back alignment and domain information

>COG2909 MalT ATP-dependent transcriptional regulator [Transcription]	Back alignment and domain information

>PF13173 AAA_14: AAA domain	Back alignment and domain information

>PRK07471 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D	Back alignment and domain information

>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda	Back alignment and domain information

>PRK09087 hypothetical protein; Validated	Back alignment and domain information

>smart00370 LRR Leucine-rich repeats, outliers	Back alignment and domain information

>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily	Back alignment and domain information

>TIGR00678 holB DNA polymerase III, delta' subunit	Back alignment and domain information

>TIGR02928 orc1/cdc6 family replication initiation protein	Back alignment and domain information

>KOG3864 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair]	Back alignment and domain information

>PRK08727 hypothetical protein; Validated	Back alignment and domain information

>PRK06645 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>TIGR02903 spore_lon_C ATP-dependent protease, Lon family	Back alignment and domain information

>PRK05564 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK09112 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK13342 recombination factor protein RarA; Reviewed	Back alignment and domain information

>PF14516 AAA_35: AAA-like domain	Back alignment and domain information

>PRK07003 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication	Back alignment and domain information

>PRK08084 DNA replication initiation factor; Provisional	Back alignment and domain information

>PRK06620 hypothetical protein; Validated	Back alignment and domain information

>PRK14961 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14963 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>smart00370 LRR Leucine-rich repeats, outliers	Back alignment and domain information

>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily	Back alignment and domain information

>KOG4308 consensus LRR-containing protein [Function unknown]	Back alignment and domain information

>PRK08691 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK12402 replication factor C small subunit 2; Reviewed	Back alignment and domain information

>KOG4308 consensus LRR-containing protein [Function unknown]	Back alignment and domain information

>PRK07940 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PLN03025 replication factor C subunit; Provisional	Back alignment and domain information

>smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily	Back alignment and domain information

>smart00364 LRR_BAC Leucine-rich repeats, bacterial type	Back alignment and domain information

>PRK05707 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK05642 DNA replication initiation factor; Validated	Back alignment and domain information

>PRK08903 DnaA regulatory inactivator Hda; Validated	Back alignment and domain information

>PRK14960 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK12323 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		820
4fcg_A		328	Structure Of The Leucine-Rich Repeat Domain Of The		2e-05
4fcg_A		328	Structure Of The Leucine-Rich Repeat Domain Of The		5e-04
1z6t_A		591	Structure Of The Apoptotic Protease-activating Fact		2e-04
3iza_B		1263	Structure Of An Apoptosome-Procaspase-9 Card Comple		7e-04

>pdb|4FCG|A Chain A, Structure Of The Leucine-Rich Repeat Domain Of The Type Iii Effector Xcv3220 (Xopl) Length = 328

Back alignment and structure

Iteration: 1

Score = 48.1 bits (113), Expect = 2e-05, Method: Compositional matrix adjust. Identities = 44/152 (28%), Positives = 70/152 (46%), Gaps = 19/152 (12%) Query: 298 FPCQEFQC--LRVLDLGQSGIIKLPDSIGTLKHLRYLDLSHTYIRKIPGSISKLKHLQTL 355 FP Q F+ L+ + +G+ +LPD+ L L L+ +R +P SI+ L L+ L Sbjct: 96 FPDQAFRLSHLQHXTIDAAGLXELPDTXQQFAGLETLTLARNPLRALPASIASLNRLREL 155 Query: 356 DLSNCYNLEELPKGICQ---------LTNLRTLDISSCYSLTHMPLGIGKLRPLRKL--- 403 + C L ELP+ + L NL++L + + +P I L+ L+ L Sbjct: 156 SIRACPELTELPEPLASTDASGEHQGLVNLQSLRL-EWTGIRSLPASIANLQNLKSLKIR 214 Query: 404 --PAFILGKQRFCAGLGELKLLDLRGRLEIKN 433 P LG L +L+ LDLRG ++N Sbjct: 215 NSPLSALGP--AIHHLPKLEELDLRGCTALRN 244

PyMOL of 4fcg

>pdb|4FCG|A Chain A, Structure Of The Leucine-Rich Repeat Domain Of The Type Iii Effector Xcv3220 (Xopl) Length = 328

Back alignment and structure

>pdb|1Z6T|A Chain A, Structure Of The Apoptotic Protease-activating Factor 1 Bound To Adp Length = 591

Back alignment and structure

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		820
1z6t_A		591	APAF-1, apoptotic protease activating factor 1; ca	3e-70
2a5y_B		549	CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis	2e-61
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	7e-30
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	3e-07
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	7e-07
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	4e-06
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	4e-27
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	5e-24
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	4e-20
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	1e-18
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	9e-25
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	8e-23
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	5e-21
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	2e-19
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	3e-14
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	4e-05
1o6v_A		466	Internalin A; bacterial infection, extracellular r	5e-23
1o6v_A		466	Internalin A; bacterial infection, extracellular r	4e-12
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	4e-22
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	6e-14
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	2e-21
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	1e-08
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	5e-21
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	3e-16
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	1e-15
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	6e-12
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	5e-10
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	2e-20
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	2e-17
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	3e-17
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	4e-17
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	5e-20
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	9e-13
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	2e-11
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	2e-10
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	1e-19
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	3e-17
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	1e-13
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	2e-09
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	1e-19
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	9e-19
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	1e-17
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	2e-10
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	2e-07
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	3e-19
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	5e-12
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	4e-19
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	2e-15
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	1e-11
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	4e-10
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	9e-09
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	1e-18
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	3e-15
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	1e-14
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	1e-13
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	9e-12
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	9e-09
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	2e-06
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	2e-18
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	1e-12
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	2e-05
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	5e-18
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	8e-15
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	2e-10
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	6e-16
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	7e-16
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	5e-15
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	4e-13
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	2e-15
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	2e-12
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	2e-15
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	3e-06
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	3e-15
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	2e-09
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	1e-07
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	5e-15
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	5e-14
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	9e-10
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	2e-04
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	6e-15
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	1e-13
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	2e-05
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	2e-14
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	2e-11
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	5e-14
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	5e-11
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	8e-04
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	4e-13
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	2e-12
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	6e-11
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	7e-11
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	9e-11
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	5e-08
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	8e-07
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	3e-06
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	3e-06
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	5e-06
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	4e-13
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	3e-11
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	7e-11
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	3e-08
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	1e-06
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	4e-05
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	6e-13
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	1e-05
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	3e-05
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	7e-13
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	2e-12
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	1e-12
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	5e-12
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	5e-08
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	2e-12
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	4e-12
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	3e-10
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	5e-12
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	6e-12
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	4e-05
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	9e-12
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	1e-11
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	4e-09
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	2e-05
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	2e-11
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	1e-06
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	5e-06
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	5e-06
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	2e-11
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	4e-08
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	5e-11
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	7e-10
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	7e-10
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	1e-08
3sfz_A		1249	APAF-1, apoptotic peptidase activating factor 1; a	7e-11
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	9e-11
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	4e-10
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	1e-09
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	1e-10
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	2e-08
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	2e-10
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	1e-09
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	5e-10
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	1e-05
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	6e-10
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	2e-07
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	1e-09
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	1e-09
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	1e-09
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	2e-09
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	1e-05
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	3e-09
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	4e-09
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	2e-08
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	3e-04
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	6e-08
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	1e-07
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	1e-06
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	6e-08
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	5e-07
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	1e-07
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	2e-07
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	3e-07
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	1e-04
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	3e-07
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	4e-04
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	6e-07
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	2e-04
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	3e-06
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	1e-04
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	5e-06
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	8e-05
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	9e-05
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	4e-05
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	5e-05
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	3e-04
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	8e-05
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	9e-05
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	9e-05
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	2e-04
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	2e-04
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	6e-04
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	4e-04

>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591	Back alignment and structure

 Score =  241 bits (617), Expect = 3e-70
 Identities = 62/365 (16%), Positives = 114/365 (31%), Gaps = 56/365 (15%)

Query: 4   KLEVYWRGRG--FLIVLDDVWDEDGENMEKALSWLNVGGSGSCVLVTTRSGRVA-SMMGT 60
           +L +    +    L++LDDVWD            L    S   +L+TTR   V  S+MG 
Sbjct: 226 RLRILMLRKHPRSLLILDDVWDSW---------VLKAFDSQCQILLTTRDKSVTDSVMGP 276

Query: 61  VPTQHLT-CLSSEDSWVLFKHFAFGSVEDESTELEEIGQKIVAKCKGLPIAIKTIGSILR 119
                +   L  E    +   F          +L E    I+ +CKG P+ +  IG++LR
Sbjct: 277 KYVVPVESSLGKEKGLEILSLFVNMKKA----DLPEQAHSIIKECKGSPLVVSLIGALLR 332

Query: 120 SKDKE--EWLSVADCDLWTLLEFKS-----HVLPVLKRSYDNLPWHLKQCFAYCSIFPKD 172
                   +L       +  +   S      +   +  S + L   +K  +   SI  KD
Sbjct: 333 DFPNRWEYYLKQLQNKQFKRIRKSSSYDYEALDEAMSISVEMLREDIKDYYTDLSILQKD 392

Query: 173 YWINKEKLVRLWVAEGFIRLDSGSEDLEETADDYFMELLQHSFFDNIVRGIFGEVVMCKV 232
             +  + L  LW  E             E  +D   E +  S          G+     +
Sbjct: 393 VKVPTKVLCILWDME------------TEEVEDILQEFVNKSLL---FCDRNGKSFRYYL 437

Query: 233 HDYIHFLAQLAAGVEYSIVSIRDSQNIHTDIRHCTLVGDLSSST------------IPRA 280
           HD            +   +     + I    R+                       +  A
Sbjct: 438 HDLQVDFLTEKNCSQ---LQDLHKKIITQFQRYHQPHTLSPDQEDCMYWYNFLAYHMASA 494

Query: 281 RKLRTLLFLTVKMENLSFPCQEFQCLRVL-DLGQ-SGIIKLPDSIGTLKHLRYLDLSHTY 338
           +  + L  L   ++ +    +      ++ +  +   I+   D   +     +L L+   
Sbjct: 495 KMHKELCALMFSLDWIKAKTELVGPAHLIHEFVEYRHILDEKDCAVSENFQEFLSLNGHL 554

Query: 339 IRKIP 343
           + + P
Sbjct: 555 LGRQP 559

PyMOL of 1z6t

>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332	Back alignment and structure

>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		820
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	100.0
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	100.0
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	100.0
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	100.0
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	100.0
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	100.0
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	100.0
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	100.0
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	100.0
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	100.0
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	100.0
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	100.0
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	100.0
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	100.0
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	100.0
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	100.0
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	100.0
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	100.0
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	100.0
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	100.0
4g8a_A		635	TOLL-like receptor 4; leucine rich repeat MD-2 rel	100.0
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	100.0
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	100.0
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	100.0
4g8a_A		635	TOLL-like receptor 4; leucine rich repeat MD-2 rel	100.0
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	100.0
1o6v_A		466	Internalin A; bacterial infection, extracellular r	100.0
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	100.0
1o6v_A		466	Internalin A; bacterial infection, extracellular r	100.0
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	100.0
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	100.0
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	99.98
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	99.98
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	99.97
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	99.97
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	99.97
2a5y_B		549	CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis	99.97
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	99.97
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	99.97
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	99.97
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	99.96
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	99.96
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	99.96
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	99.96
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	99.95
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	99.94
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	99.93
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	99.93
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	99.93
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	99.92
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	99.92
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	99.92
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	99.92
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	99.92
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	99.91
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	99.91
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	99.91
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	99.91
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	99.91
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	99.9
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	99.9
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	99.9
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	99.9
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	99.9
3sfz_A		1249	APAF-1, apoptotic peptidase activating factor 1; a	99.9
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	99.9
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	99.9
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	99.88
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	99.88
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	99.88
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	99.87
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	99.87
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	99.87
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	99.86
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	99.85
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	99.84
1z6t_A		591	APAF-1, apoptotic protease activating factor 1; ca	99.84
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	99.84
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	99.83
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	99.83
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	99.82
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	99.82
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	99.82
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	99.81
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	99.8
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	99.79
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	99.78
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	99.78
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	99.77
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	99.76
3m19_A		251	Variable lymphocyte receptor A diversity region; a	99.76
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	99.76
3m19_A		251	Variable lymphocyte receptor A diversity region; a	99.75
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	99.74
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	99.74
4glp_A		310	Monocyte differentiation antigen CD14; alpha beta	99.74
4glp_A		310	Monocyte differentiation antigen CD14; alpha beta	99.72
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	99.72
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	99.71
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	99.71
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	99.69
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	99.68
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	99.67
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	99.66
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	99.66
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	99.65
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	99.65
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	99.65
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	99.64
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	99.64
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	99.64
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	99.63
3e6j_A		229	Variable lymphocyte receptor diversity region; var	99.62
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	99.62
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	99.62
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	99.62
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	99.6
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	99.59
3e6j_A		229	Variable lymphocyte receptor diversity region; var	99.56
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	99.55
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.55
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.53
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.52
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	99.52
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	99.52
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.52
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	99.51
3sb4_A		329	Hypothetical leucine rich repeat protein; LRR, rig	99.51
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	99.48
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	99.46
4b8c_D		727	Glucose-repressible alcohol dehydrogenase transcr	99.44
4fs7_A		394	Uncharacterized protein; leucine-rich repeats, pro	99.42
3sb4_A		329	Hypothetical leucine rich repeat protein; LRR, rig	99.42
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	99.42
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	99.39
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	99.38
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	99.38
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	99.38
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	99.37
4fdw_A		401	Leucine rich hypothetical protein; putative cell s	99.35
4b8c_D		727	Glucose-repressible alcohol dehydrogenase transcr	99.33
4fs7_A		394	Uncharacterized protein; leucine-rich repeats, pro	99.33
4fdw_A		401	Leucine rich hypothetical protein; putative cell s	99.32
3g39_A		170	Variable lymphocyte receptor VLRB.2D; antibody, X-	99.3
2r9u_A		174	Variable lymphocyte receptor; adaptive immunity, V	99.29
3g39_A		170	Variable lymphocyte receptor VLRB.2D; antibody, X-	99.25
2r9u_A		174	Variable lymphocyte receptor; adaptive immunity, V	99.24
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	99.2
4gt6_A		394	Cell surface protein; leucine rich repeats, putati	99.09
4gt6_A		394	Cell surface protein; leucine rich repeats, putati	99.02
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	98.99
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	98.94
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	98.89
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	98.86
4h09_A		379	Hypothetical leucine rich repeat protein; two LRR_	98.66
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	98.6
4h09_A		379	Hypothetical leucine rich repeat protein; two LRR_	98.57
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	98.57
1io0_A		185	Tropomodulin; LRR protein, right-handed super-heli	98.3
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	98.28
3rw6_A		267	Nuclear RNA export factor 1; retroviral constituti	98.24
1io0_A		185	Tropomodulin; LRR protein, right-handed super-heli	98.15
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	98.12
3rw6_A		267	Nuclear RNA export factor 1; retroviral constituti	98.11
2qen_A		350	Walker-type ATPase; unknown function; HET: ADP; 2.	98.04
1w5s_A		412	Origin recognition complex subunit 2 ORC2; replica	97.9
2fna_A		357	Conserved hypothetical protein; structural genomic	97.87
1njg_A		250	DNA polymerase III subunit gamma; rossman-like fol	97.39
2qby_B		384	CDC6 homolog 3, cell division control protein 6 ho	97.23
2v1u_A		387	Cell division control protein 6 homolog; DNA repli	97.17
3rfe_A		130	Platelet glycoprotein IB beta chain; platelet surf	96.83
1pgv_A		197	TMD-1, tropomodulin TMD-1; structural genomics, PS	96.76
1hqc_A		324	RUVB; extended AAA-ATPase domain, complex with nuc	96.52
2qby_A		386	CDC6 homolog 1, cell division control protein 6 ho	96.42
2chg_A		226	Replication factor C small subunit; DNA-binding pr	96.4
1fnn_A		389	CDC6P, cell division control protein 6; ORC1, AAA	96.24
1pgv_A		197	TMD-1, tropomodulin TMD-1; structural genomics, PS	96.08
3rfe_A		130	Platelet glycoprotein IB beta chain; platelet surf	95.98
1sxj_B		323	Activator 1 37 kDa subunit; clamp loader, processi	95.58
1iqp_A		327	RFCS; clamp loader, extended AAA-ATPase domain, co	93.98
1jr3_A		373	DNA polymerase III subunit gamma; processivity, pr	91.69
2chq_A		319	Replication factor C small subunit; DNA-binding pr	90.29
2z4s_A		440	Chromosomal replication initiator protein DNAA; AA	90.07
3bos_A		242	Putative DNA replication factor; P-loop containing	88.43
1a5t_A		334	Delta prime, HOLB; zinc finger, DNA replication; 2	84.8
1sxj_E		354	Activator 1 40 kDa subunit; clamp loader, processi	84.56
1sxj_D		353	Activator 1 41 kDa subunit; clamp loader, processi	80.43

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A*	Back alignment and structure

Probab=100.00  E-value=5e-50  Score=469.65  Aligned_cols=408  Identities=18%  Similarity=0.111  Sum_probs=223.3

Q ss_pred             CcccCCCCccEEEeecccccc-cCc--cccCCceeEEEEeCCCCCc-ccCccc-cCcccccEEeccCcccccc-ccc---
Q 003435          275 STIPRARKLRTLLFLTVKMEN-LSF--PCQEFQCLRVLDLGQSGII-KLPDSI-GTLKHLRYLDLSHTYIRKI-PGS---  345 (820)
Q Consensus       275 ~~~~~~~~L~~L~l~~n~~~~-l~~--~~~~l~~L~~L~L~~n~l~-~lp~~~-~~l~~L~~L~Ls~n~i~~l-p~~---  345 (820)
                      ..+..+++|++|++++|.+.. +|.  .+..+++|++|+|++|.+. .+|..+ .++++|++|+|++|.++.. |..   
T Consensus        94 ~~~~~l~~L~~L~Ls~n~l~~~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~  173 (768)
T 3rgz_A           94 SGFKCSASLTSLDLSRNSLSGPVTTLTSLGSCSGLKFLNVSSNTLDFPGKVSGGLKLNSLEVLDLSANSISGANVVGWVL  173 (768)
T ss_dssp             CCCCCCTTCCEEECCSSEEEEEGGGGGGGGGCTTCCEEECCSSEEECCSSCCSCCCCTTCSEEECCSSCCEEETHHHHHH
T ss_pred             hhhccCCCCCEEECCCCcCCCcCCChHHHhCCCCCCEEECcCCccCCcCCHHHhccCCCCCEEECCCCccCCcCChhhhh
Confidence            467888888888888888764 555  5788888899999888887 345444 7888899999988888855 444   


Q ss_pred             cccCCcccEEeccCCCCccccchhccCCCCCcEEecCCCCCccccCcccCCCCCCCccCceeeCCccc----cccccccc
Q 003435          346 ISKLKHLQTLDLSNCYNLEELPKGICQLTNLRTLDISSCYSLTHMPLGIGKLRPLRKLPAFILGKQRF----CAGLGELK  421 (820)
Q Consensus       346 ~~~L~~L~~L~L~~n~~~~~lp~~~~~l~~L~~L~L~~n~~~~~~p~~~~~l~~L~~L~~~~~~~~~~----~~~l~~L~  421 (820)
                      +.++++|++|++++|.+.+..|  ++.+++|++|++++|.+.+.+|. ++++++|++|++..+.+...    ...+++|+
T Consensus       174 ~~~l~~L~~L~Ls~n~l~~~~~--~~~l~~L~~L~Ls~n~l~~~~~~-l~~l~~L~~L~Ls~n~l~~~~~~~l~~l~~L~  250 (768)
T 3rgz_A          174 SDGCGELKHLAISGNKISGDVD--VSRCVNLEFLDVSSNNFSTGIPF-LGDCSALQHLDISGNKLSGDFSRAISTCTELK  250 (768)
T ss_dssp             TTCCTTCCEEECCSSEEESCCB--CTTCTTCCEEECCSSCCCSCCCB-CTTCCSCCEEECCSSCCCSCHHHHTTTCSSCC
T ss_pred             hccCCCCCEEECCCCcccccCC--cccCCcCCEEECcCCcCCCCCcc-cccCCCCCEEECcCCcCCCcccHHHhcCCCCC
Confidence            7888889999999888776665  37888999999999987777776 88899999998887776532    24667788


Q ss_pred             cCCCCCceeecccCCCCChhhhhhhccccccccceeeEEeccCCccChhh------------------HHHHhhccCCCC
Q 003435          422 LLDLRGRLEIKNLENLKNVVDAEEAKLHDKVHIRSLGLSWSRNAQMRDDK------------------AQALIEFLRPPH  483 (820)
Q Consensus       422 ~L~l~~~~~~~~l~~~~~~~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~------------------~~~~~~~l~~~~  483 (820)
                      .|+++++........            ..+.+|+.|++++|.........                  ...++..+..++
T Consensus       251 ~L~Ls~n~l~~~~~~------------~~l~~L~~L~L~~n~l~~~ip~~~~~~~~~L~~L~Ls~n~l~~~~p~~~~~l~  318 (768)
T 3rgz_A          251 LLNISSNQFVGPIPP------------LPLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCS  318 (768)
T ss_dssp             EEECCSSCCEESCCC------------CCCTTCCEEECCSSEEEESCCCCSCTTCTTCSEEECCSSEEEECCCGGGGGCT
T ss_pred             EEECCCCcccCccCc------------cccCCCCEEECcCCccCCccCHHHHhhcCcCCEEECcCCcCCCccchHHhcCC
Confidence            887776532211111            13344555555444322100000                  001112233334


Q ss_pred             CCcEEEEecCCCC-CCCcccccCCCCccEEEecccccC-CCCC-CCCCC-CCcceeeccCcCceEeCccccCCCcccCCC
Q 003435          484 NLKVLDLKGYRGS-VFPSWLNSGVPNLVKVSLVDCTCQ-ELPP-LGQLP-NLKDLYVKGMSAVQIIGYKFYGNDAIRGFP  559 (820)
Q Consensus       484 ~L~~L~L~~n~~~-~~~~~~~~~l~~L~~L~L~~n~~~-~l~~-l~~l~-~L~~L~L~~n~~~~~~~~~~~~~~~~~~l~  559 (820)
                      +|++|++++|.+. .+|...+..+++|++|++++|.++ .+|. +..++ +|+.|++++|.+.......+.    ...++
T Consensus       319 ~L~~L~L~~n~l~~~ip~~~l~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~~L~~L~Ls~N~l~~~~~~~~~----~~~~~  394 (768)
T 3rgz_A          319 LLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLC----QNPKN  394 (768)
T ss_dssp             TCCEEECCSSEEEEECCHHHHTTCTTCCEEECCSSEEEECCCTTHHHHTTTCSEEECCSSEEEEECCTTTT----CSTTC
T ss_pred             CccEEECCCCcccCcCCHHHHhcCCCCCEEeCcCCccCccccHHHHhhhcCCcEEEccCCCcCCCcChhhh----hcccC
Confidence            4444444444433 333332334444444444444333 2222 33333 444444444443332211110    01144


Q ss_pred             CcceeecCCC-------------cccccccccccCCCccCCCCCCCCCcccEEEEcCCCCCCCCCC----CCCcCceEec
Q 003435          560 SLKLLQLFDM-------------PNLMEWKGQMTEGTDEFDGMQEPFPCLEKLVVEGCSMLNTLPF----IRNLKNLALC  622 (820)
Q Consensus       560 ~L~~L~l~~~-------------~~l~~~~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~----l~~L~~L~l~  622 (820)
                      +|++|++.++             ++|+.+..+.+...+..+..+..+++|++|++++|.+.+.+|.    +++|+.|+++
T Consensus       395 ~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~  474 (768)
T 3rgz_A          395 TLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILD  474 (768)
T ss_dssp             CCCEEECCSSEEEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECC
T ss_pred             CccEEECCCCccccccCHHHhcCCCCCEEECcCCcccCcccHHHhcCCCCCEEECCCCcccCcCCHHHcCCCCceEEEec
Confidence            5555555443             1222222222222223333333444555555555544444332    4445555555


Q ss_pred             ccC--CccccccCCCCCcceEEccCCCCCccccccCCCCCCccEEEEccCCCccchhhhcCCCCCcceEeeccCcccccC
Q 003435          623 NSN--DKLVCSLSRFPSLSSLVVDNFPELNCLSDKTGNLNSLVKLTVNECDNLESLFVFMQSFSSLRHLSILHCDKLESL  700 (820)
Q Consensus       623 ~~~--~~~~~~~~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~L~~n~~~~~~~~~~~~l~~L~~L~l~~n~~~~~~  700 (820)
                      +|.  +..+..+..+++|++|++++|.+.+.+|..++.+++|++|++++|++.+.+|..+..+++|++|++++|++.+.+
T Consensus       475 ~N~l~~~~p~~l~~l~~L~~L~L~~N~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~g~i  554 (768)
T 3rgz_A          475 FNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTI  554 (768)
T ss_dssp             SSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEEECCGGGGGCTTCCEEECCSSEEESBC
T ss_pred             CCcccCcCCHHHhcCCCCCEEEccCCccCCcCChHHhcCCCCCEEECCCCcccCcCCHHHcCCCCCCEEECCCCccCCcC
Confidence            554  233444455555555555555555555555555555555555555555555555555555555555555444433


Q ss_pred             c
Q 003435          701 P  701 (820)
Q Consensus       701 ~  701 (820)
                      |
T Consensus       555 p  555 (768)
T 3rgz_A          555 P  555 (768)
T ss_dssp             C
T ss_pred             C
Confidence            3

PyMOL of 3rgz

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A*	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A*	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A*	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A*	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A*	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A*	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A*	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens}	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens}	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens}	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens}	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A*	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697}	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron}	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A*	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens}	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens}	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697}	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron}	Back alignment and structure

>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A*	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus}	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus}	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A*	Back alignment and structure

>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A*	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A*	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes}	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens}	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens}	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes}	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B}	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae}	Back alignment and structure

>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A*	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B}	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae}	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus}	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus}	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A*	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A*	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV}	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B*	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens}	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV}	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium}	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens}	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A*	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium}	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens}	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens}	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B*	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri}	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri}	Back alignment and structure

>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A*	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A*	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A*	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae}	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae}	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus}	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus}	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B*	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B*	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens}	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri}	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A*	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri}	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A*	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C*	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C*	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C*	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C*	Back alignment and structure

>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens}	Back alignment and structure

>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens}	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri}	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp}	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp}	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A}	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes}	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A}	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens}	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes}	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus}	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri}	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus}	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes}	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens}	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus}	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus}	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes}	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens}	Back alignment and structure

>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron}	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7	Back alignment and structure

>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus}	Back alignment and structure

>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron}	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens}	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri}	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri}	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4	Back alignment and structure

>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A	Back alignment and structure

>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus}	Back alignment and structure

>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A	Back alignment and structure

>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D	Back alignment and structure

>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus}	Back alignment and structure

>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D	Back alignment and structure

>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus}	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A	Back alignment and structure

>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165}	Back alignment and structure

>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165}	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens}	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens}	Back alignment and structure

>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum}	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis}	Back alignment and structure

>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum}	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis}	Back alignment and structure

>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A	Back alignment and structure

>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A	Back alignment and structure

>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A	Back alignment and structure

>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A	Back alignment and structure

>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi}	Back alignment and structure

>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A*	Back alignment and structure

>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20	Back alignment and structure

>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A*	Back alignment and structure

>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus}	Back alignment and structure

>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix}	Back alignment and structure

>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A*	Back alignment and structure

>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1	Back alignment and structure

>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C*	Back alignment and structure

>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus}	Back alignment and structure

>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus}	Back alignment and structure

>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20	Back alignment and structure

>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1	Back alignment and structure

>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A*	Back alignment and structure

>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B*	Back alignment and structure

>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A	Back alignment and structure

>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A*	Back alignment and structure

>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A	Back alignment and structure

>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E*	Back alignment and structure

>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		820
d2a5yb3		277	c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenor	2e-28
d2omza2		384	c.10.2.1 (A:33-416) Internalin A {Listeria monocyt	2e-12
d2omza2		384	c.10.2.1 (A:33-416) Internalin A {Listeria monocyt	4e-06
d1jl5a_		353	c.10.2.6 (A:) Leucine rich effector protein YopM {	7e-09
d1jl5a_		353	c.10.2.6 (A:) Leucine rich effector protein YopM {	2e-07
d1jl5a_		353	c.10.2.6 (A:) Leucine rich effector protein YopM {	2e-05
d1jl5a_		353	c.10.2.6 (A:) Leucine rich effector protein YopM {	2e-04
d2astb2		284	c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1	1e-08
d2astb2		284	c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1	1e-07
d1xkua_		305	c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99	4e-07
d1xkua_		305	c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99	1e-06
d1xkua_		305	c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99	7e-04
d1a9na_		162	c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom	4e-06
d1a9na_		162	c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom	4e-06
d1dcea3		124	c.10.2.2 (A:444-567) Rab geranylgeranyltransferase	1e-05
d1koha1		162	c.10.2.3 (A:201-362) mRNA export factor tap {Human	2e-05
d1p9ag_		266	c.10.2.7 (G:) von Willebrand factor binding domain	4e-05
d1p9ag_		266	c.10.2.7 (G:) von Willebrand factor binding domain	0.003
d1p9ag_		266	c.10.2.7 (G:) von Willebrand factor binding domain	0.004
d1ogqa_		313	c.10.2.8 (A:) Polygalacturonase inhibiting protein	7e-05
d1ogqa_		313	c.10.2.8 (A:) Polygalacturonase inhibiting protein	7e-05
d1m9la_		198	c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree	8e-05
d1z7xw1		460	c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (	9e-05
d1z7xw1		460	c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (	8e-04
d1h6ta2		210	c.10.2.1 (A:31-240) Internalin B {Listeria monocyt	2e-04
d1h6ta2		210	c.10.2.1 (A:31-240) Internalin B {Listeria monocyt	0.002
d1h6ua2		227	c.10.2.1 (A:36-262) Internalin H {Listeria monocyt	3e-04
d1h6ua2		227	c.10.2.1 (A:36-262) Internalin H {Listeria monocyt	6e-04
d1h6ua2		227	c.10.2.1 (A:36-262) Internalin H {Listeria monocyt	7e-04
d1xwdc1		242	c.10.2.7 (C:18-259) Follicle-stimulating hormone r	3e-04
d2ca6a1		344	c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom	8e-04
d2ca6a1		344	c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom	0.001

>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Length = 277	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]

 Score =  113 bits (283), Expect = 2e-28
 Identities = 27/163 (16%), Positives = 50/163 (30%), Gaps = 14/163 (8%)

Query: 4   KLEVYWRGRGFLIVLDDVWDEDGENMEKALSWLNVGGSGSCVLVTTRSGRVA-SMMGTVP 62
                      L V DDV  E+     + L            LVTTR   ++ +   T  
Sbjct: 127 ICNALIDRPNTLFVFDDVVQEETIRWAQEL--------RLRCLVTTRDVEISNAASQTCE 178

Query: 63  TQHLTCLSSEDSWVLFKHFAFGSVEDESTELEEIGQKIVAKCKGLPIAIKTIGSILRSKD 122
              +T L  ++ +   + +          + E++  K +    G P  +         K 
Sbjct: 179 FIEVTSLEIDECYDFLEAYGMP--MPVGEKEEDVLNKTIELSSGNPATLMMFFKSCEPKT 236

Query: 123 KEEWLSVADCDLWTLLEFKSHVLPVLKRSYDNLPWHLKQCFAY 165
            E+   + +            V  +   SY +L   L++C   
Sbjct: 237 FEKMAQLNN---KLESRGLVGVECITPYSYKSLAMALQRCVEV 276

PyMOL of d2a5yb3

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		820
d2omza2		384	Internalin A {Listeria monocytogenes [TaxId: 1639]	99.93
d2omza2		384	Internalin A {Listeria monocytogenes [TaxId: 1639]	99.93
d2a5yb3		277	CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI	99.91
d1xkua_		305	Decorin {Cow (Bos taurus) [TaxId: 9913]}	99.9
d1ogqa_		313	Polygalacturonase inhibiting protein PGIP {Kidney	99.89
d1ogqa_		313	Polygalacturonase inhibiting protein PGIP {Kidney	99.86
d1xkua_		305	Decorin {Cow (Bos taurus) [TaxId: 9913]}	99.86
d1ozna_		284	Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma	99.82
d1jl5a_		353	Leucine rich effector protein YopM {Yersinia pesti	99.81
d1p9ag_		266	von Willebrand factor binding domain of glycoprote	99.8
d1p9ag_		266	von Willebrand factor binding domain of glycoprote	99.79
d1jl5a_		353	Leucine rich effector protein YopM {Yersinia pesti	99.78
d1ozna_		284	Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma	99.77
d1h6ua2		227	Internalin H {Listeria monocytogenes [TaxId: 1639]	99.66
d1h6ta2		210	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.64
d1h6ua2		227	Internalin H {Listeria monocytogenes [TaxId: 1639]	99.64
d2omxa2		199	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.63
d1z7xw1		460	Ribonuclease inhibitor {Human (Homo sapiens) [TaxI	99.62
d1xwdc1		242	Follicle-stimulating hormone receptor {Human (Homo	99.62
d2omxa2		199	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.61
d1z7xw1		460	Ribonuclease inhibitor {Human (Homo sapiens) [TaxI	99.58
d1h6ta2		210	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.54
d1dcea3		124	Rab geranylgeranyltransferase alpha-subunit, C-ter	99.51
d1xwdc1		242	Follicle-stimulating hormone receptor {Human (Homo	99.49
d1w8aa_		192	Slit {Fruit fly (Drosophila melanogaster) [TaxId:	99.49
d1a9na_		162	Splicesomal U2A' protein {Human (Homo sapiens) [Ta	99.48
d2astb2		284	Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa	99.48
d1w8aa_		192	Slit {Fruit fly (Drosophila melanogaster) [TaxId:	99.41
d2astb2		284	Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa	99.39
d1a9na_		162	Splicesomal U2A' protein {Human (Homo sapiens) [Ta	99.37
d1dcea3		124	Rab geranylgeranyltransferase alpha-subunit, C-ter	99.36
d1m9la_		198	Outer arm dynein light chain 1 {Green algae (Chlam	99.33
d2ca6a1		344	Rna1p (RanGAP1), N-terminal domain {Fission yeast	99.11
d2ifga3		156	High affinity nerve growth factor receptor, N-term	99.09
d2ca6a1		344	Rna1p (RanGAP1), N-terminal domain {Fission yeast	99.0
d1m9la_		198	Outer arm dynein light chain 1 {Green algae (Chlam	98.99
d2ifga3		156	High affinity nerve growth factor receptor, N-term	98.96
d1koha1		162	mRNA export factor tap {Human (Homo sapiens) [TaxI	98.32
d1koha1		162	mRNA export factor tap {Human (Homo sapiens) [TaxI	98.22
d1pgva_		167	Tropomodulin C-terminal domain {nematode (Caenorha	97.57
d1pgva_		167	Tropomodulin C-terminal domain {nematode (Caenorha	97.47
d1io0a_		166	Tropomodulin C-terminal domain {Chicken (Gallus ga	96.83
d1io0a_		166	Tropomodulin C-terminal domain {Chicken (Gallus ga	96.58
d2fnaa2		283	Archaeal ATPase SSO1545 {Sulfolobus solfataricus [	94.17
d1a5ta2		207	delta prime subunit of DNA polymerase III, N-domai	91.07
d1njfa_		239	delta prime subunit of DNA polymerase III, N-domai	88.28
d1sxjc2		227	Replication factor C3 {Baker's yeast (Saccharomyce	80.68

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

Probab=99.93  E-value=5.3e-25  Score=234.63  Aligned_cols=190  Identities=18%  Similarity=0.218  Sum_probs=112.9

Q ss_pred             cCCCCccEEEecccccCCCCCCCCCCCCcceeeccCcCceEeCccccCCCcccCCCCcceeecCCCcccccccccccCCC
Q 003435          504 SGVPNLVKVSLVDCTCQELPPLGQLPNLKDLYVKGMSAVQIIGYKFYGNDAIRGFPSLKLLQLFDMPNLMEWKGQMTEGT  583 (820)
Q Consensus       504 ~~l~~L~~L~L~~n~~~~l~~l~~l~~L~~L~L~~n~~~~~~~~~~~~~~~~~~l~~L~~L~l~~~~~l~~~~~~~~~~~  583 (820)
                      ..+++++.+++++|.++.+++...+++|+.|++++|.+....        .+.                           
T Consensus       194 ~~l~~~~~l~l~~n~i~~~~~~~~~~~L~~L~l~~n~l~~~~--------~l~---------------------------  238 (384)
T d2omza2         194 AKLTNLESLIATNNQISDITPLGILTNLDELSLNGNQLKDIG--------TLA---------------------------  238 (384)
T ss_dssp             GGCTTCSEEECCSSCCCCCGGGGGCTTCCEEECCSSCCCCCG--------GGG---------------------------
T ss_pred             ccccccceeeccCCccCCCCcccccCCCCEEECCCCCCCCcc--------hhh---------------------------
Confidence            346666777777776666666666666666666666433210        001                           


Q ss_pred             ccCCCCCCCCCcccEEEEcCCCCCCCCCCCCCcCceEecccCCccccccCCCCCcceEEccCCCCCccccccCCCCCCcc
Q 003435          584 DEFDGMQEPFPCLEKLVVEGCSMLNTLPFIRNLKNLALCNSNDKLVCSLSRFPSLSSLVVDNFPELNCLSDKTGNLNSLV  663 (820)
Q Consensus       584 ~~~~~~~~~~~~L~~L~l~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~  663 (820)
                              .+++|+.|++++|.+.+.                    ..+..+++|++|++++|.+.+..+  +..++.++
T Consensus       239 --------~l~~L~~L~l~~n~l~~~--------------------~~~~~~~~L~~L~l~~~~l~~~~~--~~~~~~l~  288 (384)
T d2omza2         239 --------SLTNLTDLDLANNQISNL--------------------APLSGLTKLTELKLGANQISNISP--LAGLTALT  288 (384)
T ss_dssp             --------GCTTCSEEECCSSCCCCC--------------------GGGTTCTTCSEEECCSSCCCCCGG--GTTCTTCS
T ss_pred             --------cccccchhccccCccCCC--------------------CcccccccCCEeeccCcccCCCCc--cccccccc
Confidence                    344455555555543221                    134455666666666666554332  55666667


Q ss_pred             EEEEccCCCccchhhhcCCCCCcceEeeccCcccccCccccCCCCcccEEEecCCCCCCccccccCCCCCccEEEeccCC
Q 003435          664 KLTVNECDNLESLFVFMQSFSSLRHLSILHCDKLESLPMSLEKFCSLQKLDIVECPRLVHIPDIMGQHSSLLELSIEGCP  743 (820)
Q Consensus       664 ~L~L~~n~~~~~~~~~~~~l~~L~~L~l~~n~~~~~~~~~l~~l~~L~~L~L~~n~~~~~~~~~~~~l~~L~~L~l~~n~  743 (820)
                      .+++++|.+.+.  ..+..+++++.|++++|++.+. + .+..+++|++|++++|++.+ ++ .+.++++|++|++++|+
T Consensus       289 ~l~~~~n~l~~~--~~~~~~~~l~~L~ls~n~l~~l-~-~l~~l~~L~~L~L~~n~l~~-l~-~l~~l~~L~~L~l~~N~  362 (384)
T d2omza2         289 NLELNENQLEDI--SPISNLKNLTYLTLYFNNISDI-S-PVSSLTKLQRLFFANNKVSD-VS-SLANLTNINWLSAGHNQ  362 (384)
T ss_dssp             EEECCSSCCSCC--GGGGGCTTCSEEECCSSCCSCC-G-GGGGCTTCCEEECCSSCCCC-CG-GGGGCTTCCEEECCSSC
T ss_pred             cccccccccccc--cccchhcccCeEECCCCCCCCC-c-ccccCCCCCEEECCCCCCCC-Ch-hHcCCCCCCEEECCCCc
Confidence            777766655442  2356667777777777765443 2 36667777777777775543 33 46667777777777777


Q ss_pred             CcccccccccCCCCcceEEEeCC
Q 003435          744 MLKLSLKSIEFLGQLQRLVIKKC  766 (820)
Q Consensus       744 ~~~~~~~~~~~l~~L~~L~l~~~  766 (820)
                      +.+..|  +.++++|++|+|+++
T Consensus       363 l~~l~~--l~~l~~L~~L~L~~N  383 (384)
T d2omza2         363 ISDLTP--LANLTRITQLGLNDQ  383 (384)
T ss_dssp             CCBCGG--GTTCTTCSEEECCCE
T ss_pred             CCCChh--hccCCCCCEeeCCCC
Confidence            766544  667777777777664

PyMOL of d2omza2

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]}	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]}	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]}	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]}	Back information, alignment and structure

>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure