Citrus Sinensis ID: 003444

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------82
MTPELISAPVAEDAPIQYSFATEYEGPPVSYDIPRAVPINVQKIPVAAVVKQVSLSDKLSLPVVHPIVSADKLKTSFSKDLKPASVEAEVKSETTVSPTSVIDRAADSVNCVLSGELSSSGALEFSNYVSGELGNCSNGFNPTTENLNISSSERSRESWSRLRGSNVGKESLDMTDELNQPDWESNESVLSMDYPSSRVSSLKTGDLSNRINHDDDGFESNGDARRGPVVTFRDIASDDEDEDDDFGDEFSQEAPRIMQRVKREPETRGKKGSCYRCFKGNRFTEKEVCIVCDAKYCCNCVLRAMGSMPEGRKCVTCIGYPIDEAKRGSLGKCSRMLKRLLNPLEVKQIMKAEKLCEANQLPPEYICVNGKPLCHEELVILQTCPNPPKKLKPGNYWYDKVSGLWGKEGQKPSKIISPHLSVGGPIKPDASNGNTQIFINGREITKVELRMLQLAGVQCAGNPHFWVNEDGSYQEEGQKNTKGYIWGMAKTKLVCAVLSLPVPSKSSNPGAEQGSGLMSRSVPDYIERRTLQKLLLVGCSGSGTSTIFKQAKILYKAVPFSDDEHENIKLKIQSNAYGYLGILLEGRERFEEEILGEKRKKQSSDETNPVGSSDSTDGKTIYTIGPRLKAFSDWLLKTMVSGNLEAIFPAATREYSPLVEELWKDAAIQATYSRRSELEMLSSVASYFLERVVDISRTDYEPSDLDILYAEGVTSSNGLACVDFSFPRSASDDSVDTADQHDSLLRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSDYDQFSVDGNGSLMNKMMLSRKFFESIVTIQLLIRWNFF
cccccccccccccccccEEEEEEEccccccccccccccccccccccccccccccccccccccEEcccccccccccccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEccccccccHHHHHcccccccccccccccccccccccccccccHHHHHHHccHHHHHHHHHHHHHHHHccccccEEEEccccccHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEccccccHHHHHHHHHHcccccccccEEEEccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccHHHHHHHHHHEEEcccccccccccccccEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHcccHHHHHHHHcccccccccccHHHHHHccccccccccccccccEEEEEcccccccEEEEEEEcccccccccccccccccccccEEEEEEccccccccccEEEccccccEEEEEEEcccccccccccccccccHHHHHHHHHHHHHccccccccccc
ccccccccccccccccEEEEEEEEccccccccccccccEccccccEEEEEccccccccccccEEccccccccccccccccccccccccccccccccccccEEEEcccccEEEEcccccccccEEEcccccccccccccccccccccccccccccccccccHcccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccEEEEccccccccccccccccccccccccEEEcccccccccccccEEEEcccccccccEEEEEEEccHHcHHHHHHHccccccccEEEEEccccccHHHHcHcccHHHHHHHHccHHHHHHHHHHHHHHHHccccccEEEEccccccHHHHHHHHcccccccccccccEEEEccccccccccccccEEEcccccccccccccccccccEEEEcccHHHHHHHHHHHHcccccccccEEEEEccccccHcccccccccccccHHHHHHHHHHccccccccHHHHHHHHHHHHHHccHHHHHHHHHHEEEEEEcccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHcccccccccccccEEEccHHHHHHHHHHHHHHHcccHHcccccccHHHHHHHHHHHccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHcccccccHHHEEEEEEEcccccEEEEEEEcccccccccccccccccccEEEEEEEEccccccHHccHHHHcccccEEEEEEEHHHHHHEEEcccccHHHHHHHHHHHHHHHHccccccccccc
mtpelisapvaedapiqysfateyegppvsydipravpinvqkiPVAAVVKQVSlsdklslpvvhpivsadklktsfskdlkpasveaevksettvsptsviDRAADSVNCVlsgelsssgalefsnyvsgelgncsngfnpttenlnissserSRESWsrlrgsnvgkesldmtdelnqpdwesnesvlsmdypssrvsslktgdlsnrinhdddgfesngdarrgpvvtfrdiasddededddfgdefsQEAPRIMQRVkrepetrgkkgscyrcfkgnrftekeVCIVCDAKYCCNCVLramgsmpegrkcvtcigypideakrgslgKCSRMLKRLLNPLEVKQIMKAEKLceanqlppeyicvngkplchEELVIlqtcpnppkklkpgnywydkvsglwgkegqkpskiisphlsvggpikpdasngntqifinGREITKVELRMLQLAGvqcagnphfwvnedgsyqeegqkNTKGYIWGMAKTKLVCAVlslpvpskssnpgaeqgsglmsrsvpdYIERRTLQKLLLVgcsgsgtstIFKQAKILykavpfsddehenIKLKIQSNAYGYLGILLEGRERFEEEILGEkrkkqssdetnpvgssdstdgktiytigPRLKAFSDWLLKTMVSGnleaifpaatreySPLVEELWKDAAIQATYSRRSELEMLSSVASYFLERVVdisrtdyepsdldilyaegvtssnglacvdfsfprsasddsvdtadqHDSLLRYQLIRVQARglgenckwLEMFEDIGMVIFCVAlsdydqfsvdgngsLMNKMMLSRKFFESIVTIQLLIRWNFF
mtpelisapvaedapIQYSFATEYEGPPVSYDIPRAVPINVQKIPVAAVVKQVSLSDKLSLPVVHPIvsadklktsfskdlkpasveaevksettvsptsvidrAADSVNCVLSGELSSSGALEFSNYVSGELGNCSNGFNPTTEnlnisssersreswsrlrgsnvgkesldmtdelnqpdWESNESVLSMDYPSSRVSslktgdlsnrinhdddgfesngdarrgpvvtfrdiasddededddfgdefsqeaprimqrvkrepetrgkkgscyrcfkgnrfteKEVCIVCDAKYCCNCVLramgsmpegrKCVTCIGYPIdeakrgslgkCSRMLKRLLNPLEVKQIMKAEKLCEANQLPPEYICVNGKPLCHEELVILQTCpnppkklkpgNYWYDKVSGLWGKEGQKPSKIISPHLSVGGPIKPDASNGNTQIFINGREITKVELRMLQLAGVQCAGNPHFWVNEDGSYQEEGQKNTKGYIWGMAKTKLVCAVLSLPVPSKssnpgaeqgsglmSRSVPDYIERRTLQKLLLVGCSGSGTSTIFKQAKILYKAVPFSDDEHENIKLKIQSNAYGYLGILLEGRERFEEEILgekrkkqssdetnpvgssdstdgktiYTIGPRLKAFSDWLLKTMVSGNLEAIFPAATREYSPLVEELWKDAAIQATYSRRSELEMLSSVASYFLERVVDISRTDYEPSDLDILYAEGVTSSNGLACVDFSFPRSASDDSVDTADQHDSLLRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSDYDQFSVDGNGSLMNKMMLSRKFFESIVTIQLLIRWNFF
MTPELISAPVAEDAPIQYSFATEYEGPPVSYDIPRAVPINVQKIPVAAVVKQVSLSDKLSLPVVHPIVSADKLKTSFSKDLKPASVEAEVKSETTVSPTSVIDRAADSVNCVlsgelsssgalefsNYVSGELGNCSNGFNPTTENLNIsssersreswsrlrgsNVGKESLDMTDELNQPDWESNESVLSMDYPSSRVSSLKTGDLSNRINHDDDGFESNGDARRGPVVTFRDIASddededddfgdefSQEAPRIMQRVKREPETRGKKGSCYRCFKGNRFTEKEVCIVCDAKYCCNCVLRAMGSMPEGRKCVTCIGYPIDEAKRGSLGKCSRMLKRLLNPLEVKQIMKAEKLCEANQLPPEYICVNGKPLCHEELVILQTCPNPPKKLKPGNYWYDKVSGLWGKEGQKPSKIISPHLSVGGPIKPDASNGNTQIFINGREITKVELRMLQLAGVQCAGNPHFWVNEDGSYQEEGQKNTKGYIWGMAKTKLVCAVLSLPVPSKSSNPGAEQGSGLMSRSVPDYIERRTLQKLLLVGCSGSGTSTIFKQAKILYKAVPFSDDEHENIKLKIQSNAYGYLGILLEGRERFEEEILGEKRKKQSSDETNPVGSSDSTDGKTIYTIGPRLKAFSDWLLKTMVSGNLEAIFPAATREYSPLVEELWKDAAIQATYSRRSELEMLSSVASYFLERVVDISRTDYEPSDLDILYAEGVTSSNGLACVDFSFPRSASDDSVDTADQHDSLLRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSDYDQFSVDGNGSLMNKMMLSRKFFESIVTIQLLIRWNFF
**************PIQYSFATEYEGPPVSYDIPRAVPINVQKIPVAAVVKQVSLSDKLSLPVVHPIVSA*************************************SVNCVLSG******ALEFSNYVSGEL*******************************************************************************************************************************************SCYRCFKGNRFTEKEVCIVCDAKYCCNCVLRAMGSMPEGRKCVTCIGYPIDEAKRGSLGKCSRMLKRLLNPLEVKQIMKAEKLCEANQLPPEYICVNGKPLCHEELVILQTCPNPPKKLKPGNYWYDKVSGLWGK**************************NTQIFINGREITKVELRMLQLAGVQCAGNPHFWVNEDGSYQEEGQKNTKGYIWGMAKTKLVCAVLSL***********************DYIERRTLQKLLLVGCSGSGTSTIFKQAKILYKAVPFSDDEHENIKLKIQSNAYGYLGILLEGRER******************************TIYTIGPRLKAFSDWLLKTMVSGNLEAIFPAATREYSPLVEELWKDAAIQATYSRRSELEMLSSVASYFLERVVDISRTDYEPSDLDILYAEGVTSSNGLACVDFSF***************DSLLRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSDYDQFSVDGNGSLMNKMMLSRKFFESIVTIQLLIRWNF*
**********AEDAPIQYSFATEYEGPPVSYDIPRAVPINVQKI*************************************************************************************************************************************************************************************************************************************************KEVCIVCDAKYCCNCVLRAMGSMPEGRKCVTCI*********************LLNPLEVKQI**********QLPPEYICVNGKPLCHEELVILQTCPNPPKKLKPGNYWYDKVSGLWGKEGQKPSKIISPHLSVGGPIKPDASNGNTQIFINGREITKVELRMLQLAGVQCAGNPHFWVNEDGSYQ**********IWGMAK*************************************RRTLQKLLLVGCSGSGTSTIFKQAKILYKAVPFSDDEHENIKLKIQSNAYGYLGILLEGRERFEEEILGEKRK************SDSTDGKTIYTIGPRLKAFSDWLLKTMVSGNLEAIFPAATREYSPLVEELWKDAAIQATYSRRSELEMLSSVASYFLERVVDISRTDYEPSDLDILYAEGVTSSNGLACVDFSFPRSASDDSVDTADQHDSLLRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSDYDQFSVDGNGSLMNKMMLSRKFFESIVTIQLLIRWNFF
MTPELISAPVAEDAPIQYSFATEYEGPPVSYDIPRAVPINVQKIPVAAVVKQVSLSDKLSLPVVHPIVSADKLKTSFSK******************PTSVIDRAADSVNCVLSGELSSSGALEFSNYVSGELGNCSNGFNPTTENLN****************SNVGKESLDMTDELNQPDWESNESVLSM**********KTGDLSNRINHDDDGFESNGDARRGPVVTFRDIASD*********DEFSQEAPRIMQ************GSCYRCFKGNRFTEKEVCIVCDAKYCCNCVLRAMGSMPEGRKCVTCIGYPIDEAKRGSLGKCSRMLKRLLNPLEVKQIMKAEKLCEANQLPPEYICVNGKPLCHEELVILQTCPNPPKKLKPGNYWYDKVSGLWGKEGQKPSKIISPHLSVGGPIKPDASNGNTQIFINGREITKVELRMLQLAGVQCAGNPHFWVNEDGSYQEEGQKNTKGYIWGMAKTKLVCAVLSLPV***************MSRSVPDYIERRTLQKLLLVGCSGSGTSTIFKQAKILYKAVPFSDDEHENIKLKIQSNAYGYLGILLEGRERFEEEIL*********************DGKTIYTIGPRLKAFSDWLLKTMVSGNLEAIFPAATREYSPLVEELWKDAAIQATYSRRSELEMLSSVASYFLERVVDISRTDYEPSDLDILYAEGVTSSNGLACVDFSFPR**********DQHDSLLRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSDYDQFSVDGNGSLMNKMMLSRKFFESIVTIQLLIRWNFF
*****ISAPVAEDAPIQYSFATEYEGPPVSYDIPRAVPINVQKIPVAAVVKQVSLSDKLSLPVVHPIVS******************************SVIDRAADSVNCVLSGELSSSGA*******************************************************LNQPDWESNESVLSMDY*******************************RGP*V*****A******************PRIMQRV*******GKKGSCYRCFKGNRFTEKEVCIVCDAKYCCNCVLRAMGSMPEGRKCVTCIGYPIDEAKRGSLGKCSRMLKRLLNPLEVKQIMKAEKLCEANQLPPEYICVNGKPLCHEELVILQTCPNPPKKLKPGNYWYDKVSGLWGKEGQKPSKIISPHLSVGGPIKPDASNGNTQIFINGREITKVELRMLQLAGVQCAGNPHFWVNEDGSYQEEGQKNTKGYIWGMAKTKLVCAVLSLPVPSKSSNPGAEQGSGLMSRSVPDYIERRTLQKLLLVGCSGSGTSTIFKQAKILYKAVPFSDDEHENIKLKIQSNAYGYLGILLEGRERFEEEILGEKRKKQSSDETNPVGSSDSTDGKTIYTIGPRLKAFSDWLLKTMVSGNLEAIFPAATREYSPLVEELWKDAAIQATYSRRSELEMLSSVASYFLERVVDISRTDYEPSDLDILYAEGVTSSNGLACVDFSFPRSASDDSVDTADQHDSLLRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSDYDQFSVDGNGSLMNKMMLSRKFFESIVTIQLLIRWNF*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTPELISAPVAEDAPIQYSFATEYEGPPVSYDIPRAVPINVQKIPVAAVVKQVSLSDKLSLPVVHPIVSADKLKTSFSKDLKPASVEAEVKSETTVSPTSVIDRAADSVNCVLSGELSSSGALEFSNYVSGELGNCSNGFNPTTENLNISSSERSRESWSRLRGSNVGKESLDMTDELNQPDWESNESVLSMDYPSSRVSSLKTGDLSNRINHDDDGFESNGDARRGPVVTFRDIASDDEDEDDDFGDEFSQEAPRIMQRVKREPETRGKKGSCYRCFKGNRFTEKEVCIVCDAKYCCNCVLRAMGSMPEGRKCVTCIGYPIDEAKRGSLGKCSRMLKRLLNPLEVKQIMKAEKLCEANQLPPEYICVNGKPLCHEELVILQTCPNPPKKLKPGNYWYDKVSGLWGKEGQKPSKIISPHLSVGGPIKPDASNGNTQIFINGREITKVELRMLQLAGVQCAGNPHFWVNEDGSYQEEGQKNTKGYIWGMAKTKLVCAVLSLPVPSKSSNPGAEQGSGLMSRSVPDYIERRTLQKLLLVGCSGSGTSTIFKQAKILYKAVPFSDDEHENIKLKIQSNAYGYLGILLEGRERFEEEILGEKRKKQSSDETNPVGSSDSTDGKTIYTIGPRLKAFSDWLLKTMVSGNLEAIFPAATREYSPLVEELWKDAAIQATYSRRSELEMLSSVASYFLERVVDISRTDYEPSDLDILYAEGVTSSNGLACVDFSFPRSASDDSVDTADQHDSLLRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSDYDQFSVDGNGSLMNKMMLSRKFFESIVTIQLLIRWNFF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query819 2.2.26 [Sep-21-2011]
P93163385 Guanine nucleotide-bindin no no 0.289 0.615 0.321 2e-24
P49082384 Guanine nucleotide-bindin N/A no 0.289 0.617 0.314 6e-24
O04278384 Guanine nucleotide-bindin N/A no 0.300 0.640 0.298 1e-23
P49084 385 Guanine nucleotide-bindin no no 0.289 0.615 0.303 2e-23
O04279384 Guanine nucleotide-bindin N/A no 0.289 0.617 0.310 9e-23
Q40224384 Guanine nucleotide-bindin N/A no 0.288 0.614 0.302 2e-22
Q0DJ33380 Guanine nucleotide-bindin no no 0.293 0.631 0.315 1e-21
A2Y3B5380 Guanine nucleotide-bindin N/A no 0.293 0.631 0.315 1e-21
P26981384 Guanine nucleotide-bindin N/A no 0.289 0.617 0.314 3e-21
P93564384 Guanine nucleotide-bindin N/A no 0.289 0.617 0.314 5e-21
>sp|P93163|GPA2_SOYBN Guanine nucleotide-binding protein alpha-2 subunit OS=Glycine max GN=GPA2 PE=2 SV=1 Back     alignment and function desciption
 Score =  114 bits (286), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 90/280 (32%), Positives = 141/280 (50%), Gaps = 43/280 (15%)

Query: 529 RTLQKLLLVGCSGSGTSTIFKQAKILYKAVPFSDDEHENIKLKIQSNAYGYLGILLEGRE 588
           + +QKLLL+G   SG STIFKQ K+L++   F + E ++    I +N Y  + +L +G +
Sbjct: 38  KHIQKLLLLGAGESGKSTIFKQIKLLFQT-GFDEAELKSYLPVIHANVYQTIKLLHDGSK 96

Query: 589 RFEEEILGEKRKKQSSDETNPVGSSDSTDGKTIYTIGPRLKAFSDWLLKTMVSGNLEAIF 648
            F +               N V SS        Y I    K   + LL+  + G L+  +
Sbjct: 97  EFAQ---------------NDVDSSK-------YVISNENKEIGEKLLE--IGGRLD--Y 130

Query: 649 PAATREYSPLVEELWKDAAIQATYSRRSELEMLSSVASYFLERVVDISRTDYEPSDLDIL 708
           P  ++E +  +E LWKD AIQ TY+R SEL+ +     YF+E +  +S  +Y P+  D+L
Sbjct: 131 PYLSKELAQEIENLWKDPAIQETYARGSELQ-IPDCTDYFMENLQRLSDANYVPTKEDVL 189

Query: 709 YAEGVTSSNGLACVDFSFPRSASDDSVDTADQHDSLLRYQLIRVQARGLGENCKWLEMFE 768
           YA   T+  G+  + FS P   +  S +          Y+L  V  +   E  KW+ +FE
Sbjct: 190 YARVRTT--GVVEIQFS-PVGENKKSDEV---------YRLFDVGGQR-NERRKWIHLFE 236

Query: 769 DIGMVIFCVALSDYDQFSVDGNGSLMNKMMLSRKFFESIV 808
            +  VIFC A+S+YDQ   +      N+MM +++ FE I+
Sbjct: 237 GVSAVIFCAAISEYDQTLFEDENR--NRMMETKELFEWIL 274
Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems.
Glycine max (taxid: 3847)
>sp|P49082|GPA1_LOTJA Guanine nucleotide-binding protein alpha-1 subunit OS=Lotus japonicus GN=GPA1 PE=2 SV=1 Back     alignment and function description
>sp|O04278|GPA1_PEA Guanine nucleotide-binding protein alpha-1 subunit OS=Pisum sativum GN=GPA1 PE=2 SV=1 Back     alignment and function description
>sp|P49084|GPA1_SOYBN Guanine nucleotide-binding protein alpha-1 subunit OS=Glycine max GN=GPA1 PE=2 SV=1 Back     alignment and function description
>sp|O04279|GPA2_PEA Guanine nucleotide-binding protein alpha-2 subunit OS=Pisum sativum GN=GPA2 PE=2 SV=1 Back     alignment and function description
>sp|Q40224|GPA1_LUPLU Guanine nucleotide-binding protein alpha-1 subunit OS=Lupinus luteus GN=GPA1 PE=2 SV=1 Back     alignment and function description
>sp|Q0DJ33|GPA1_ORYSJ Guanine nucleotide-binding protein alpha-1 subunit OS=Oryza sativa subsp. japonica GN=GPA1 PE=1 SV=2 Back     alignment and function description
>sp|A2Y3B5|GPA1_ORYSI Guanine nucleotide-binding protein alpha-1 subunit OS=Oryza sativa subsp. indica GN=GPA1 PE=2 SV=2 Back     alignment and function description
>sp|P26981|GPA1_SOLLC Guanine nucleotide-binding protein alpha-1 subunit OS=Solanum lycopersicum GN=GPA1 PE=2 SV=1 Back     alignment and function description
>sp|P93564|GPA1_SOLTU Guanine nucleotide-binding protein alpha-1 subunit OS=Solanum tuberosum GN=GPA1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query819
359480423918 PREDICTED: uncharacterized protein LOC10 0.957 0.854 0.719 0.0
255562733917 GTP-binding protein alpha subunit, gna, 0.954 0.852 0.719 0.0
356537768917 PREDICTED: uncharacterized protein LOC10 0.945 0.844 0.707 0.0
356496832915 PREDICTED: uncharacterized protein LOC10 0.956 0.855 0.7 0.0
147794785 1056 hypothetical protein VITISV_002365 [Viti 0.967 0.75 0.633 0.0
449520756908 PREDICTED: uncharacterized protein LOC10 0.946 0.853 0.690 0.0
449448536908 PREDICTED: uncharacterized protein LOC10 0.946 0.853 0.690 0.0
357483115907 Guanine nucleotide-binding protein alpha 0.931 0.841 0.700 0.0
357483117908 Guanine nucleotide-binding protein alpha 0.931 0.840 0.7 0.0
224096872901 predicted protein [Populus trichocarpa] 0.931 0.846 0.690 0.0
>gi|359480423|ref|XP_003632458.1| PREDICTED: uncharacterized protein LOC100248291 [Vitis vinifera] Back     alignment and taxonomy information
 Score = 1155 bits (2989), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 587/816 (71%), Positives = 663/816 (81%), Gaps = 32/816 (3%)

Query: 10  VAEDAPIQYSFATEYEGPPVSYDIPRAVPINVQKIPVAAVVKQVSLSDKLSLPVVHPIVS 69
           V +D P  YSFA EY GPPV+YDIPRAVPINV+KIPVA VV QVSLSDKLSLPVV P+++
Sbjct: 7   VDDDGP--YSFAMEYHGPPVTYDIPRAVPINVEKIPVATVVAQVSLSDKLSLPVVQPLLA 64

Query: 70  ADKLKTSFSKDLKPASVEAEVKSETTVSPTSVI--DRAAD---SVNCVLSGELSSSGALE 124
            D      SK++K       + S++TVSPTSVI  +R ++      CVLSGEL+SSGALE
Sbjct: 65  PDPRCKMLSKEIK-------LGSKSTVSPTSVIAFERGSEDDAGHECVLSGELTSSGALE 117

Query: 125 FSNYVSGELGNCSNGFNPTTENLNISSSERSRESWSRLRGSNVGKESLDMTDELNQPDWE 184
           FS+  +  LG   +       +    S + S  S +    SN  KESLD  D LN PDW 
Sbjct: 118 FSDNSNELLGGAGSSGTIEFSDRLYKSRDLSGSSGA-FEVSNGCKESLDFND-LNAPDWV 175

Query: 185 SNESVLSMDYPSSRVSSLKTGDLSNRINHDDDGFESNGDARRGPVVTFRDIASDDEDEDD 244
           S ES +S+DYPSSRVSSLK GD SN         E   D RR PVV+FR +A DD     
Sbjct: 176 STESQVSLDYPSSRVSSLKAGDCSN---------EPGCDVRRTPVVSFRGVALDD----- 221

Query: 245 DFGDEFSQEAPRIMQRVKREPETRGKKGSCYRCFKGNRFTEKEVCIVCDAKYCCNCVLRA 304
           D  +EFS   P I+ R K+EPET+GKKGSCYRCFKG+RFTEKEVCIVCDAKYC NCVLRA
Sbjct: 222 DTNEEFSSAEPEIV-RPKKEPETKGKKGSCYRCFKGSRFTEKEVCIVCDAKYCSNCVLRA 280

Query: 305 MGSMPEGRKCVTCIGYPIDEAKRGSLGKCSRMLKRLLNPLEVKQIMKAEKLCEANQLPPE 364
           MGSMPEGRKCVTCIGYPIDE+KRG+LGKCSRMLKRLLN LEV+QIMK+EK+CE NQLPPE
Sbjct: 281 MGSMPEGRKCVTCIGYPIDESKRGNLGKCSRMLKRLLNELEVRQIMKSEKMCETNQLPPE 340

Query: 365 YICVNGKPLCHEELVILQTCPNPPKKLKPGNYWYDKVSGLWGKEGQKPSKIISPHLSVGG 424
           Y+CVN KPL  EELV+LQ CPNPPKKLKPGNYWYDKVSGLWGKEGQKPSKIISP+LSVGG
Sbjct: 341 YVCVNEKPLSQEELVLLQNCPNPPKKLKPGNYWYDKVSGLWGKEGQKPSKIISPNLSVGG 400

Query: 425 PIKPDASNGNTQIFINGREITKVELRMLQLAGVQCAGNPHFWVNEDGSYQEEGQKNTKGY 484
           PI+ +ASNGNTQ+FINGREITKVELRMLQLAGVQCAGNPHFWVNEDGSYQEEGQKNTKGY
Sbjct: 401 PIRANASNGNTQVFINGREITKVELRMLQLAGVQCAGNPHFWVNEDGSYQEEGQKNTKGY 460

Query: 485 IWGMAKTKLVCAVLSLPVPSKSSNPGAEQGSGLMSRSVPDYIERRTLQKLLLVGCSGSGT 544
           IWG A TKLVCAVLSLPVPSK  +P  EQ +  ++R+VPDY+E+RTLQKLLL+G +GSGT
Sbjct: 461 IWGKAGTKLVCAVLSLPVPSKFLSPSGEQVNNFVTRTVPDYLEQRTLQKLLLIGNNGSGT 520

Query: 545 STIFKQAKILYKAVPFSDDEHENIKLKIQSNAYGYLGILLEGRERFEEEILGEKRKKQSS 604
           STIFKQAKILYKA PFS+DE ENIKLKIQSN YGYLGILLEGRERFE+E L E RK++S 
Sbjct: 521 STIFKQAKILYKATPFSEDERENIKLKIQSNVYGYLGILLEGRERFEDESLIEMRKRKSY 580

Query: 605 DETNPVGSS-DSTDGKTIYTIGPRLKAFSDWLLKTMVSGNLEAIFPAATREYSPLVEELW 663
            +++ +G++ D  D KTIY+IG RLKAFSDWLLKTMV+GNLEAIFPAATREY+PLVEELW
Sbjct: 581 HKSDSIGNTDDENDDKTIYSIGTRLKAFSDWLLKTMVAGNLEAIFPAATREYAPLVEELW 640

Query: 664 KDAAIQATYSRRSELEMLSSVASYFLERVVDISRTDYEPSDLDILYAEGVTSSNGLACVD 723
            DAAIQATY RRSELEML SVASYFLER VDI RTDYEPSD+DILYAEGVTSSNGLACVD
Sbjct: 641 NDAAIQATYKRRSELEMLPSVASYFLERAVDILRTDYEPSDVDILYAEGVTSSNGLACVD 700

Query: 724 FSFPRSASDDSVDTADQHDSLLRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSDYD 783
           FSFP+S   D +DTAD HDSLLRYQLIRVQARGLGENCKWLEMFED+ +VIFCV+L+DYD
Sbjct: 701 FSFPQSEPGDDIDTADLHDSLLRYQLIRVQARGLGENCKWLEMFEDVRIVIFCVSLNDYD 760

Query: 784 QFSVDGNGSLMNKMMLSRKFFESIVTIQLLIRWNFF 819
           Q+S D NGSL+NKMMLS++ FESIVT     + +F 
Sbjct: 761 QYSYDANGSLVNKMMLSQRLFESIVTHPTFEQMDFL 796

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255562733|ref|XP_002522372.1| GTP-binding protein alpha subunit, gna, putative [Ricinus communis] gi|223538450|gb|EEF40056.1| GTP-binding protein alpha subunit, gna, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356537768|ref|XP_003537397.1| PREDICTED: uncharacterized protein LOC100820512 [Glycine max] Back     alignment and taxonomy information
>gi|356496832|ref|XP_003517269.1| PREDICTED: uncharacterized protein LOC100778059 [Glycine max] Back     alignment and taxonomy information
>gi|147794785|emb|CAN66844.1| hypothetical protein VITISV_002365 [Vitis vinifera] Back     alignment and taxonomy information
>gi|449520756|ref|XP_004167399.1| PREDICTED: uncharacterized protein LOC101225793 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449448536|ref|XP_004142022.1| PREDICTED: uncharacterized protein LOC101221850 [Cucumis sativus] Back     alignment and taxonomy information
>gi|357483115|ref|XP_003611844.1| Guanine nucleotide-binding protein alpha-2 subunit [Medicago truncatula] gi|355513179|gb|AES94802.1| Guanine nucleotide-binding protein alpha-2 subunit [Medicago truncatula] Back     alignment and taxonomy information
>gi|357483117|ref|XP_003611845.1| Guanine nucleotide-binding protein alpha-2 subunit [Medicago truncatula] gi|355513180|gb|AES94803.1| Guanine nucleotide-binding protein alpha-2 subunit [Medicago truncatula] Back     alignment and taxonomy information
>gi|224096872|ref|XP_002310767.1| predicted protein [Populus trichocarpa] gi|222853670|gb|EEE91217.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query819
TAIR|locus:2046738 888 XLG1 "AT2G23460" [Arabidopsis 0.769 0.709 0.703 3.1e-265
UNIPROTKB|Q9LI02 867 P0029D06.12 "cDNA clone:J02303 0.656 0.620 0.561 7.4e-176
TAIR|locus:2034446 848 XLG3 "AT1G31930" [Arabidopsis 0.744 0.719 0.516 9.8e-172
UNIPROTKB|Q0IM71 686 Os12g0593000 "Os12g0593000 pro 0.600 0.717 0.607 2.1e-169
TAIR|locus:2116204 861 XLG2 "AT4G34390" [Arabidopsis 0.406 0.386 0.606 2.5e-119
UNIPROTKB|Q0IZ94 440 Os10g0117800 "Os10g0117800 pro 0.373 0.695 0.485 9.9e-71
UNIPROTKB|Q0DJ33380 GPA1 "Guanine nucleotide-bindi 0.184 0.397 0.313 1.7e-19
TAIR|locus:2005529383 GP ALPHA 1 "AT2G26300" [Arabid 0.184 0.394 0.307 2.1e-18
UNIPROTKB|P87383354 gnai1 "Guanine nucleotide-bind 0.101 0.234 0.318 3.5e-15
ZFIN|ZDB-GENE-040426-1310354 gnai1 "guanine nucleotide bind 0.101 0.234 0.318 7.1e-15
TAIR|locus:2046738 XLG1 "AT2G23460" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2364 (837.2 bits), Expect = 3.1e-265, Sum P(2) = 3.1e-265
 Identities = 462/657 (70%), Positives = 535/657 (81%)

Query:   169 KESLDMTDELNQP---DWESNESVLSMDYPSSRVSSLKTGDLSNRINHDDDGFESNGDAR 225
             KESLD+ +  + P   DWESNESVLSMDYPSSRV    TGD  +         E+NGD +
Sbjct:   133 KESLDLNESSSNPLVPDWESNESVLSMDYPSSRV----TGDCVS---------ETNGDGK 179

Query:   226 RGPVVTFRDIASXXXXXXXXXXXXXSQEAPRIMQRVKREPETRGKKGSCYRCFKGNRFTE 285
             + PVVTF  IAS              +   R++  VK++P+T+GKKGSCYRCFKG+RFTE
Sbjct:   180 KQPVVTFLGIASDDGFEEEESCSNLRRV--RVVP-VKKQPQTKGKKGSCYRCFKGSRFTE 236

Query:   286 KEVCIVCDAKYCCNCVLRAMGSMPEGRKCVTCIGYPIDEAKRGSLGKCSRMLKRLLNPLE 345
             KEVC+VCDAKYC +CVLRAMGSMPEGRKCVTCIG+PIDE+KRGSLGKCSRMLKRLLN LE
Sbjct:   237 KEVCLVCDAKYCNSCVLRAMGSMPEGRKCVTCIGFPIDESKRGSLGKCSRMLKRLLNDLE 296

Query:   346 VKQIMKAEKLCEANQLPPEYICVNGKPLCHEELVILQTCPNPPKKLKPGNYWYDKVSGLW 405
             VKQIMK E+ CEANQLP EY+ VNG+PL  EELV LQTC NPPKKLKPG+YWYDKVSGLW
Sbjct:   297 VKQIMKTERFCEANQLPAEYVYVNGQPLYPEELVTLQTCSNPPKKLKPGDYWYDKVSGLW 356

Query:   406 GKEGQKPSKIISPHLSVGGPIKPDASNGNTQIFINGREITKVELRMLQLAGVQCAGNPHF 465
             GKEG+KP +IISPHL+VGGPI P+ASNGNTQ+FINGREITKVELRMLQLAGVQCAGNPHF
Sbjct:   357 GKEGEKPYQIISPHLNVGGPISPEASNGNTQVFINGREITKVELRMLQLAGVQCAGNPHF 416

Query:   466 WVNEDGSYQEEGQKNTKGYIWGMAKTKLVCAVLSLPVPSKSS-NPGAEQGSGLMSRSVPD 524
             WVNEDGSYQEEGQKNTKGYIWG A TKL+CAVLSLPVPSKS+ N   EQ     SRS+ D
Sbjct:   417 WVNEDGSYQEEGQKNTKGYIWGKAGTKLLCAVLSLPVPSKSTANASGEQLYSANSRSILD 476

Query:   525 YIERRTLQKLLLVGCSGSGTSTIFKQAKILYKAVPFSDDEHENIKLKIQSNAYGYLGILL 584
             ++E RTLQK+LLVG SGSGTSTIFKQAKILYK VPF +DE ENIK+ IQ+N YGYLG+LL
Sbjct:   477 HLEHRTLQKILLVGNSGSGTSTIFKQAKILYKDVPFLEDERENIKVIIQTNVYGYLGMLL 536

Query:   585 EGRERFEEEILGEKRKKQSSDETNPVGSSDS-TDGKTI--YTIGPRLKAFSDWLLKTMVS 641
             EGRERFEEE L  +  KQ   E  P    D+ ++ KT+  Y+IGPRLKAFSDWLLKTM +
Sbjct:   537 EGRERFEEEALALRNTKQCVLENIPADEGDAKSNDKTVTMYSIGPRLKAFSDWLLKTMAA 596

Query:   642 GNLEAIFPAATREYSPLVEELWKDAAIQATYSRRSELEMLSSVASYFLERVVDISRTDYE 701
             GNL  IFPAA+REY+PLVEELW+DAAIQATY RRSEL +L SVASYFLER +D+   DYE
Sbjct:   597 GNLGVIFPAASREYAPLVEELWRDAAIQATYKRRSELGLLPSVASYFLERAIDVLTPDYE 656

Query:   702 PSDLDILYAEGVTSSNGLACVDFSFPRSASDDSVDTADQHDSLLRYQLIRVQARGLGENC 761
             PSDLDILYAEGVTSS+GLAC+DFSFP++AS++++D +D HDSLLRYQLIRV +RGLGENC
Sbjct:   657 PSDLDILYAEGVTSSSGLACLDFSFPQTASEENLDPSDHHDSLLRYQLIRVPSRGLGENC 716

Query:   762 KWLEMFEDIGMVIFCVALSDYDQFSVDGNGSLMNKMMLSRKFFESIVTIQLLIRWNF 818
             KW++MFED+GMV+F V++SDYDQ S DG     NKM+L++K FESI+T  +    +F
Sbjct:   717 KWIDMFEDVGMVVFVVSMSDYDQVSEDGT----NKMLLTKKLFESIITHPIFENMDF 769
GO:0001664 "G-protein coupled receptor binding" evidence=IBA
GO:0003924 "GTPase activity" evidence=IBA
GO:0004871 "signal transducer activity" evidence=IEA;ISS;IBA
GO:0005834 "heterotrimeric G-protein complex" evidence=IBA
GO:0005886 "plasma membrane" evidence=ISM
GO:0006184 "GTP catabolic process" evidence=IBA
GO:0007165 "signal transduction" evidence=IEA
GO:0007186 "G-protein coupled receptor signaling pathway" evidence=IEA;ISS
GO:0007188 "adenylate cyclase-modulating G-protein coupled receptor signaling pathway" evidence=IBA
GO:0019001 "guanyl nucleotide binding" evidence=IEA
GO:0031234 "extrinsic to internal side of plasma membrane" evidence=IBA
GO:0031683 "G-protein beta/gamma-subunit complex binding" evidence=IBA
GO:0005634 "nucleus" evidence=IDA
GO:0009737 "response to abscisic acid stimulus" evidence=IGI
GO:0009744 "response to sucrose stimulus" evidence=IGI
GO:0009749 "response to glucose stimulus" evidence=IGI
GO:0009750 "response to fructose stimulus" evidence=IGI
GO:0010555 "response to mannitol stimulus" evidence=IGI
GO:2000067 "regulation of root morphogenesis" evidence=IGI
UNIPROTKB|Q9LI02 P0029D06.12 "cDNA clone:J023031J07, full insert sequence" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2034446 XLG3 "AT1G31930" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q0IM71 Os12g0593000 "Os12g0593000 protein" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2116204 XLG2 "AT4G34390" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q0IZ94 Os10g0117800 "Os10g0117800 protein" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|Q0DJ33 GPA1 "Guanine nucleotide-binding protein alpha-1 subunit" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2005529 GP ALPHA 1 "AT2G26300" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|P87383 gnai1 "Guanine nucleotide-binding protein G(i) subunit alpha-1" [Oryzias latipes (taxid:8090)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-1310 gnai1 "guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query819
cd00066315 cd00066, G-alpha, Alpha subunit of G proteins (gua 1e-54
pfam00503329 pfam00503, G-alpha, G-protein alpha subunit 2e-45
smart00275342 smart00275, G_alpha, G protein alpha subunit 4e-32
>gnl|CDD|206639 cd00066, G-alpha, Alpha subunit of G proteins (guanine nucleotide binding) Back     alignment and domain information 
 Score =  190 bits (486), Expect = 1e-54
 Identities = 84/281 (29%), Positives = 116/281 (41%), Gaps = 62/281 (22%)

Query: 532 QKLLLVGCSGSGTSTIFKQAKILYKAVPFSDDEHENIKLKIQSNAYGYLGILLEGRERFE 591
            KLLL+G   SG STI KQ KIL+    FSD+E    +  I SN    +  LL   E   
Sbjct: 1   VKLLLLGAGESGKSTILKQMKILHG-NGFSDEERREFRPVIYSNILQSMKALLRAMETLN 59

Query: 592 EEILGEKRKKQSSDETNPVGSSDSTDGKTIYTIGPRLKAFSDWLLKTMVSGNLEAIFPAA 651
                 + +K +                               +L         A     
Sbjct: 60  IPYGDPENEKDA-----------------------------KKILSLAP----RAEEGPL 86

Query: 652 TREYSPLVEELWKDAAIQATYSRRSELEMLSSVASYFLERVVDISRTDYEPSDLDILYAE 711
             E +  ++ LWKD  IQA Y RR+E   L+  A YFL+ +  IS  DY P++ DIL + 
Sbjct: 87  PPELAEAIKRLWKDPGIQACYDRRNEY-QLNDSAKYFLDNLDRISDPDYIPTEQDILRSR 145

Query: 712 GVTSSNGLACVDFSFPRSASDDSVDTADQHDSLLRYQLIRVQARGLG---ENCKWLEMFE 768
             T+  G+   DFS                   L++++  V     G   E  KW+  FE
Sbjct: 146 VKTT--GIIETDFSIKN----------------LKFRMFDVG----GQRSERKKWIHCFE 183

Query: 769 DIGMVIFCVALSDYDQFSVDGNGSLMNKMMLSRKFFESIVT 809
           D+  +IF VALS+YDQ  V      +N+M  S K F+SI  
Sbjct: 184 DVTAIIFVVALSEYDQ--VLVEDESVNRMQESLKLFDSICN 222

The alpha subunit of G proteins contains the guanine nucleotide binding site. The heterotrimeric GNP-binding proteins are signal transducers that communicate signals from many hormones, neurotransmitters, chemokines, and autocrine and paracrine factors. Extracellular signals are received by receptors, which activate the G proteins, which in turn route the signals to several distinct intracellular signaling pathways. The alpha subunit of G proteins is a weak GTPase. In the resting state, heterotrimeric G proteins are associated at the cytosolic face of the plasma membrane and the alpha subunit binds to GDP. Upon activation by a receptor GDP is replaced with GTP, and the G-alpha/GTP complex dissociates from the beta and gamma subunits. This results in activation of downstream signaling pathways, such as cAMP synthesis by adenylyl cyclase, which is terminated when GTP is hydrolized and the heterotrimers reconstitute. Length = 315
>gnl|CDD|215955 pfam00503, G-alpha, G-protein alpha subunit Back     alignment and domain information
>gnl|CDD|214595 smart00275, G_alpha, G protein alpha subunit Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 819
KOG0082354 consensus G-protein alpha subunit (small G protein 100.0
KOG0085359 consensus G protein subunit Galphaq/Galphay, small 100.0
smart00275342 G_alpha G protein alpha subunit. Subunit of G prot 100.0
PF00503389 G-alpha: G-protein alpha subunit; InterPro: IPR001 100.0
KOG0099 379 consensus G protein subunit Galphas, small G prote 100.0
cd00066317 G-alpha G protein alpha subunit. The alpha subunit 100.0
PF00025175 Arf: ADP-ribosylation factor family The prints ent 98.49
KOG0071180 consensus GTP-binding ADP-ribosylation factor Arf6 98.49
KOG0070181 consensus GTP-binding ADP-ribosylation factor Arf1 98.29
KOG0073185 consensus GTP-binding ADP-ribosylation factor-like 97.99
KOG0072182 consensus GTP-binding ADP-ribosylation factor-like 97.94
PLN00223181 ADP-ribosylation factor; Provisional 97.64
KOG0074185 consensus GTP-binding ADP-ribosylation factor-like 97.52
smart00177175 ARF ARF-like small GTPases; ARF, ADP-ribosylation 97.36
cd04161167 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 ( 97.32
cd04150159 Arf1_5_like Arf1-Arf5-like subfamily. This subfami 97.3
cd04149168 Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor 97.25
KOG0076197 consensus GTP-binding ADP-ribosylation factor-like 97.18
KOG0075186 consensus GTP-binding ADP-ribosylation factor-like 97.13
PTZ00133182 ADP-ribosylation factor; Provisional 97.11
cd04158169 ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor 97.11
smart00178184 SAR Sar1p-like members of the Ras-family of small 96.97
cd04157162 Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a sub 96.82
cd04153174 Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) a 96.63
cd04160167 Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote 96.6
cd00879190 Sar1 Sar1 subfamily. Sar1 is an essential componen 96.54
KOG0077193 consensus Vesicle coat complex COPII, GTPase subun 96.51
cd04162164 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9 96.35
cd04151158 Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes t 96.3
cd04156160 ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su 96.11
cd04154173 Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are 96.08
cd00878158 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik 95.92
KOG0074185 consensus GTP-binding ADP-ribosylation factor-like 95.74
cd04175164 Rap1 Rap1 subgroup. The Rap1 subgroup is part of t 95.3
cd04152183 Arl4_Arl7 Arl4/Arl7 subfamily. Arl4 (Arf-like 4) i 95.27
cd04176163 Rap2 Rap2 subgroup. The Rap2 subgroup is part of t 95.15
cd04159159 Arl10_like Arl10-like subfamily. Arl9/Arl10 was id 94.95
cd04136163 Rap_like Rap-like subfamily. The Rap subfamily con 94.65
PF00025175 Arf: ADP-ribosylation factor family The prints ent 94.63
cd04120202 Rab12 Rab12 subfamily. Rab12 was first identified 94.19
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f 94.03
cd01892169 Miro2 Miro2 subfamily. Miro (mitochondrial Rho) pr 93.87
PTZ00099176 rab6; Provisional 93.86
PF08477119 Miro: Miro-like protein; InterPro: IPR013684 Mitoc 93.84
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 93.82
cd04143 247 Rhes_like Rhes_like subfamily. This subfamily incl 93.65
cd04173222 Rnd2_Rho7 Rnd2/Rho7 subfamily. Rnd2/Rho7 is a memb 93.61
cd01875191 RhoG RhoG subfamily. RhoG is a GTPase with high se 93.48
PRK08118167 topology modulation protein; Reviewed 93.3
cd00879190 Sar1 Sar1 subfamily. Sar1 is an essential componen 93.14
PRK07261171 topology modulation protein; Provisional 93.13
cd04113161 Rab4 Rab4 subfamily. Rab4 has been implicated in n 93.08
cd04141172 Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like p 93.01
TIGR00231161 small_GTP small GTP-binding protein domain. This m 93.01
cd00154159 Rab Rab family. Rab GTPases form the largest famil 92.97
cd04154173 Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are 92.88
cd04138162 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, 92.83
COG0563178 Adk Adenylate kinase and related kinases [Nucleoti 92.79
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f 92.76
cd00157171 Rho Rho (Ras homology) family. Members of the Rho 92.76
cd01874175 Cdc42 Cdc42 subfamily. Cdc42 is an essential GTPas 92.72
PTZ00133182 ADP-ribosylation factor; Provisional 92.54
smart00175164 RAB Rab subfamily of small GTPases. Rab GTPases ar 92.25
cd04130173 Wrch_1 Wrch-1 subfamily. Wrch-1 (Wnt-1 responsive 92.24
cd01860163 Rab5_related Rab5-related subfamily. This subfamil 92.13
cd01869166 Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev 92.02
cd04150159 Arf1_5_like Arf1-Arf5-like subfamily. This subfami 92.02
cd04144190 Ras2 Ras2 subfamily. The Ras2 subfamily, found exc 91.96
cd01860163 Rab5_related Rab5-related subfamily. This subfamil 91.84
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 91.82
PF00071162 Ras: Ras family; InterPro: IPR001806 Small GTPases 91.78
smart00173164 RAS Ras subfamily of RAS small GTPases. Similar in 91.77
cd04105203 SR_beta Signal recognition particle receptor, beta 91.76
PF01926116 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I 91.72
cd04123162 Rab21 Rab21 subfamily. The localization and functi 91.69
cd04139164 RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) 91.68
PF1355562 AAA_29: P-loop containing region of AAA domain 91.68
COG4639168 Predicted kinase [General function prediction only 91.65
PRK06217183 hypothetical protein; Validated 91.62
cd04115170 Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is u 91.59
cd04121189 Rab40 Rab40 subfamily. This subfamily contains Rab 91.58
cd04114169 Rab30 Rab30 subfamily. Rab30 appears to be associa 91.52
cd04160167 Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote 91.48
COG1100219 GTPase SAR1 and related small G proteins [General 91.39
cd04127180 Rab27A Rab27a subfamily. The Rab27a subfamily cons 91.39
cd04135174 Tc10 TC10 subfamily. TC10 is a Rho family protein 91.35
PLN00223181 ADP-ribosylation factor; Provisional 91.27
cd04106162 Rab23_lke Rab23-like subfamily. Rab23 is a member 91.25
KOG0073185 consensus GTP-binding ADP-ribosylation factor-like 91.23
cd01871174 Rac1_like Rac1-like subfamily. The Rac1-like subfa 91.23
cd04138162 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, 91.21
cd01861161 Rab6 Rab6 subfamily. Rab6 is involved in microtubu 91.2
smart00178184 SAR Sar1p-like members of the Ras-family of small 91.15
cd04110199 Rab35 Rab35 subfamily. Rab35 is one of several Rab 91.05
smart00177175 ARF ARF-like small GTPases; ARF, ADP-ribosylation 90.93
cd04124161 RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily 90.92
cd00876160 Ras Ras family. The Ras family of the Ras superfam 90.89
cd04153174 Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) a 90.85
smart00173164 RAS Ras subfamily of RAS small GTPases. Similar in 90.84
cd01865165 Rab3 Rab3 subfamily. The Rab3 subfamily contains R 90.83
cd04133176 Rop_like Rop subfamily. The Rop (Rho-related prote 90.74
cd04128182 Spg1 Spg1p. Spg1p (septum-promoting GTPase) was fi 90.69
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 90.69
cd04136163 Rap_like Rap-like subfamily. The Rap subfamily con 90.68
cd01864165 Rab19 Rab19 subfamily. Rab19 proteins are associat 90.63
cd04141172 Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like p 90.61
cd04117161 Rab15 Rab15 subfamily. Rab15 colocalizes with the 90.57
cd04119168 RJL RJL (RabJ-Like) subfamily. RJLs are found in m 90.57
cd01868165 Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a 90.53
cd04116170 Rab9 Rab9 subfamily. Rab9 is found in late endosom 90.5
cd04177168 RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the 90.39
cd04124161 RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily 90.38
cd04149168 Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor 90.33
cd04122166 Rab14 Rab14 subfamily. Rab14 GTPases are localized 90.28
cd04127180 Rab27A Rab27a subfamily. The Rab27a subfamily cons 90.26
cd01895174 EngA2 EngA2 subfamily. This CD represents the seco 90.25
cd04147198 Ras_dva Ras-dva subfamily. Ras-dva (Ras - dorsal-v 90.19
cd01862172 Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th 90.18
cd04107201 Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38 90.16
cd04107201 Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38 90.06
cd01892169 Miro2 Miro2 subfamily. Miro (mitochondrial Rho) pr 90.05
cd04151158 Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes t 90.05
cd04140165 ARHI_like ARHI subfamily. ARHI (A Ras homolog memb 90.03
cd04117161 Rab15 Rab15 subfamily. Rab15 colocalizes with the 90.03
cd04145164 M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf 90.0
cd04103158 Centaurin_gamma Centaurin gamma. The centaurins (a 89.96
PF00005137 ABC_tran: ABC transporter This structure is on hol 89.94
cd04112191 Rab26 Rab26 subfamily. First identified in rat pan 89.93
cd04137180 RheB Rheb (Ras Homolog Enriched in Brain) subfamil 89.86
cd04134189 Rho3 Rho3 subfamily. Rho3 is a member of the Rho f 89.81
cd04163168 Era Era subfamily. Era (E. coli Ras-like protein) 89.79
PTZ00132215 GTP-binding nuclear protein Ran; Provisional 89.78
cd04101164 RabL4 RabL4 (Rab-like4) subfamily. RabL4s are nove 89.76
cd01893166 Miro1 Miro1 subfamily. Miro (mitochondrial Rho) pr 89.75
cd04122166 Rab14 Rab14 subfamily. Rab14 GTPases are localized 89.75
cd01863161 Rab18 Rab18 subfamily. Mammalian Rab18 is implicat 89.72
smart00382148 AAA ATPases associated with a variety of cellular 89.61
cd04172182 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily. Rnd3/RhoE 89.61
TIGR02322179 phosphon_PhnN phosphonate metabolism protein/1,5-b 89.6
PLN03108210 Rab family protein; Provisional 89.59
cd04101164 RabL4 RabL4 (Rab-like4) subfamily. RabL4s are nove 89.57
PRK10078186 ribose 1,5-bisphosphokinase; Provisional 89.56
cd01867167 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp 89.52
cd04110199 Rab35 Rab35 subfamily. Rab35 is one of several Rab 89.51
PTZ00369189 Ras-like protein; Provisional 89.51
cd04129187 Rho2 Rho2 subfamily. Rho2 is a fungal GTPase that 89.49
cd01870175 RhoA_like RhoA-like subfamily. The RhoA subfamily 89.44
cd04158169 ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor 89.36
cd01874175 Cdc42 Cdc42 subfamily. Cdc42 is an essential GTPas 89.31
cd01876170 YihA_EngB The YihA (EngB) subfamily. This subfamil 89.28
cd04164157 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein 89.2
cd01878204 HflX HflX subfamily. A distinct conserved domain w 89.17
cd04125188 RabA_like RabA-like subfamily. RabA was first iden 89.17
COG4619223 ABC-type uncharacterized transport system, ATPase 89.09
cd04118193 Rab24 Rab24 subfamily. Rab24 is distinct from othe 89.07
cd01865165 Rab3 Rab3 subfamily. The Rab3 subfamily contains R 89.05
smart00176200 RAN Ran (Ras-related nuclear proteins) /TC4 subfam 88.87
cd04108170 Rab36_Rab34 Rab34/Rab36 subfamily. Rab34, found pr 88.79
cd04175164 Rap1 Rap1 subgroup. The Rap1 subgroup is part of t 88.78
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phospho 88.78
PRK03839180 putative kinase; Provisional 88.77
cd00877166 Ran Ran (Ras-related nuclear proteins) /TC4 subfam 88.77
cd04132187 Rho4_like Rho4-like subfamily. Rho4 is a GTPase th 88.73
cd04159159 Arl10_like Arl10-like subfamily. Arl9/Arl10 was id 88.7
cd04156160 ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su 88.68
cd01866168 Rab2 Rab2 subfamily. Rab2 is localized on cis-Golg 88.66
TIGR03598179 GTPase_YsxC ribosome biogenesis GTP-binding protei 88.52
cd03243202 ABC_MutS_homologs The MutS protein initiates DNA m 88.31
TIGR03263180 guanyl_kin guanylate kinase. Members of this famil 88.23
cd04145164 M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf 88.21
cd04152183 Arl4_Arl7 Arl4/Arl7 subfamily. Arl4 (Arf-like 4) i 88.21
PRK14532188 adenylate kinase; Provisional 88.15
cd03274212 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC protein 88.14
PLN03071219 GTP-binding nuclear protein Ran; Provisional 88.12
cd01863161 Rab18 Rab18 subfamily. Mammalian Rab18 is implicat 88.1
cd04176163 Rap2 Rap2 subgroup. The Rap2 subgroup is part of t 88.04
cd03283199 ABC_MutS-like MutS-like homolog in eukaryotes. The 87.95
cd04161167 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 ( 87.93
TIGR02528142 EutP ethanolamine utilization protein, EutP. This 87.87
cd01428194 ADK Adenylate kinase (ADK) catalyzes the reversibl 87.8
PRK13949169 shikimate kinase; Provisional 87.79
COG1136226 SalX ABC-type antimicrobial peptide transport syst 87.67
PTZ00369189 Ras-like protein; Provisional 87.65
cd04157162 Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a sub 87.65
TIGR01313163 therm_gnt_kin carbohydrate kinase, thermoresistant 87.65
PF13521163 AAA_28: AAA domain; PDB: 1LW7_A. 87.59
cd04130173 Wrch_1 Wrch-1 subfamily. Wrch-1 (Wnt-1 responsive 87.58
cd04131178 Rnd Rnd subfamily. The Rnd subfamily contains Rnd1 87.5
PF05729166 NACHT: NACHT domain 87.37
cd01875191 RhoG RhoG subfamily. RhoG is a GTPase with high se 87.36
cd04109215 Rab28 Rab28 subfamily. First identified in maize, 87.35
TIGR01360188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 87.35
cd00878158 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik 87.31
COG1122235 CbiO ABC-type cobalt transport system, ATPase comp 87.24
cd01869166 Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev 87.21
cd04108170 Rab36_Rab34 Rab34/Rab36 subfamily. Rab34, found pr 87.18
TIGR01351210 adk adenylate kinases. Adenylate kinase (EC 2.7.4. 87.11
PRK00300205 gmk guanylate kinase; Provisional 86.91
PRK08233182 hypothetical protein; Provisional 86.75
KOG0084205 consensus GTPase Rab1/YPT1, small G protein superf 86.74
cd01871174 Rac1_like Rac1-like subfamily. The Rac1-like subfa 86.69
PRK13695174 putative NTPase; Provisional 86.68
PTZ00088229 adenylate kinase 1; Provisional 86.66
PLN03071219 GTP-binding nuclear protein Ran; Provisional 86.64
cd04111211 Rab39 Rab39 subfamily. Found in eukaryotes, Rab39 86.53
PF00004132 AAA: ATPase family associated with various cellula 86.49
cd03280200 ABC_MutS2 MutS2 homologs in bacteria and eukaryote 86.46
cd04115170 Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is u 86.42
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 86.33
PF13173128 AAA_14: AAA domain 86.26
TIGR01359183 UMP_CMP_kin_fam UMP-CMP kinase family. This subfam 86.24
PRK14530215 adenylate kinase; Provisional 86.23
PRK00454196 engB GTP-binding protein YsxC; Reviewed 86.18
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 86.12
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). 86.11
smart00174174 RHO Rho (Ras homology) subfamily of Ras-like small 86.07
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 85.92
TIGR00235207 udk uridine kinase. Model contains a number of lon 85.91
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 85.9
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. 85.87
cd04174232 Rnd1_Rho6 Rnd1/Rho6 subfamily. Rnd1/Rho6 is a memb 85.86
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 85.78
cd00877166 Ran Ran (Ras-related nuclear proteins) /TC4 subfam 85.75
cd04121189 Rab40 Rab40 subfamily. This subfamily contains Rab 85.74
COG1126240 GlnQ ABC-type polar amino acid transport system, A 85.66
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 85.66
smart00534185 MUTSac ATPase domain of DNA mismatch repair MUTS f 85.63
cd04126 220 Rab20 Rab20 subfamily. Rab20 is one of several Rab 85.59
cd04146165 RERG_RasL11_like RERG/RasL11-like subfamily. RERG 85.58
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 85.56
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 85.55
cd00820107 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC 85.53
cd04172182 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily. Rnd3/RhoE 85.52
cd03234226 ABCG_White The White subfamily represents ABC tran 85.38
cd00154159 Rab Rab family. Rab GTPases form the largest famil 85.37
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 85.34
TIGR02673214 FtsE cell division ATP-binding protein FtsE. This 85.33
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 85.32
PRK02496184 adk adenylate kinase; Provisional 85.31
cd04177168 RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the 85.29
cd03281213 ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS 85.27
PRK00279215 adk adenylate kinase; Reviewed 85.19
cd03272243 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC protein 85.18
cd04128182 Spg1 Spg1p. Spg1p (septum-promoting GTPase) was fi 85.15
PF13304303 AAA_21: AAA domain; PDB: 3QKS_B 1US8_B 1F2U_B 1F2T 84.99
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 84.96
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 84.88
cd03269210 ABC_putative_ATPase This subfamily is involved in 84.84
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the mal 84.83
cd03218232 ABC_YhbG The ABC transporters belonging to the Yhb 84.82
PLN03118211 Rab family protein; Provisional 84.79
COG4598256 HisP ABC-type histidine transport system, ATPase c 84.77
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 84.72
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase compon 84.67
cd04144190 Ras2 Ras2 subfamily. The Ras2 subfamily, found exc 84.63
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 84.59
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 84.52
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component 84.49
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 84.49
cd04123162 Rab21 Rab21 subfamily. The localization and functi 84.44
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding 84.43
cd04137180 RheB Rheb (Ras Homolog Enriched in Brain) subfamil 84.41
TIGR01978243 sufC FeS assembly ATPase SufC. SufC is part of the 84.39
PRK14531183 adenylate kinase; Provisional 84.34
cd04135174 Tc10 TC10 subfamily. TC10 is a Rho family protein 84.32
cd01866168 Rab2 Rab2 subfamily. Rab2 is localized on cis-Golg 84.31
cd01862172 Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th 84.26
cd03258233 ABC_MetN_methionine_transporter MetN (also known a 84.24
cd03235213 ABC_Metallic_Cations ABC component of the metal-ty 84.23
TIGR02315243 ABC_phnC phosphonate ABC transporter, ATP-binding 84.23
cd01867167 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp 84.22
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 84.21
cd01897168 NOG NOG1 is a nucleolar GTP-binding protein presen 84.2
cd04104197 p47_IIGP_like p47 (47-kDa) family. The p47 GTPase 84.17
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC tra 84.16
PRK05480209 uridine/cytidine kinase; Provisional 84.14
PRK15177213 Vi polysaccharide export ATP-binding protein VexC; 84.1
PF04670 232 Gtr1_RagA: Gtr1/RagA G protein conserved region; I 84.1
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 84.07
cd04118193 Rab24 Rab24 subfamily. Rab24 is distinct from othe 84.0
PRK11701258 phnK phosphonate C-P lyase system protein PhnK; Pr 83.95
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 83.92
PLN03110216 Rab GTPase; Provisional 83.91
cd03279213 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complex 83.83
cd04109215 Rab28 Rab28 subfamily. First identified in maize, 83.77
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 83.75
cd04111211 Rab39 Rab39 subfamily. Found in eukaryotes, Rab39 83.71
cd04143247 Rhes_like Rhes_like subfamily. This subfamily incl 83.68
TIGR01166190 cbiO cobalt transport protein ATP-binding subunit. 83.66
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 83.65
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; 83.64
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 83.64
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the tr 83.63
cd04131178 Rnd Rnd subfamily. The Rnd subfamily contains Rnd1 83.62
cd04113161 Rab4 Rab4 subfamily. Rab4 has been implicated in n 83.6
cd04162164 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9 83.59
cd01898170 Obg Obg subfamily. The Obg nucleotide binding prot 83.59
cd04146165 RERG_RasL11_like RERG/RasL11-like subfamily. RERG 83.58
cd01861161 Rab6 Rab6 subfamily. Rab6 is involved in microtubu 83.56
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 83.54
PRK04213201 GTP-binding protein; Provisional 83.54
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 83.52
PRK11264250 putative amino-acid ABC transporter ATP-binding pr 83.51
PRK14242253 phosphate transporter ATP-binding protein; Provisi 83.51
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-li 83.47
cd03257228 ABC_NikE_OppD_transporters The ABC transporter sub 83.41
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 83.41
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is 83.39
COG4615546 PvdE ABC-type siderophore export system, fused ATP 83.34
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 83.31
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 83.26
cd04103158 Centaurin_gamma Centaurin gamma. The centaurins (a 83.22
PRK10771232 thiQ thiamine transporter ATP-binding subunit; Pro 83.14
PLN00023 334 GTP-binding protein; Provisional 83.12
TIGR01189198 ccmA heme ABC exporter, ATP-binding protein CcmA. 83.1
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is 83.06
PLN03118211 Rab family protein; Provisional 83.05
cd04148221 RGK RGK subfamily. The RGK (Rem, Rem2, Rad, Gem/Ki 83.01
cd04102202 RabL3 RabL3 (Rab-like3) subfamily. RabL3s are nove 83.0
cd03297214 ABC_ModC_molybdenum_transporter ModC is an ABC-typ 82.95
PF13479213 AAA_24: AAA domain 82.93
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) 82.92
PRK11176582 lipid transporter ATP-binding/permease protein; Pr 82.89
PRK05057172 aroK shikimate kinase I; Reviewed 82.87
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 82.86
cd00464154 SK Shikimate kinase (SK) is the fifth enzyme in th 82.8
PRK00131175 aroK shikimate kinase; Reviewed 82.78
TIGR02770230 nickel_nikD nickel import ATP-binding protein NikD 82.78
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-bind 82.77
PRK10463290 hydrogenase nickel incorporation protein HypB; Pro 82.74
PHA02530300 pseT polynucleotide kinase; Provisional 82.73
cd04147198 Ras_dva Ras-dva subfamily. Ras-dva (Ras - dorsal-v 82.71
cd04132187 Rho4_like Rho4-like subfamily. Rho4 is a GTPase th 82.7
cd03215182 ABC_Carb_Monos_II This family represents domain II 82.7
cd04171164 SelB SelB subfamily. SelB is an elongation factor 82.69
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 82.67
smart00174174 RHO Rho (Ras homology) subfamily of Ras-like small 82.64
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 82.62
PRK10584228 putative ABC transporter ATP-binding protein YbbA; 82.62
cd03267236 ABC_NatA_like Similar in sequence to NatA, this is 82.62
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter t 82.61
PRK09825176 idnK D-gluconate kinase; Provisional 82.6
COG0529197 CysC Adenylylsulfate kinase and related kinases [I 82.6
PRK10895241 lipopolysaccharide ABC transporter ATP-binding pro 82.6
cd04126220 Rab20 Rab20 subfamily. Rab20 is one of several Rab 82.58
PRK14241258 phosphate transporter ATP-binding protein; Provisi 82.57
PRK10908222 cell division protein FtsE; Provisional 82.54
cd03216163 ABC_Carb_Monos_I This family represents the domain 82.53
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin 82.51
cd02025220 PanK Pantothenate kinase (PanK) catalyzes the phos 82.45
PRK06762166 hypothetical protein; Provisional 82.4
PRK11248255 tauB taurine transporter ATP-binding subunit; Prov 82.37
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transpor 82.27
PRK15056272 manganese/iron transporter ATP-binding protein; Pr 82.25
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, cl 82.22
PRK14527191 adenylate kinase; Provisional 82.15
PRK13539207 cytochrome c biogenesis protein CcmA; Provisional 82.13
PF02421156 FeoB_N: Ferrous iron transport protein B; InterPro 82.13
PRK14526211 adenylate kinase; Provisional 82.04
PRK04182180 cytidylate kinase; Provisional 82.01
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 82.01
KOG0090238 consensus Signal recognition particle receptor, be 81.99
cd01870175 RhoA_like RhoA-like subfamily. The RhoA subfamily 81.95
cd00882157 Ras_like_GTPase Ras-like GTPase superfamily. The R 81.95
COG3842352 PotA ABC-type spermidine/putrescine transport syst 81.94
PRK11124242 artP arginine transporter ATP-binding subunit; Pro 81.94
COG3638258 ABC-type phosphate/phosphonate transport system, A 81.91
cd04119168 RJL RJL (RabJ-Like) subfamily. RJLs are found in m 81.9
TIGR01277213 thiQ thiamine ABC transporter, ATP-binding protein 81.86
PRK13638271 cbiO cobalt transporter ATP-binding subunit; Provi 81.86
PRK11614237 livF leucine/isoleucine/valine transporter ATP-bin 81.77
PRK14738206 gmk guanylate kinase; Provisional 81.77
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 81.75
PRK14528186 adenylate kinase; Provisional 81.74
cd03246173 ABCC_Protease_Secretion This family represents the 81.65
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tr 81.55
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding su 81.54
TIGR02323253 CP_lyasePhnK phosphonate C-P lyase system protein 81.53
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 81.52
cd04105203 SR_beta Signal recognition particle receptor, beta 81.49
TIGR02769265 nickel_nikE nickel import ATP-binding protein NikE 81.47
cd01868165 Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a 81.44
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 81.41
cd00880163 Era_like Era (E. coli Ras-like protein)-like. This 81.41
TIGR03005252 ectoine_ehuA ectoine/hydroxyectoine ABC transporte 81.41
PRK11300255 livG leucine/isoleucine/valine transporter ATP-bin 81.39
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o 81.39
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin ex 81.35
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein 81.28
PF10662143 PduV-EutP: Ethanolamine utilisation - propanediol 81.28
PRK14250241 phosphate ABC transporter ATP-binding protein; Pro 81.22
COG4559259 ABC-type hemin transport system, ATPase component 81.2
TIGR01184230 ntrCD nitrate transport ATP-binding subunits C and 81.1
PRK14245250 phosphate ABC transporter ATP-binding protein; Pro 81.09
TIGR03411242 urea_trans_UrtD urea ABC transporter, ATP-binding 81.09
PRK00625173 shikimate kinase; Provisional 81.05
COG3839338 MalK ABC-type sugar transport systems, ATPase comp 81.04
TIGR01288303 nodI ATP-binding ABC transporter family nodulation 81.03
TIGR01526325 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltr 81.02
TIGR03574249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem 81.01
cd04112191 Rab26 Rab26 subfamily. First identified in rat pan 81.01
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 80.98
PRK11831269 putative ABC transporter ATP-binding protein YrbF; 80.94
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 80.91
cd01890179 LepA LepA subfamily. LepA belongs to the GTPase fa 80.9
TIGR01193708 bacteriocin_ABC ABC-type bacteriocin transporter. 80.88
cd04125188 RabA_like RabA-like subfamily. RabA was first iden 80.84
PRK10790592 putative multidrug transporter membrane\ATP-bindin 80.83
TIGR00972247 3a0107s01c2 phosphate ABC transporter, ATP-binding 80.79
PRK14273254 phosphate ABC transporter ATP-binding protein; Pro 80.79
PLN00023334 GTP-binding protein; Provisional 80.78
PRK14267253 phosphate ABC transporter ATP-binding protein; Pro 80.76
PRK14737186 gmk guanylate kinase; Provisional 80.74
PRK10247225 putative ABC transporter ATP-binding protein YbbL; 80.74
cd03236255 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o 80.71
TIGR02324224 CP_lyasePhnL phosphonate C-P lyase system protein 80.7
PF04670232 Gtr1_RagA: Gtr1/RagA G protein conserved region; I 80.67
PF00735281 Septin: Septin; InterPro: IPR000038 Septins consti 80.64
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 80.57
TIGR03771223 anch_rpt_ABC anchored repeat-type ABC transporter, 80.57
cd03227162 ABC_Class2 ABC-type Class 2 contains systems invol 80.52
COG1127263 Ttg2A ABC-type transport system involved in resist 80.5
TIGR03864236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 80.5
PRK10418254 nikD nickel transporter ATP-binding protein NikD; 80.48
cd04133176 Rop_like Rop subfamily. The Rop (Rho-related prote 80.48
cd04116170 Rab9 Rab9 subfamily. Rab9 is found in late endosom 80.45
PRK14247250 phosphate ABC transporter ATP-binding protein; Pro 80.44
PRK14240250 phosphate transporter ATP-binding protein; Provisi 80.43
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pi 80.41
cd03217200 ABC_FeS_Assembly ABC-type transport system involve 80.37
PRK14248268 phosphate ABC transporter ATP-binding protein; Pro 80.36
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 80.35
PRK14251251 phosphate ABC transporter ATP-binding protein; Pro 80.35
PRK10744260 pstB phosphate transporter ATP-binding protein; Pr 80.32
PRK13651305 cobalt transporter ATP-binding subunit; Provisiona 80.3
cd03240204 ABC_Rad50 The catalytic domains of Rad50 are simil 80.28
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 80.26
PRK14239252 phosphate transporter ATP-binding protein; Provisi 80.25
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, c 80.22
PRK14256252 phosphate ABC transporter ATP-binding protein; Pro 80.22
PRK13650279 cbiO cobalt transporter ATP-binding subunit; Provi 80.21
cd03220224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo 80.2
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; 80.2
cd03248226 ABCC_TAP TAP, the Transporter Associated with Anti 80.18
PRK01184184 hypothetical protein; Provisional 80.16
KOG2355291 consensus Predicted ABC-type transport, ATPase com 80.15
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 80.13
PF06414199 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This e 80.12
cd04106162 Rab23_lke Rab23-like subfamily. Rab23 is a member 80.11
PRK09580248 sufC cysteine desulfurase ATPase component; Review 80.09
cd01896233 DRG The developmentally regulated GTP-binding prot 80.07
TIGR03740223 galliderm_ABC gallidermin-class lantibiotic protec 80.01
>KOG0082 consensus G-protein alpha subunit (small G protein superfamily) [Cell cycle control, cell division, chromosome partitioning; Signal transduction mechanisms] Back     alignment and domain information 
Probab=100.00  E-value=5e-71  Score=595.09  Aligned_cols=250  Identities=34%  Similarity=0.518  Sum_probs=220.1

Q ss_pred             cccccccCch-hHHHhcceeeEEEeecCCCCchhHHHHHHHHhcCCCCCHHHhhhhHHHHHHHHHHHHHHHHhhhccchh
Q 003444          514 GSGLMSRSVP-DYIERRTLQKLLLVGCSGSGTSTIFKQAKILYKAVPFSDDEHENIKLKIQSNAYGYLGILLEGRERFEE  592 (819)
Q Consensus       514 ~S~~IDr~L~-dk~~~k~~vKLLLLGaGESGKSTIlKQMKILy~p~GFS~eEr~~~K~iIqsNIi~sm~iLLea~e~fe~  592 (819)
                      .|..||++|+ ++++.++.+||||||+||||||||+|||||||. +|||++|+..+|.+||.|++++|..||+||+.+++
T Consensus        15 ~~~~I~~~l~~~~~~~~~~iKlLLLGageSGKSTI~KQmkilh~-~gfs~ee~~~~r~~I~~N~~~~~~~ll~a~~~~~i   93 (354)
T KOG0082|consen   15 RSKEIDKQLKKEKKKEKKIIKLLLLGAGESGKSTIVKQMKILHG-DGFSEEELLEYRPVIYSNIIQSLKALLRAMETLGI   93 (354)
T ss_pred             hhhhhhHHHHHHHHhhhhheeeeeecCCCCchHHHHHHHHHHhc-CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcC
Confidence            7899999998 889999999999999999999999999999999 99999999999999999999999999999986665


Q ss_pred             hHHHhhhhcCCCCCCCCCCCCCCCCCcceeccchhhHHhHHHHHhh-hhcCCccccCcccchhHHHHHHHHhcCHHHHHH
Q 003444          593 EILGEKRKKQSSDETNPVGSSDSTDGKTIYTIGPRLKAFSDWLLKT-MVSGNLEAIFPAATREYSPLVEELWKDAAIQAT  671 (819)
Q Consensus       593 e~l~e~r~~~spde~~~~g~~~~~~~~~Iysi~~rlk~fsdwll~~-~~~g~ld~~fp~~t~E~A~aI~eLWkDpgIQ~~  671 (819)
                      +.                +.+...++.         ..    ++.. ...++.    +.+++|++++|++||+||+||+|
T Consensus        94 ~~----------------~~~~~~~d~---------~~----~~~~~~~~~~~----~~~~~e~~~~i~~lW~d~~Iq~~  140 (354)
T KOG0082|consen   94 NL----------------DDPERENDA---------QK----LTLLADAAEEL----GVFSPELAEAIKELWKDPGIQAC  140 (354)
T ss_pred             CC----------------CChhhhhHH---------HH----HHHhhhccccc----ccCCHHHHHHHHHHHcCHHHHHH
Confidence            32                122111110         00    1111 111111    45678999999999999999999


Q ss_pred             HhcccchhhcccchhhhhhcccccccCCCCCCccceeeeecccccCCeeEEEEEcCCCCCCCCccccccccccccEEEEE
Q 003444          672 YSRRSELEMLSSVASYFLERVVDISRTDYEPSDLDILYAEGVTSSNGLACVDFSFPRSASDDSVDTADQHDSLLRYQLIR  751 (819)
Q Consensus       672 y~RRnEfq~LpDSA~YFLdnIdRIaspDYvPTdqDILraR~kT~stGItE~eF~~~~~~~~~~~D~ggqr~~~l~frLiD  751 (819)
                      |+||+||+ |+|+|.|||+|++||++|+|+||++||||+|++|  +||+|+.|++++                ++|+++|
T Consensus       141 ~~r~~e~~-l~Dsa~Yfl~~l~rI~~~~Y~PT~~DIL~~R~~T--~GI~e~~F~~k~----------------~~f~~~D  201 (354)
T KOG0082|consen  141 YERRREFQ-LNDSAKYFLENLDRISSPDYVPTEQDILRSRVPT--TGIVEVEFTIKG----------------LKFRMFD  201 (354)
T ss_pred             HHcCCcCC-CCccHHHHHHhHHHhcCCCCCCCHHHHHhhccCc--CCeeEEEEEeCC----------------CceEEEe
Confidence            99999999 8999999999999999999999999999999998  699999999987                7999999


Q ss_pred             ecccccccccccccccCCCCEEEEEEeCCCcccccccCCCCccchHHHHHHHHHHHhccccccCCCCC
Q 003444          752 VQARGLGENCKWLEMFEDIGMVIFCVALSDYDQFSVDGNGSLMNKMMLSRKFFESIVTIQLLIRWNFF  819 (819)
Q Consensus       752 VGGQgrsERkKWi~~FEdVtaVIFvVSLSdYDQ~lED~~G~~~NRM~ESL~LFEsI~nnp~F~~t~f~  819 (819)
                      |||| |+||+||+||||+|+|||||||||+|||+++++.  .+|||+||++||++||||+||++|+||
T Consensus       202 vGGQ-RseRrKWihcFe~v~aviF~vslSeYdq~l~ED~--~~NRM~eS~~LF~sI~n~~~F~~tsii  266 (354)
T KOG0082|consen  202 VGGQ-RSERKKWIHCFEDVTAVIFCVSLSEYDQVLEEDE--TTNRMHESLKLFESICNNKWFANTSII  266 (354)
T ss_pred             CCCc-HHHhhhHHHhhcCCCEEEEEEehhhhhhhccccc--chhHHHHHHHHHHHHhcCcccccCcEE
Confidence            9999 9999999999999999999999999999965443  799999999999999999999999986

>KOG0085 consensus G protein subunit Galphaq/Galphay, small G protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>smart00275 G_alpha G protein alpha subunit Back     alignment and domain information
>PF00503 G-alpha: G-protein alpha subunit; InterPro: IPR001019 Guanine nucleotide binding proteins (G proteins) are membrane-associated, heterotrimeric proteins composed of three subunits: alpha (IPR001019 from INTERPRO), beta (IPR001632 from INTERPRO) and gamma (IPR001770 from INTERPRO) [] Back     alignment and domain information
>KOG0099 consensus G protein subunit Galphas, small G protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>cd00066 G-alpha G protein alpha subunit Back     alignment and domain information
>PF00025 Arf: ADP-ribosylation factor family The prints entry specific to Sar1 proteins The Prosite entry specific to Sar1 proteins; InterPro: IPR006689 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>KOG0071 consensus GTP-binding ADP-ribosylation factor Arf6 (dArf3) [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0070 consensus GTP-binding ADP-ribosylation factor Arf1 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0073 consensus GTP-binding ADP-ribosylation factor-like protein ARL2 [Intracellular trafficking, secretion, and vesicular transport; Cytoskeleton] Back     alignment and domain information
>KOG0072 consensus GTP-binding ADP-ribosylation factor-like protein ARL1 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN00223 ADP-ribosylation factor; Provisional Back     alignment and domain information
>KOG0074 consensus GTP-binding ADP-ribosylation factor-like protein ARL3 [General function prediction only] Back     alignment and domain information
>smart00177 ARF ARF-like small GTPases; ARF, ADP-ribosylation factor Back     alignment and domain information
>cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily Back     alignment and domain information
>cd04150 Arf1_5_like Arf1-Arf5-like subfamily Back     alignment and domain information
>cd04149 Arf6 Arf6 subfamily Back     alignment and domain information
>KOG0076 consensus GTP-binding ADP-ribosylation factor-like protein yARL3 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0075 consensus GTP-binding ADP-ribosylation factor-like protein [General function prediction only] Back     alignment and domain information
>PTZ00133 ADP-ribosylation factor; Provisional Back     alignment and domain information
>cd04158 ARD1 ARD1 subfamily Back     alignment and domain information
>smart00178 SAR Sar1p-like members of the Ras-family of small GTPases Back     alignment and domain information
>cd04157 Arl6 Arl6 subfamily Back     alignment and domain information
>cd04153 Arl5_Arl8 Arl5/Arl8 subfamily Back     alignment and domain information
>cd04160 Arfrp1 Arfrp1 subfamily Back     alignment and domain information
>cd00879 Sar1 Sar1 subfamily Back     alignment and domain information
>KOG0077 consensus Vesicle coat complex COPII, GTPase subunit SAR1 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd04162 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily Back     alignment and domain information
>cd04151 Arl1 Arl1 subfamily Back     alignment and domain information
>cd04156 ARLTS1 ARLTS1 subfamily Back     alignment and domain information
>cd04154 Arl2 Arl2 subfamily Back     alignment and domain information
>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases Back     alignment and domain information
>KOG0074 consensus GTP-binding ADP-ribosylation factor-like protein ARL3 [General function prediction only] Back     alignment and domain information
>cd04175 Rap1 Rap1 subgroup Back     alignment and domain information
>cd04152 Arl4_Arl7 Arl4/Arl7 subfamily Back     alignment and domain information
>cd04176 Rap2 Rap2 subgroup Back     alignment and domain information
>cd04159 Arl10_like Arl10-like subfamily Back     alignment and domain information
>cd04136 Rap_like Rap-like subfamily Back     alignment and domain information
>PF00025 Arf: ADP-ribosylation factor family The prints entry specific to Sar1 proteins The Prosite entry specific to Sar1 proteins; InterPro: IPR006689 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>cd04120 Rab12 Rab12 subfamily Back     alignment and domain information
>cd04155 Arl3 Arl3 subfamily Back     alignment and domain information
>cd01892 Miro2 Miro2 subfamily Back     alignment and domain information
>PTZ00099 rab6; Provisional Back     alignment and domain information
>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>cd04143 Rhes_like Rhes_like subfamily Back     alignment and domain information
>cd04173 Rnd2_Rho7 Rnd2/Rho7 subfamily Back     alignment and domain information
>cd01875 RhoG RhoG subfamily Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>cd00879 Sar1 Sar1 subfamily Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>cd04113 Rab4 Rab4 subfamily Back     alignment and domain information
>cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily Back     alignment and domain information
>TIGR00231 small_GTP small GTP-binding protein domain Back     alignment and domain information
>cd00154 Rab Rab family Back     alignment and domain information
>cd04154 Arl2 Arl2 subfamily Back     alignment and domain information
>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>cd04155 Arl3 Arl3 subfamily Back     alignment and domain information
>cd00157 Rho Rho (Ras homology) family Back     alignment and domain information
>cd01874 Cdc42 Cdc42 subfamily Back     alignment and domain information
>PTZ00133 ADP-ribosylation factor; Provisional Back     alignment and domain information
>smart00175 RAB Rab subfamily of small GTPases Back     alignment and domain information
>cd04130 Wrch_1 Wrch-1 subfamily Back     alignment and domain information
>cd01860 Rab5_related Rab5-related subfamily Back     alignment and domain information
>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily Back     alignment and domain information
>cd04150 Arf1_5_like Arf1-Arf5-like subfamily Back     alignment and domain information
>cd04144 Ras2 Ras2 subfamily Back     alignment and domain information
>cd01860 Rab5_related Rab5-related subfamily Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>PF00071 Ras: Ras family; InterPro: IPR001806 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>smart00173 RAS Ras subfamily of RAS small GTPases Back     alignment and domain information
>cd04105 SR_beta Signal recognition particle receptor, beta subunit (SR-beta) Back     alignment and domain information
>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse Back     alignment and domain information
>cd04123 Rab21 Rab21 subfamily Back     alignment and domain information
>cd04139 RalA_RalB RalA/RalB subfamily Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>COG4639 Predicted kinase [General function prediction only] Back     alignment and domain information
>PRK06217 hypothetical protein; Validated Back     alignment and domain information
>cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily Back     alignment and domain information
>cd04121 Rab40 Rab40 subfamily Back     alignment and domain information
>cd04114 Rab30 Rab30 subfamily Back     alignment and domain information
>cd04160 Arfrp1 Arfrp1 subfamily Back     alignment and domain information
>COG1100 GTPase SAR1 and related small G proteins [General function prediction only] Back     alignment and domain information
>cd04127 Rab27A Rab27a subfamily Back     alignment and domain information
>cd04135 Tc10 TC10 subfamily Back     alignment and domain information
>PLN00223 ADP-ribosylation factor; Provisional Back     alignment and domain information
>cd04106 Rab23_lke Rab23-like subfamily Back     alignment and domain information
>KOG0073 consensus GTP-binding ADP-ribosylation factor-like protein ARL2 [Intracellular trafficking, secretion, and vesicular transport; Cytoskeleton] Back     alignment and domain information
>cd01871 Rac1_like Rac1-like subfamily Back     alignment and domain information
>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily Back     alignment and domain information
>cd01861 Rab6 Rab6 subfamily Back     alignment and domain information
>smart00178 SAR Sar1p-like members of the Ras-family of small GTPases Back     alignment and domain information
>cd04110 Rab35 Rab35 subfamily Back     alignment and domain information
>smart00177 ARF ARF-like small GTPases; ARF, ADP-ribosylation factor Back     alignment and domain information
>cd04124 RabL2 RabL2 subfamily Back     alignment and domain information
>cd00876 Ras Ras family Back     alignment and domain information
>cd04153 Arl5_Arl8 Arl5/Arl8 subfamily Back     alignment and domain information
>smart00173 RAS Ras subfamily of RAS small GTPases Back     alignment and domain information
>cd01865 Rab3 Rab3 subfamily Back     alignment and domain information
>cd04133 Rop_like Rop subfamily Back     alignment and domain information
>cd04128 Spg1 Spg1p Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>cd04136 Rap_like Rap-like subfamily Back     alignment and domain information
>cd01864 Rab19 Rab19 subfamily Back     alignment and domain information
>cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily Back     alignment and domain information
>cd04117 Rab15 Rab15 subfamily Back     alignment and domain information
>cd04119 RJL RJL (RabJ-Like) subfamily Back     alignment and domain information
>cd01868 Rab11_like Rab11-like Back     alignment and domain information
>cd04116 Rab9 Rab9 subfamily Back     alignment and domain information
>cd04177 RSR1 RSR1 subgroup Back     alignment and domain information
>cd04124 RabL2 RabL2 subfamily Back     alignment and domain information
>cd04149 Arf6 Arf6 subfamily Back     alignment and domain information
>cd04122 Rab14 Rab14 subfamily Back     alignment and domain information
>cd04127 Rab27A Rab27a subfamily Back     alignment and domain information
>cd01895 EngA2 EngA2 subfamily Back     alignment and domain information
>cd04147 Ras_dva Ras-dva subfamily Back     alignment and domain information
>cd01862 Rab7 Rab7 subfamily Back     alignment and domain information
>cd04107 Rab32_Rab38 Rab38/Rab32 subfamily Back     alignment and domain information
>cd04107 Rab32_Rab38 Rab38/Rab32 subfamily Back     alignment and domain information
>cd01892 Miro2 Miro2 subfamily Back     alignment and domain information
>cd04151 Arl1 Arl1 subfamily Back     alignment and domain information
>cd04140 ARHI_like ARHI subfamily Back     alignment and domain information
>cd04117 Rab15 Rab15 subfamily Back     alignment and domain information
>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily Back     alignment and domain information
>cd04103 Centaurin_gamma Centaurin gamma Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>cd04112 Rab26 Rab26 subfamily Back     alignment and domain information
>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily Back     alignment and domain information
>cd04134 Rho3 Rho3 subfamily Back     alignment and domain information
>cd04163 Era Era subfamily Back     alignment and domain information
>PTZ00132 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>cd04101 RabL4 RabL4 (Rab-like4) subfamily Back     alignment and domain information
>cd01893 Miro1 Miro1 subfamily Back     alignment and domain information
>cd04122 Rab14 Rab14 subfamily Back     alignment and domain information
>cd01863 Rab18 Rab18 subfamily Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>cd04172 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>PLN03108 Rab family protein; Provisional Back     alignment and domain information
>cd04101 RabL4 RabL4 (Rab-like4) subfamily Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2 Back     alignment and domain information
>cd04110 Rab35 Rab35 subfamily Back     alignment and domain information
>PTZ00369 Ras-like protein; Provisional Back     alignment and domain information
>cd04129 Rho2 Rho2 subfamily Back     alignment and domain information
>cd01870 RhoA_like RhoA-like subfamily Back     alignment and domain information
>cd04158 ARD1 ARD1 subfamily Back     alignment and domain information
>cd01874 Cdc42 Cdc42 subfamily Back     alignment and domain information
>cd01876 YihA_EngB The YihA (EngB) subfamily Back     alignment and domain information
>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes Back     alignment and domain information
>cd01878 HflX HflX subfamily Back     alignment and domain information
>cd04125 RabA_like RabA-like subfamily Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>cd04118 Rab24 Rab24 subfamily Back     alignment and domain information
>cd01865 Rab3 Rab3 subfamily Back     alignment and domain information
>smart00176 RAN Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>cd04108 Rab36_Rab34 Rab34/Rab36 subfamily Back     alignment and domain information
>cd04175 Rap1 Rap1 subgroup Back     alignment and domain information
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate Back     alignment and domain information
>PRK03839 putative kinase; Provisional Back     alignment and domain information
>cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>cd04132 Rho4_like Rho4-like subfamily Back     alignment and domain information
>cd04159 Arl10_like Arl10-like subfamily Back     alignment and domain information
>cd04156 ARLTS1 ARLTS1 subfamily Back     alignment and domain information
>cd01866 Rab2 Rab2 subfamily Back     alignment and domain information
>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB Back     alignment and domain information
>cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily Back     alignment and domain information
>cd04152 Arl4_Arl7 Arl4/Arl7 subfamily Back     alignment and domain information
>PRK14532 adenylate kinase; Provisional Back     alignment and domain information
>cd03274 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>PLN03071 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>cd01863 Rab18 Rab18 subfamily Back     alignment and domain information
>cd04176 Rap2 Rap2 subgroup Back     alignment and domain information
>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes Back     alignment and domain information
>cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily Back     alignment and domain information
>TIGR02528 EutP ethanolamine utilization protein, EutP Back     alignment and domain information
>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) Back     alignment and domain information
>PRK13949 shikimate kinase; Provisional Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>PTZ00369 Ras-like protein; Provisional Back     alignment and domain information
>cd04157 Arl6 Arl6 subfamily Back     alignment and domain information
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family Back     alignment and domain information
>PF13521 AAA_28: AAA domain; PDB: 1LW7_A Back     alignment and domain information
>cd04130 Wrch_1 Wrch-1 subfamily Back     alignment and domain information
>cd04131 Rnd Rnd subfamily Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>cd01875 RhoG RhoG subfamily Back     alignment and domain information
>cd04109 Rab28 Rab28 subfamily Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases Back     alignment and domain information
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily Back     alignment and domain information
>cd04108 Rab36_Rab34 Rab34/Rab36 subfamily Back     alignment and domain information
>TIGR01351 adk adenylate kinases Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>KOG0084 consensus GTPase Rab1/YPT1, small G protein superfamily, and related GTP-binding proteins [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd01871 Rac1_like Rac1-like subfamily Back     alignment and domain information
>PRK13695 putative NTPase; Provisional Back     alignment and domain information
>PTZ00088 adenylate kinase 1; Provisional Back     alignment and domain information
>PLN03071 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>cd04111 Rab39 Rab39 subfamily Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes Back     alignment and domain information
>cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family Back     alignment and domain information
>PRK14530 adenylate kinase; Provisional Back     alignment and domain information
>PRK00454 engB GTP-binding protein YsxC; Reviewed Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) Back     alignment and domain information
>smart00174 RHO Rho (Ras homology) subfamily of Ras-like small GTPases Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>cd04174 Rnd1_Rho6 Rnd1/Rho6 subfamily Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>cd04121 Rab40 Rab40 subfamily Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>smart00534 MUTSac ATPase domain of DNA mismatch repair MUTS family Back     alignment and domain information
>cd04126 Rab20 Rab20 subfamily Back     alignment and domain information
>cd04146 RERG_RasL11_like RERG/RasL11-like subfamily Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>cd04172 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily Back     alignment and domain information
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors Back     alignment and domain information
>cd00154 Rab Rab family Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>PRK02496 adk adenylate kinase; Provisional Back     alignment and domain information
>cd04177 RSR1 RSR1 subgroup Back     alignment and domain information
>cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes Back     alignment and domain information
>PRK00279 adk adenylate kinase; Reviewed Back     alignment and domain information
>cd03272 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>cd04128 Spg1 Spg1p Back     alignment and domain information
>PF13304 AAA_21: AAA domain; PDB: 3QKS_B 1US8_B 1F2U_B 1F2T_B 3QKT_A 1II8_B 3QKR_B 3QKU_A Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>PLN03118 Rab family protein; Provisional Back     alignment and domain information
>COG4598 HisP ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>cd04144 Ras2 Ras2 subfamily Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>cd04123 Rab21 Rab21 subfamily Back     alignment and domain information
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily Back     alignment and domain information
>TIGR01978 sufC FeS assembly ATPase SufC Back     alignment and domain information
>PRK14531 adenylate kinase; Provisional Back     alignment and domain information
>cd04135 Tc10 TC10 subfamily Back     alignment and domain information
>cd01866 Rab2 Rab2 subfamily Back     alignment and domain information
>cd01862 Rab7 Rab7 subfamily Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2 Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans Back     alignment and domain information
>cd04104 p47_IIGP_like p47 (47-kDa) family Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>PRK05480 uridine/cytidine kinase; Provisional Back     alignment and domain information
>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional Back     alignment and domain information
>PF04670 Gtr1_RagA: Gtr1/RagA G protein conserved region; InterPro: IPR006762 GTR1 was first identified in Saccharomyces cerevisiae (Baker's yeast) as a suppressor of a mutation in RCC1 Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>cd04118 Rab24 Rab24 subfamily Back     alignment and domain information
>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PLN03110 Rab GTPase; Provisional Back     alignment and domain information
>cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends Back     alignment and domain information
>cd04109 Rab28 Rab28 subfamily Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>cd04111 Rab39 Rab39 subfamily Back     alignment and domain information
>cd04143 Rhes_like Rhes_like subfamily Back     alignment and domain information
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>cd04131 Rnd Rnd subfamily Back     alignment and domain information
>cd04113 Rab4 Rab4 subfamily Back     alignment and domain information
>cd04162 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily Back     alignment and domain information
>cd01898 Obg Obg subfamily Back     alignment and domain information
>cd04146 RERG_RasL11_like RERG/RasL11-like subfamily Back     alignment and domain information
>cd01861 Rab6 Rab6 subfamily Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>PRK04213 GTP-binding protein; Provisional Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>PRK14242 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E Back     alignment and domain information
>COG4615 PvdE ABC-type siderophore export system, fused ATPase and permease components [Secondary metabolites biosynthesis, transport, and catabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>cd04103 Centaurin_gamma Centaurin gamma Back     alignment and domain information
>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PLN00023 GTP-binding protein; Provisional Back     alignment and domain information
>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>PLN03118 Rab family protein; Provisional Back     alignment and domain information
>cd04148 RGK RGK subfamily Back     alignment and domain information
>cd04102 RabL3 RabL3 (Rab-like3) subfamily Back     alignment and domain information
>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB Back     alignment and domain information
>PF13479 AAA_24: AAA domain Back     alignment and domain information
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 Back     alignment and domain information
>PRK11176 lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>PRK05057 aroK shikimate kinase I; Reviewed Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD Back     alignment and domain information
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein Back     alignment and domain information
>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional Back     alignment and domain information
>PHA02530 pseT polynucleotide kinase; Provisional Back     alignment and domain information
>cd04147 Ras_dva Ras-dva subfamily Back     alignment and domain information
>cd04132 Rho4_like Rho4-like subfamily Back     alignment and domain information
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>cd04171 SelB SelB subfamily Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>smart00174 RHO Rho (Ras homology) subfamily of Ras-like small GTPases Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake Back     alignment and domain information
>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria Back     alignment and domain information
>PRK09825 idnK D-gluconate kinase; Provisional Back     alignment and domain information
>COG0529 CysC Adenylylsulfate kinase and related kinases [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd04126 Rab20 Rab20 subfamily Back     alignment and domain information
>PRK14241 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10908 cell division protein FtsE; Provisional Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment Back     alignment and domain information
>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway Back     alignment and domain information
>PRK06762 hypothetical protein; Provisional Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>PRK15056 manganese/iron transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins Back     alignment and domain information
>PRK14527 adenylate kinase; Provisional Back     alignment and domain information
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PF02421 FeoB_N: Ferrous iron transport protein B; InterPro: IPR011619 Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions Back     alignment and domain information
>PRK14526 adenylate kinase; Provisional Back     alignment and domain information
>PRK04182 cytidylate kinase; Provisional Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>KOG0090 consensus Signal recognition particle receptor, beta subunit (small G protein superfamily) [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd01870 RhoA_like RhoA-like subfamily Back     alignment and domain information
>cd00882 Ras_like_GTPase Ras-like GTPase superfamily Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd04119 RJL RJL (RabJ-Like) subfamily Back     alignment and domain information
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14738 gmk guanylate kinase; Provisional Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>PRK14528 adenylate kinase; Provisional Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP Back     alignment and domain information
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>cd04105 SR_beta Signal recognition particle receptor, beta subunit (SR-beta) Back     alignment and domain information
>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE Back     alignment and domain information
>cd01868 Rab11_like Rab11-like Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd00880 Era_like Era (E Back     alignment and domain information
>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor Back     alignment and domain information
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters Back     alignment and domain information
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways Back     alignment and domain information
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>PRK14245 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>PRK00625 shikimate kinase; Provisional Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>TIGR01526 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltransferase, NadR type Back     alignment and domain information
>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal Back     alignment and domain information
>cd04112 Rab26 Rab26 subfamily Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd01890 LepA LepA subfamily Back     alignment and domain information
>TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter Back     alignment and domain information
>cd04125 RabA_like RabA-like subfamily Back     alignment and domain information
>PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PLN00023 GTP-binding protein; Provisional Back     alignment and domain information
>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14737 gmk guanylate kinase; Provisional Back     alignment and domain information
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor Back     alignment and domain information
>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>PF04670 Gtr1_RagA: Gtr1/RagA G protein conserved region; InterPro: IPR006762 GTR1 was first identified in Saccharomyces cerevisiae (Baker's yeast) as a suppressor of a mutation in RCC1 Back     alignment and domain information
>PF00735 Septin: Septin; InterPro: IPR000038 Septins constitute a eukaryotic family of guanine nucleotide-binding proteins, most of which polymerise to form filaments [] Back     alignment and domain information
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>cd03227 ABC_Class2 ABC-type Class 2 contains systems involved in cellular processes other than transport Back     alignment and domain information
>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional Back     alignment and domain information
>cd04133 Rop_like Rop subfamily Back     alignment and domain information
>cd04116 Rab9 Rab9 subfamily Back     alignment and domain information
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14240 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>PRK14248 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>PRK14251 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13651 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03240 ABC_Rad50 The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>PRK14239 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export Back     alignment and domain information
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules Back     alignment and domain information
>PRK01184 hypothetical protein; Provisional Back     alignment and domain information
>KOG2355 consensus Predicted ABC-type transport, ATPase component/CCR4 associated factor [General function prediction only; Transcription] Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>PF06414 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This entry represents a domain originally identified in bacterial zeta toxin proteins, where it comprises the whole protein [] Back     alignment and domain information
>cd04106 Rab23_lke Rab23-like subfamily Back     alignment and domain information
>PRK09580 sufC cysteine desulfurase ATPase component; Reviewed Back     alignment and domain information
>cd01896 DRG The developmentally regulated GTP-binding protein (DRG) subfamily is an uncharacterized member of the Obg family, an evolutionary branch of GTPase superfamily proteins Back     alignment and domain information
>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query819
2xtz_A354 Crystal Structure Of The G Alpha Protein Atgpa1 Fro 1e-21
1shz_A340 Crystal Structure Of The P115rhogef Rgrgs Domain In 2e-19
1gg2_A353 G Protein Heterotrimer Mutant Gi_alpha_1(G203a) Bet 2e-17
2ode_A350 Crystal Structure Of The Heterodimeric Complex Of H 3e-17
2ihb_A323 Crystal Structure Of The Heterodimeric Complex Of H 4e-17
3umr_A354 Crystal Structure Of The G202d Mutant Of Human G-Al 4e-17
4g5o_A330 Structure Of Lgn Gl4GALPHAI3(Q147L) COMPLEX Length 4e-17
3ums_A354 Crystal Structure Of The G202a Mutant Of Human G-Al 4e-17
4g5r_A330 Structure Of Lgn Gl4GALPHAI3 COMPLEX Length = 330 4e-17
3ffb_A360 Crystal Structure Of A Fast Activating G Protein Mu 6e-17
1gil_A353 Structure Of Active Conformations Of Gia1 And The M 7e-17
2zjy_A356 Structure Of The K349p Mutant Of Gi Alpha 1 Subunit 7e-17
1gp2_A353 G Protein Heterotrimer Gi_alpha_1 Beta_1 Gamma_2 Wi 8e-17
3c7k_A333 Molecular Architecture Of Galphao And The Structura 1e-16
3onw_A328 Structure Of A G-Alpha-I1 Mutant With Enhanced Affi 1e-16
1as0_A353 Gtp-Gamma-S Bound G42v Gia1 Length = 353 1e-16
2xns_A327 Crystal Structure Of Human G Alpha I1 Bound To A De 1e-16
1kjy_A325 Crystal Structure Of Human G[alpha]i1 Bound To The 1e-16
1y3a_A329 Structure Of G-Alpha-I1 Bound To A Gdp-Selective Pe 1e-16
4g5q_A330 Structure Of Lgn Gl4GALPHAI1 COMPLEX Length = 330 1e-16
3qi2_A328 A Galpha P-Loop Mutation Prevents Transition To The 1e-16
2gtp_A323 Crystal Structure Of The Heterodimeric Complex Of H 1e-16
2ik8_A324 Crystal Structure Of The Heterodimeric Complex Of H 1e-16
1svk_A353 Structure Of The K180p Mutant Of Gi Alpha Subunit B 1e-16
2g83_A313 Structure Of Activated G-alpha-i1 Bound To A Nucleo 1e-16
3qe0_A325 A Galpha-I1 P-Loop Mutation Prevents Transition To 2e-16
3d7m_A354 Crystal Structure Of The G Protein Fast-Exchange Do 2e-16
1bh2_A315 A326s Mutant Of An Inhibitory Alpha Subunit Length 2e-16
1zcb_A362 Crystal Structure Of G Alpha 13 In Complex With Gdp 5e-15
3cx7_A338 Crystal Structure Of Pdzrhogef Rgrgs Domain In A Co 1e-14
3cx6_A338 Crystal Structure Of Pdzrhogef Rgrgs Domain In A Co 5e-14
1zca_A359 Crystal Structure Of G Alpha 12 In Complex With Gdp 6e-14
3v00_C356 Studies Of A Constitutively Active G-Alpha Subunit 3e-13
1fqj_A325 Crystal Structure Of The Heterotrimeric Complex Of 3e-13
1cs4_C 394 Complex Of Gs-Alpha With The Catalytic Domains Of M 4e-12
1azs_C 402 Complex Of Gs-Alpha With The Catalytic Domains Of M 4e-12
1cjk_C 402 Complex Of Gs-Alpha With The Catalytic Domains Of M 1e-11
3sn6_A 380 Crystal Structure Of The Beta2 Adrenergic Receptor- 1e-11
1cul_C 380 Complex Of Gs-Alpha With The Catalytic Domains Of M 3e-11
1got_A350 Heterotrimeric Complex Of A Gt-AlphaGI-Alpha Chimer 6e-11
2bcj_Q353 Crystal Structure Of G Protein-coupled Receptor Kin 1e-10
3ah8_A355 Structure Of Heterotrimeric G Protein Galpha-Q Beta 2e-10
4gnk_A353 Crystal Structure Of Galphaq In Complex With Full-l 3e-10
3ohm_A327 Crystal Structure Of Activated G Alpha Q Bound To I 4e-10
1tnd_A324 The 2.2 Angstroms Crystal Structure Of Transducin-A 1e-09
4fid_A340 Crystal Structure Of A Heterotrimeric G-Protein Sub 1e-09
4ekc_A347 Structure Of Human Regulator Of G Protein Signaling 1e-09
>pdb|2XTZ|A Chain A, Crystal Structure Of The G Alpha Protein Atgpa1 From Arabidopsis Thaliana Length = 354 Back     alignment and structure 
Iteration: 1

 Score =  101 bits (252), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 81/278 (29%), Positives = 138/278 (49%), Gaps = 43/278 (15%)
Query: 531 LQKLLLVGCSGSGTSTIFKQAKILYKAVPFSDDEHENIKLKIQSNAYGYLGILLEGRERF 590
           ++KLLL+G   SG STIFKQ K+L++   F + E ++    I +N Y  + +L +G + F
Sbjct: 9   IRKLLLLGAGESGKSTIFKQIKLLFQT-GFDEGELKSYVPVIHANVYQTIKLLHDGTKEF 67
Query: 591 EEEILGEKRKKQSSDETNPVGSSDSTDGKTIYTIGPRLKAFSDWLLKTMVSGNLEAIFPA 650
            +           +D    + SS+S        IG +L         + + G L+  +P 
Sbjct: 68  AQ---------NETDSAKYMLSSESI------AIGEKL---------SEIGGRLD--YPR 101
Query: 651 ATREYSPLVEELWKDAAIQATYSRRSELEMLSSVASYFLERVVDISRTDYEPSDLDILYA 710
            T++ +  +E LWKD AIQ T +R +EL++      Y +E +  +S  +Y P+  D+LYA
Sbjct: 102 LTKDIAEGIETLWKDPAIQETXARGNELQV-PDXTKYLMENLKRLSDINYIPTKEDVLYA 160
Query: 711 EGVTSSNGLACVDFSFPRSASDDSVDTADQHDSLLRYQLIRVQARGLGENCKWLEMFEDI 770
                + G+  + FS P   +  S +          Y+L  V  +   E  KW+ +FE +
Sbjct: 161 R--VRTTGVVEIQFS-PVGENKKSGEV---------YRLFDVGGQR-NERRKWIHLFEGV 207
Query: 771 GMVIFCVALSDYDQFSVDGNGSLMNKMMLSRKFFESIV 808
             VIFC A+S+YDQ   +      N+MM +++ F+ ++
Sbjct: 208 TAVIFCAAISEYDQTLFEDEQK--NRMMETKELFDWVL 243
>pdb|1SHZ|A Chain A, Crystal Structure Of The P115rhogef Rgrgs Domain In A Complex With Galpha(13):galpha(i1) Chimera Length = 340 Back     alignment and structure
>pdb|1GG2|A Chain A, G Protein Heterotrimer Mutant Gi_alpha_1(G203a) Beta_1 Gamma_2 With Gdp Bound Length = 353 Back     alignment and structure
>pdb|2ODE|A Chain A, Crystal Structure Of The Heterodimeric Complex Of Human Rgs8 And Activated Gi Alpha 3 Length = 350 Back     alignment and structure
>pdb|2IHB|A Chain A, Crystal Structure Of The Heterodimeric Complex Of Human Rgs10 And Activated Gi Alpha 3 Length = 323 Back     alignment and structure
>pdb|3UMR|A Chain A, Crystal Structure Of The G202d Mutant Of Human G-Alpha-I1 Length = 354 Back     alignment and structure
>pdb|4G5O|A Chain A, Structure Of Lgn Gl4GALPHAI3(Q147L) COMPLEX Length = 330 Back     alignment and structure
>pdb|3UMS|A Chain A, Crystal Structure Of The G202a Mutant Of Human G-Alpha-I1 Length = 354 Back     alignment and structure
>pdb|4G5R|A Chain A, Structure Of Lgn Gl4GALPHAI3 COMPLEX Length = 330 Back     alignment and structure
>pdb|1GIL|A Chain A, Structure Of Active Conformations Of Gia1 And The Mechanism Of Gtp Hydrolysis Length = 353 Back     alignment and structure
>pdb|2ZJY|A Chain A, Structure Of The K349p Mutant Of Gi Alpha 1 Subunit Bound To Alf4 And Gdp Length = 356 Back     alignment and structure
>pdb|1GP2|A Chain A, G Protein Heterotrimer Gi_alpha_1 Beta_1 Gamma_2 With Gdp Bound Length = 353 Back     alignment and structure
>pdb|3C7K|A Chain A, Molecular Architecture Of Galphao And The Structural Basis For Rgs16-Mediated Deactivation Length = 333 Back     alignment and structure
>pdb|3ONW|A Chain A, Structure Of A G-Alpha-I1 Mutant With Enhanced Affinity For The Rgs14 Goloco Motif. Length = 328 Back     alignment and structure
>pdb|1AS0|A Chain A, Gtp-Gamma-S Bound G42v Gia1 Length = 353 Back     alignment and structure
>pdb|2XNS|A Chain A, Crystal Structure Of Human G Alpha I1 Bound To A Designed Helical Peptide Derived From The Goloco Motif Of Rgs14 Length = 327 Back     alignment and structure
>pdb|1KJY|A Chain A, Crystal Structure Of Human G[alpha]i1 Bound To The Goloco Motif Of Rgs14 Length = 325 Back     alignment and structure
>pdb|1Y3A|A Chain A, Structure Of G-Alpha-I1 Bound To A Gdp-Selective Peptide Provides Insight Into Guanine Nucleotide Exchange Length = 329 Back     alignment and structure
>pdb|4G5Q|A Chain A, Structure Of Lgn Gl4GALPHAI1 COMPLEX Length = 330 Back     alignment and structure
>pdb|3QI2|A Chain A, A Galpha P-Loop Mutation Prevents Transition To The Activated State: G42r Bound To Rgs14 Goloco Length = 328 Back     alignment and structure
>pdb|2GTP|A Chain A, Crystal Structure Of The Heterodimeric Complex Of Human Rgs1 And Activated Gi Alpha 1 Length = 323 Back     alignment and structure
>pdb|2IK8|A Chain A, Crystal Structure Of The Heterodimeric Complex Of Human Rgs16 And Activated Gi Alpha 1 Length = 324 Back     alignment and structure
>pdb|1SVK|A Chain A, Structure Of The K180p Mutant Of Gi Alpha Subunit Bound To Alf4 And Gdp Length = 353 Back     alignment and structure
>pdb|2G83|A Chain A, Structure Of Activated G-alpha-i1 Bound To A Nucleotide- State-selective Peptide: Minimal Determinants For Recognizing The Active Form Of A G Protein Alpha Subunit Length = 313 Back     alignment and structure
>pdb|3QE0|A Chain A, A Galpha-I1 P-Loop Mutation Prevents Transition To The Activated State Length = 325 Back     alignment and structure
>pdb|3D7M|A Chain A, Crystal Structure Of The G Protein Fast-Exchange Double Mutant I56cQ333C Length = 354 Back     alignment and structure
>pdb|1BH2|A Chain A, A326s Mutant Of An Inhibitory Alpha Subunit Length = 315 Back     alignment and structure
>pdb|1ZCB|A Chain A, Crystal Structure Of G Alpha 13 In Complex With Gdp Length = 362 Back     alignment and structure
>pdb|3CX7|A Chain A, Crystal Structure Of Pdzrhogef Rgrgs Domain In A Complex With Galpha-13 Bound To Gdp-Alf4 Length = 338 Back     alignment and structure
>pdb|3CX6|A Chain A, Crystal Structure Of Pdzrhogef Rgrgs Domain In A Complex With Galpha-13 Bound To Gdp Length = 338 Back     alignment and structure
>pdb|1ZCA|A Chain A, Crystal Structure Of G Alpha 12 In Complex With Gdp, Mg2+ And Alf4- Length = 359 Back     alignment and structure
>pdb|3V00|C Chain C, Studies Of A Constitutively Active G-Alpha Subunit Provide Insights Into The Mechanism Of G Protein Activation. Length = 356 Back     alignment and structure
>pdb|1FQJ|A Chain A, Crystal Structure Of The Heterotrimeric Complex Of The Rgs Domain Of Rgs9, The Gamma Subunit Of Phosphodiesterase And The GtI1 CHIMERA ALPHA SUBUNIT [(RGS9)-(Pdegamma)- (GtI1ALPHA)-(Gdp)-(Alf4-)-(Mg2+)] Length = 325 Back     alignment and structure
>pdb|1CS4|C Chain C, Complex Of Gs-Alpha With The Catalytic Domains Of Mammalian Adenylyl Cyclase: Complex With 2'-Deoxy-Adenosine 3'- Monophosphate, Pyrophosphate And Mg Length = 394 Back     alignment and structure
>pdb|1AZS|C Chain C, Complex Of Gs-Alpha With The Catalytic Domains Of Mammalian Adenylyl Cyclase Length = 402 Back     alignment and structure
>pdb|1CJK|C Chain C, Complex Of Gs-Alpha With The Catalytic Domains Of Mammalian Adenylyl Cyclase: Complex With Adenosine 5'-(Alpha Thio)-Triphosphate (Rp), Mg, And Mn Length = 402 Back     alignment and structure
>pdb|3SN6|A Chain A, Crystal Structure Of The Beta2 Adrenergic Receptor-Gs Protein Complex Length = 380 Back     alignment and structure
>pdb|1CUL|C Chain C, Complex Of Gs-Alpha With The Catalytic Domains Of Mammalian Adenylyl Cyclase: Complex With 2',5'-Dideoxy-Adenosine 3'- Triphosphate And Mg Length = 380 Back     alignment and structure
>pdb|1GOT|A Chain A, Heterotrimeric Complex Of A Gt-AlphaGI-Alpha Chimera And The Gt-Beta-Gamma Subunits Length = 350 Back     alignment and structure
>pdb|2BCJ|Q Chain Q, Crystal Structure Of G Protein-coupled Receptor Kinase 2 In Complex With Galpha-q And Gbetagamma Subunits Length = 353 Back     alignment and structure
>pdb|3AH8|A Chain A, Structure Of Heterotrimeric G Protein Galpha-Q Beta Gamma In Complex With An Inhibitor Ym-254890 Length = 355 Back     alignment and structure
>pdb|4GNK|A Chain A, Crystal Structure Of Galphaq In Complex With Full-length Human Plcbeta3 Length = 353 Back     alignment and structure
>pdb|3OHM|A Chain A, Crystal Structure Of Activated G Alpha Q Bound To Its Effector Phospholipase C Beta 3 Length = 327 Back     alignment and structure
>pdb|1TND|A Chain A, The 2.2 Angstroms Crystal Structure Of Transducin-Alpha Complexed With Gtp Gamma S Length = 324 Back     alignment and structure
>pdb|4FID|A Chain A, Crystal Structure Of A Heterotrimeric G-Protein Subunit From Entamoeba Histolytica, Ehg-Alpha-1 Length = 340 Back     alignment and structure
>pdb|4EKC|A Chain A, Structure Of Human Regulator Of G Protein Signaling 2 (rgs2) In Complex With Murine Galpha-q(r183c) Length = 347 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query819
2xtz_A354 Guanine nucleotide-binding protein alpha-1 subuni; 1e-42
1cip_A353 Protein (guanine nucleotide-binding protein alpha- 2e-39
1zcb_A362 G alpha I/13; GTP-binding, lipoprotein, membrane, 2e-38
1azs_C 402 GS-alpha; complex (lyase/hydrolase), hydrolase, si 2e-37
3ohm_A327 Guanine nucleotide-binding protein G(Q) subunit A; 4e-36
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-04
>2xtz_A Guanine nucleotide-binding protein alpha-1 subuni; hydrolase, G-protein signaling, SELF-activation, RAS-like DO; HET: GSP; 2.34A {Arabidopsis thaliana} Length = 354 Back     alignment and structure
 Score =  157 bits (399), Expect = 1e-42
 Identities = 74/285 (25%), Positives = 126/285 (44%), Gaps = 43/285 (15%)

Query: 531 LQKLLLVGCSGSGTSTIFKQAKILYKAVPFSDDEHENIKLKIQSNAYGYLGILLEGRERF 590
           ++KLLL+G   SG STIFKQ K+L++   F + E ++    I +N Y  + +L +G + F
Sbjct: 9   IRKLLLLGAGESGKSTIFKQIKLLFQ-TGFDEGELKSYVPVIHANVYQTIKLLHDGTKEF 67

Query: 591 EEEILGEKRKKQSSDETNPVGSSDSTDGKTIYTIGPRLKAFSDWLLKTMVSGNLEAIFPA 650
            +      +   SS+                               + +        +P 
Sbjct: 68  AQNETDSAKYMLSSESIAIG--------------------------EKLSEIGGRLDYPR 101

Query: 651 ATREYSPLVEELWKDAAIQATYSRRSELEMLSSVASYFLERVVDISRTDYEPSDLDILYA 710
            T++ +  +E LWKD AIQ T +R +EL++      Y +E +  +S  +Y P+  D+LYA
Sbjct: 102 LTKDIAEGIETLWKDPAIQETCARGNELQVPDC-TKYLMENLKRLSDINYIPTKEDVLYA 160

Query: 711 EGVTSSNGLACVDFSFPRSASDDSVDTADQHDSLLRYQLIRVQARGLGENCKWLEMFEDI 770
              T   G+  + FS             +   S   Y+L  V      E  KW+ +FE +
Sbjct: 161 RVRT--TGVVEIQFSPV----------GENKKSGEVYRLFDV-GGQRNERRKWIHLFEGV 207

Query: 771 GMVIFCVALSDYDQFSVDGNGSLMNKMMLSRKFFESIVTIQLLIR 815
             VIFC A+S+YDQ   +      N+MM +++ F+ ++      +
Sbjct: 208 TAVIFCAAISEYDQTLFEDEQ--KNRMMETKELFDWVLKQPCFEK 250
>1cip_A Protein (guanine nucleotide-binding protein alpha-1 subunit); GTPase, hydrolase; HET: GNP; 1.50A {Rattus norvegicus} SCOP: a.66.1.1 c.37.1.8 PDB: 1agr_A* 1bof_A* 1gdd_A* 1gfi_A* 1gia_A* 1gp2_A* 3ffa_A* 3ffb_A* 1gg2_A* 1git_A* 1svs_A* 1svk_A* 2zjz_A* 2zjy_A* 3ums_A* 2pz2_A* 2pz3_A* 1as0_A* 1as2_A* 1as3_A* ... Length = 353 Back     alignment and structure
>1zcb_A G alpha I/13; GTP-binding, lipoprotein, membrane, transducer, signaling PR; HET: GDP; 2.00A {Mus musculus} SCOP: a.66.1.1 c.37.1.8 PDB: 3ab3_A* 3cx8_A* 3cx7_A* 3cx6_A* 1zca_A* Length = 362 Back     alignment and structure
>1azs_C GS-alpha; complex (lyase/hydrolase), hydrolase, signal transducing protein, cyclase, effector enzyme; HET: GSP FKP; 2.30A {Bos taurus} SCOP: a.66.1.1 c.37.1.8 PDB: 1azt_A* 3c14_C* 3c15_C* 3c16_C* 1cjt_C* 1cjk_C* 1cju_C* 1cjv_C* 1tl7_C* 1cs4_C* 1u0h_C* 2gvd_C* 2gvz_C* 3e8a_C* 3g82_C* 3maa_C* 1cul_C* 3sn6_A* Length = 402 Back     alignment and structure
>3ohm_A Guanine nucleotide-binding protein G(Q) subunit A; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Mus musculus} PDB: 2bcj_Q* 2rgn_A* 3ah8_A* Length = 327 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query819
1cip_A353 Protein (guanine nucleotide-binding protein alpha- 100.0
3ohm_A327 Guanine nucleotide-binding protein G(Q) subunit A; 100.0
1azs_C 402 GS-alpha; complex (lyase/hydrolase), hydrolase, si 100.0
1zcb_A362 G alpha I/13; GTP-binding, lipoprotein, membrane, 100.0
4fid_A 340 G protein alpha subunit; RAS-like domain, all-heli 100.0
2xtz_A354 Guanine nucleotide-binding protein alpha-1 subuni; 100.0
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 97.25
3l82_B227 F-box only protein 4; TRFH domain, helix, GTPase d 96.48
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 96.46
2x77_A189 ADP-ribosylation factor; GTP-binding protein, smal 96.29
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 96.14
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 96.09
2h57_A190 ADP-ribosylation factor-like protein 6; GTP, GTPas 96.08
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 96.05
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 96.0
4bas_A199 ADP-ribosylation factor, putative (small GTPase, p 95.94
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 95.87
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 95.86
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 95.84
3l2o_B312 F-box only protein 4; small G protein fold, UBL co 95.78
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 95.76
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 95.72
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 95.35
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 95.12
3t1o_A198 Gliding protein MGLA; G domain containing protein, 95.07
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 93.78
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 93.45
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 93.41
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 93.24
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 93.08
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 93.07
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 93.07
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 93.06
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 93.02
3o47_A329 ADP-ribosylation factor GTPase-activating protein 92.99
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 92.96
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 92.93
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 92.92
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 92.91
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 92.83
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 92.83
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 92.83
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 92.76
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 92.75
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 92.74
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 92.71
2o52_A200 RAS-related protein RAB-4B; G-protein, GDP, struct 92.69
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 92.68
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 92.65
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 92.6
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 92.55
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 92.5
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 92.46
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 92.38
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 92.35
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 92.34
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 92.33
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 92.3
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 92.28
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 92.28
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 92.27
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 92.2
2wji_A165 Ferrous iron transport protein B homolog; membrane 92.17
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 92.16
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 92.15
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 92.13
2ged_A193 SR-beta, signal recognition particle receptor beta 92.11
2fh5_B214 SR-beta, signal recognition particle receptor beta 92.09
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 92.07
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 92.05
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 92.04
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 91.99
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 91.99
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 91.98
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 91.92
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 91.91
2hf9_A226 Probable hydrogenase nickel incorporation protein 91.91
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 91.89
2j0v_A212 RAC-like GTP-binding protein ARAC7; nucleotide-bin 91.87
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 91.87
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 91.87
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 91.84
2q3h_A201 RAS homolog gene family, member U; GTPase, structu 91.81
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 91.8
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 91.79
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 91.78
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 91.78
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 91.75
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 91.74
3t1o_A198 Gliding protein MGLA; G domain containing protein, 91.73
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 91.71
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 91.7
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 91.68
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 91.68
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 91.65
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 91.52
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 91.48
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 91.4
2atx_A194 Small GTP binding protein TC10; GTPase, P-loop, al 91.36
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 91.35
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 91.35
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 91.34
3llu_A196 RAS-related GTP-binding protein C; structural geno 91.34
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 91.31
1nrj_B218 SR-beta, signal recognition particle receptor beta 91.26
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 91.26
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 91.26
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 91.25
1gwn_A205 RHO-related GTP-binding protein RHOE; GTPase, inac 91.25
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 91.24
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 91.2
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 91.2
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 91.16
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 91.14
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 91.13
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 91.09
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 91.07
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 91.02
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 91.02
2f7s_A217 C25KG, RAS-related protein RAB-27B; G-protein, str 91.01
2hup_A201 RAS-related protein RAB-43; G-protein, GDP, struct 90.99
2q3h_A201 RAS homolog gene family, member U; GTPase, structu 90.99
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 90.98
2h57_A190 ADP-ribosylation factor-like protein 6; GTP, GTPas 90.9
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 90.88
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 90.86
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 90.83
4a74_A231 DNA repair and recombination protein RADA; hydrola 90.82
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 90.79
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 90.79
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 90.78
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 90.75
4gzl_A204 RAS-related C3 botulinum toxin substrate 1; rossma 90.74
1kag_A173 SKI, shikimate kinase I; transferase, structural g 90.65
2j1l_A214 RHO-related GTP-binding protein RHOD; GTPase, memb 90.62
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 90.58
2f7s_A217 C25KG, RAS-related protein RAB-27B; G-protein, str 90.51
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 90.46
2x77_A189 ADP-ribosylation factor; GTP-binding protein, smal 90.45
2fu5_C183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 90.41
3llu_A196 RAS-related GTP-binding protein C; structural geno 90.29
3q3j_B214 RHO-related GTP-binding protein RHO6; RAS-binding 90.28
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 90.26
3lxx_A239 GTPase IMAP family member 4; structural genomics c 90.23
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 90.22
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 90.16
4bas_A199 ADP-ribosylation factor, putative (small GTPase, p 90.15
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 90.15
2atx_A194 Small GTP binding protein TC10; GTPase, P-loop, al 90.09
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 90.09
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 89.98
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 89.95
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 89.9
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 89.76
2cjw_A192 GTP-binding protein GEM; nucleotide-binding, small 89.74
2j0v_A212 RAC-like GTP-binding protein ARAC7; nucleotide-bin 89.72
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 89.65
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 89.6
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 89.59
2yc2_C208 IFT27, small RAB-related GTPase; transport protein 89.57
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 89.55
2fu5_C183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 89.51
2gco_A201 H9, RHO-related GTP-binding protein RHOC; GTPase,s 89.51
2fv8_A207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 89.49
3cph_A213 RAS-related protein SEC4; RAB GTPase, prenylation, 89.46
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 89.4
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 89.37
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 89.32
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 89.25
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 89.24
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 89.23
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 89.21
2yc2_C208 IFT27, small RAB-related GTPase; transport protein 89.14
3th5_A204 RAS-related C3 botulinum toxin substrate 1; rossma 88.7
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 89.06
2g3y_A211 GTP-binding protein GEM; small GTPase, GDP, inacti 89.01
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 89.0
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 88.94
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 88.84
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 88.84
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 88.82
4dkx_A216 RAS-related protein RAB-6A; GTP binding fold, memb 88.81
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 88.69
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 88.67
3gj0_A221 GTP-binding nuclear protein RAN; G protein, GDP, a 88.65
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 88.62
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 88.57
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 88.48
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 88.39
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 88.35
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 88.28
4djt_A218 GTP-binding nuclear protein GSP1; structural genom 88.27
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 88.26
2qu8_A228 Putative nucleolar GTP-binding protein 1; GTPase, 88.23
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 88.12
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 88.08
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 88.06
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 88.06
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 88.02
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 87.99
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 87.98
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 87.91
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 87.89
2qnr_A301 Septin-2, protein NEDD5; structural genomics conso 87.88
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 87.87
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 87.78
3cpj_B223 GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl 87.77
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 87.76
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 87.74
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 87.7
3vaa_A199 Shikimate kinase, SK; structural genomics, center 87.67
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 87.66
3sop_A270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 87.66
1via_A175 Shikimate kinase; structural genomics, transferase 87.63
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 87.63
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 87.58
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 87.53
3k53_A271 Ferrous iron transport protein B; GTPase fold, hel 87.47
3t5d_A274 Septin-7; GTP-binding protein, cytoskeleton, signa 87.45
3q3j_B214 RHO-related GTP-binding protein RHO6; RAS-binding 87.44
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 87.19
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 87.13
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 87.09
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 87.03
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 87.01
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 86.99
3cpj_B223 GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl 86.99
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 86.98
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 86.94
3cph_A213 RAS-related protein SEC4; RAB GTPase, prenylation, 86.93
3a1s_A258 Iron(II) transport protein B; FEOB, iron transport 86.93
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 86.91
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 86.82
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 86.81
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 86.78
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 86.73
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 86.72
4dhe_A223 Probable GTP-binding protein ENGB; melioidosis, RA 86.65
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 86.63
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 86.6
3lxw_A247 GTPase IMAP family member 1; immunity, structural 86.59
2eyu_A261 Twitching motility protein PILT; pilus retraction 86.55
2fh5_B214 SR-beta, signal recognition particle receptor beta 86.54
1lw7_A365 Transcriptional regulator NADR; NMN, NMN adenylyl 86.53
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 86.51
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 86.5
1ji0_A240 ABC transporter; ATP binding protein, structural g 86.48
2cvh_A220 DNA repair and recombination protein RADB; filamen 86.46
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 86.42
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 86.42
2wkq_A332 NPH1-1, RAS-related C3 botulinum toxin substrate 1 86.39
1sgw_A214 Putative ABC transporter; structural genomics, P p 86.39
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 86.31
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 86.29
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 86.27
1g6h_A257 High-affinity branched-chain amino acid transport 86.27
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 86.27
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 86.23
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 86.19
2xtp_A260 GTPase IMAP family member 2; immune system, G prot 86.16
3l0i_B199 RAS-related protein RAB-1A; GEF-GDF-RAB complex, G 86.07
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 86.06
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 86.04
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 86.01
1b0u_A262 Histidine permease; ABC transporter, transport pro 85.97
3kta_A182 Chromosome segregation protein SMC; structural mai 85.87
3tlx_A243 Adenylate kinase 2; structural genomics, structura 85.74
3def_A262 T7I23.11 protein; chloroplast, TOC33, GTPase, hydr 85.72
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 85.68
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 85.67
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 85.65
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 85.61
2ghi_A260 Transport protein; multidrug resistance protein, M 85.57
3b1v_A272 Ferrous iron uptake transporter protein B; G prote 85.56
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 85.52
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 85.49
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 85.49
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 85.48
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 85.47
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 85.47
2hup_A201 RAS-related protein RAB-43; G-protein, GDP, struct 85.41
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 85.37
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 85.32
1h65_A270 Chloroplast outer envelope protein OEP34; GTPase, 85.25
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 85.24
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 85.22
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 85.22
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 85.21
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 85.2
2fv8_A207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 85.18
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 85.17
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 85.11
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 85.09
2vli_A183 Antibiotic resistance protein; transferase, tunica 85.07
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 85.06
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 85.06
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 84.97
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 84.94
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 84.83
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 84.81
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 84.8
1gwn_A205 RHO-related GTP-binding protein RHOE; GTPase, inac 84.79
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 84.74
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 84.71
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 84.71
3r7w_A307 Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT 84.7
2gco_A201 H9, RHO-related GTP-binding protein RHOC; GTPase,s 84.58
3l0i_B199 RAS-related protein RAB-1A; GEF-GDF-RAB complex, G 84.55
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 84.39
3r7w_A 307 Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT 84.26
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 84.18
1vfy_A73 Phosphatidylinositol-3-phosphate binding FYVE doma 84.14
2qag_A361 Septin-2, protein NEDD5; cell cycle, cell division 84.14
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 84.11
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 84.09
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 84.08
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 84.08
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 84.08
4gzl_A204 RAS-related C3 botulinum toxin substrate 1; rossma 84.03
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 83.98
2wkq_A332 NPH1-1, RAS-related C3 botulinum toxin substrate 1 83.92
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 83.86
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 83.82
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 83.79
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 83.77
3bos_A242 Putative DNA replication factor; P-loop containing 83.71
3r7w_B 331 Gtpase2, GTP-binding protein GTR2; RAG gtpases, GT 83.69
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 83.68
3gj0_A221 GTP-binding nuclear protein RAN; G protein, GDP, a 83.65
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 83.64
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 83.61
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 83.55
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 83.4
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 83.4
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 83.38
2ged_A193 SR-beta, signal recognition particle receptor beta 83.38
3c5h_A255 Glucocorticoid receptor DNA-binding factor 1; RAS, 83.37
3i8s_A274 Ferrous iron transport protein B; GTPase, GPCR, ir 83.31
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 83.28
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 83.17
3o47_A329 ADP-ribosylation factor GTPase-activating protein 83.06
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 83.02
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 82.88
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 82.82
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 82.77
1z2q_A84 LM5-1; membrane protein, FYVE domain, zinc-finger; 82.69
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 82.65
4dkx_A216 RAS-related protein RAB-6A; GTP binding fold, memb 82.49
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 82.25
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 82.2
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 82.14
4djt_A218 GTP-binding nuclear protein GSP1; structural genom 82.12
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 82.04
3iby_A256 Ferrous iron transport protein B; G protein, G dom 82.04
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 82.03
1nrj_B218 SR-beta, signal recognition particle receptor beta 82.02
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 81.97
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 81.92
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 81.9
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 81.84
1dvp_A220 HRS, hepatocyte growth factor-regulated tyrosine k 81.83
2qag_C418 Septin-7; cell cycle, cell division, GTP-binding, 81.78
2j1l_A214 RHO-related GTP-binding protein RHOD; GTPase, memb 81.59
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 81.59
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 81.57
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 81.56
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 81.44
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 81.41
1tf7_A 525 KAIC; homohexamer, hexamer, circadian clock protei 81.36
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 81.25
3fvq_A359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 81.24
1z47_A355 CYSA, putative ABC-transporter ATP-binding protein 81.11
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 80.94
2o52_A200 RAS-related protein RAB-4B; G-protein, GDP, struct 80.82
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P- 80.74
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 80.71
2yyz_A359 Sugar ABC transporter, ATP-binding protein; sugar 80.68
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 80.6
2ro1_A189 Transcription intermediary factor 1-beta; KAP, TIF 80.55
2kjq_A149 DNAA-related protein; solution structure, NESG, st 80.49
1r5b_A 467 Eukaryotic peptide chain release factor GTP-bindi 80.46
1g29_1372 MALK, maltose transport protein MALK; ATPase, acti 80.42
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 80.42
1f2t_A149 RAD50 ABC-ATPase; DNA double-strand break repair, 80.41
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 80.36
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 80.27
2obl_A347 ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O 80.25
1v43_A372 Sugar-binding transport ATP-binding protein; ATPas 80.23
2it1_A362 362AA long hypothetical maltose/maltodextrin trans 80.12
>1cip_A Protein (guanine nucleotide-binding protein alpha-1 subunit); GTPase, hydrolase; HET: GNP; 1.50A {Rattus norvegicus} SCOP: a.66.1.1 c.37.1.8 PDB: 1agr_A* 1bof_A* 1gdd_A* 1gfi_A* 1gia_A* 1gp2_A* 3ffa_A* 3ffb_A* 1gg2_A* 1git_A* 1svs_A* 1svk_A* 2zjz_A* 2zjy_A* 3ums_A* 2pz2_A* 2pz3_A* 1as0_A* 1as2_A* 1as3_A* ... Back     alignment and structure
Probab=100.00  E-value=8.3e-58  Score=492.38  Aligned_cols=255  Identities=30%  Similarity=0.482  Sum_probs=206.4

Q ss_pred             CCcccccccccccCch-hHHHhcceeeEEEeecCCCCchhHHHHHHHHhcCCCCCHHHhhhhHHHHHHHHHHHHHHHHhh
Q 003444          508 NPGAEQGSGLMSRSVP-DYIERRTLQKLLLVGCSGSGTSTIFKQAKILYKAVPFSDDEHENIKLKIQSNAYGYLGILLEG  586 (819)
Q Consensus       508 ~~~a~~~S~~IDr~L~-dk~~~k~~vKLLLLGaGESGKSTIlKQMKILy~p~GFS~eEr~~~K~iIqsNIi~sm~iLLea  586 (819)
                      ..+++++|++||++|+ ++++.++++||||||+||||||||+|||||||+ +||+++|++.||.+||.|++++|+.||++
T Consensus         8 ~~~~~~~s~~id~~l~~~~~~~~~~~klLlLG~geSGKST~~KQmkii~~-~g~~~~e~~~~~~~i~~N~~~~~~~l~~~   86 (353)
T 1cip_A            8 DKAAVERSKMIDRNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHE-AGYSEEECKQYKAVVYSNTIQSIIAIIRA   86 (353)
T ss_dssp             -----------------------CEEEEEEECSTTSSHHHHHHHHHHHHS-CCCCHHHHHHTHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHhHHhhcccceEEEEcCCCCCchhHHHHHHHhhC-CCCCHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            4467789999999998 888999999999999999999999999999999 89999999999999999999999999999


Q ss_pred             hccchhhHHHhhhhcCCCCCCCCCCCCCCCCCcceeccchhhHHhHHHHHhhhhcCCccccCcccchhHHHHHHHHhcCH
Q 003444          587 RERFEEEILGEKRKKQSSDETNPVGSSDSTDGKTIYTIGPRLKAFSDWLLKTMVSGNLEAIFPAATREYSPLVEELWKDA  666 (819)
Q Consensus       587 ~e~fe~e~l~e~r~~~spde~~~~g~~~~~~~~~Iysi~~rlk~fsdwll~~~~~g~ld~~fp~~t~E~A~aI~eLWkDp  666 (819)
                      |+.++++.                +++             .++..+++++......+ +.   .++.+++++|..||+||
T Consensus        87 ~~~~~i~~----------------~~~-------------~~~~~~~~~~~~~~~~~-~~---~~~~~~~~~i~~lw~d~  133 (353)
T 1cip_A           87 MGRLKIDF----------------GDA-------------ARADDARQLFVLAGAAE-EG---FMTAELAGVIKRLWKDS  133 (353)
T ss_dssp             HHHHTCCC----------------SST-------------THHHHHHHHHHHHHHHT-TT---CCCHHHHHHHHHHHHCH
T ss_pred             HHHhCCCC----------------CCc-------------chHHHHHHHHhhccccc-cc---cCCHHHHHHHHHHHCCH
Confidence            99876542                111             12334555555432111 11   24579999999999999


Q ss_pred             HHHHHHhcccchhhcccchhhhhhcccccccCCCCCCccceeeeecccccCCeeEEEEEcCCCCCCCCcccccccccccc
Q 003444          667 AIQATYSRRSELEMLSSVASYFLERVVDISRTDYEPSDLDILYAEGVTSSNGLACVDFSFPRSASDDSVDTADQHDSLLR  746 (819)
Q Consensus       667 gIQ~~y~RRnEfq~LpDSA~YFLdnIdRIaspDYvPTdqDILraR~kT~stGItE~eF~~~~~~~~~~~D~ggqr~~~l~  746 (819)
                      +||+||.||+||+ |+|+|.|||++++||+.++|+||++|||++|.+|  +||.+..|.++.                ++
T Consensus       134 ~iq~~~~~~~e~~-l~dsa~yfl~~~~ri~~~~Y~PT~~Dil~~~~~T--~Gi~~~~~~~~~----------------~~  194 (353)
T 1cip_A          134 GVQACFNRSREYQ-LNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVKT--TGIVETHFTFKD----------------LH  194 (353)
T ss_dssp             HHHHHHTTGGGSC-CCTTHHHHHTTHHHHTSTTCCCCHHHHHTCCCCC--CSEEEEEEEETT----------------EE
T ss_pred             HHHHHHHhhhhcc-cCccHHHHHHHHHHHhcCCCCCCccccccccCce--eceEEEEEeeCC----------------ee
Confidence            9999999999999 8999999999999999999999999999999998  699999998865                78


Q ss_pred             EEEEEecccccccccccccccCCCCEEEEEEeCCCccccc-ccCCCCccchHHHHHHHHHHHhccccccCCCCC
Q 003444          747 YQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSDYDQFS-VDGNGSLMNKMMLSRKFFESIVTIQLLIRWNFF  819 (819)
Q Consensus       747 frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSdYDQ~l-ED~~G~~~NRM~ESL~LFEsI~nnp~F~~t~f~  819 (819)
                      +++||+||| +++|++|.+||+++++||||+|+++|||++ ||.   ..|||++++.+|++|++++||.++|+|
T Consensus       195 l~iwDt~GQ-e~~r~~w~~yf~~a~~iIfV~dls~~d~~l~ed~---~~nr~~e~~~~~~~i~~~~~~~~~pii  264 (353)
T 1cip_A          195 FKMFDVGGQ-RSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDE---EMNRMHESMKLFDSICNNKWFTDTSII  264 (353)
T ss_dssp             EEEEEECCS-GGGGGGGGGGCTTCSEEEEEEEGGGGGCEETTEE---EEEHHHHHHHHHHHHHTCGGGTTSEEE
T ss_pred             EEEEeCCCc-hhhhHHHHHHHhcCCEEEEEEECccccccccccc---hhhhHHHHHHHHHHHHcCccccCCcEE
Confidence            999999999 899999999999999999999999999995 555   799999999999999999999999875
>3ohm_A Guanine nucleotide-binding protein G(Q) subunit A; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Mus musculus} PDB: 2bcj_Q* 2rgn_A* 3ah8_A* Back     alignment and structure
>1azs_C GS-alpha; complex (lyase/hydrolase), hydrolase, signal transducing protein, cyclase, effector enzyme; HET: GSP FKP; 2.30A {Bos taurus} SCOP: a.66.1.1 c.37.1.8 PDB: 1azt_A* 3c14_C* 3c15_C* 3c16_C* 1cjt_C* 1cjk_C* 1cju_C* 1cjv_C* 1tl7_C* 1cs4_C* 1u0h_C* 2gvd_C* 2gvz_C* 3e8a_C* 3g82_C* 3maa_C* 1cul_C* 3sn6_A* Back     alignment and structure
>1zcb_A G alpha I/13; GTP-binding, lipoprotein, membrane, transducer, signaling PR; HET: GDP; 2.00A {Mus musculus} SCOP: a.66.1.1 c.37.1.8 PDB: 3ab3_A* 3cx8_A* 3cx7_A* 3cx6_A* 1zca_A* Back     alignment and structure
>4fid_A G protein alpha subunit; RAS-like domain, all-helical domain, GTP binding, nucleotide signaling protein, transducer, lipoprotein; HET: MLY MSE GDP; 2.62A {Entamoeba histolytica} Back     alignment and structure
>2xtz_A Guanine nucleotide-binding protein alpha-1 subuni; hydrolase, G-protein signaling, SELF-activation, RAS-like DO; HET: GSP; 2.34A {Arabidopsis thaliana} Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>3l82_B F-box only protein 4; TRFH domain, helix, GTPase domain, acetylation, ADP- ribosylation, alternative splicing, cell cycle, cell division; 2.40A {Homo sapiens} Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Back     alignment and structure
>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Back     alignment and structure
>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Back     alignment and structure
>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C Back     alignment and structure
>3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>4dkx_A RAS-related protein RAB-6A; GTP binding fold, membrane trafficking, GTP, cytosol, protei transport; HET: GDP; 1.90A {Homo sapiens} PDB: 3bbp_A* Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} SCOP: c.37.1.8 PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 4gmx_A* 4gpt_A* 4hat_A* 4hau_A* 4hav_A* 4haw_A* ... Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Back     alignment and structure
>3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A* Back     alignment and structure
>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A Back     alignment and structure
>3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_A* Back     alignment and structure
>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Back     alignment and structure
>3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_A* Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>1vfy_A Phosphatidylinositol-3-phosphate binding FYVE domain of protein VPS27; endosome maturation, intracellular trafficking; 1.15A {Saccharomyces cerevisiae} SCOP: g.50.1.1 Back     alignment and structure
>2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>3r7w_B Gtpase2, GTP-binding protein GTR2; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_B* Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} SCOP: c.37.1.8 PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 4gmx_A* 4gpt_A* 4hat_A* 4hau_A* 4hav_A* 4haw_A* ... Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3c5h_A Glucocorticoid receptor DNA-binding factor 1; RAS, GTPase, glucorticoid receptor, structural genomics consortium, SGC, alternative splicing; HET: GNP; 1.80A {Homo sapiens} Back     alignment and structure
>3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>1z2q_A LM5-1; membrane protein, FYVE domain, zinc-finger; NMR {Leishmania major} Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>4dkx_A RAS-related protein RAB-6A; GTP binding fold, membrane trafficking, GTP, cytosol, protei transport; HET: GDP; 1.90A {Homo sapiens} PDB: 3bbp_A* Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>1dvp_A HRS, hepatocyte growth factor-regulated tyrosine kinase substrate; VHS, FYVE, zinc finger, superhelix, transferase; HET: CIT; 2.00A {Drosophila melanogaster} SCOP: a.118.9.2 g.50.1.1 Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>1r5b_A Eukaryotic peptide chain release factor GTP-bindi subunit; translation termination, peptide release, GTPase, translatio; 2.35A {Schizosaccharomyces pombe} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1r5n_A* 1r5o_A* 3e20_A Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 819
d1zcba1126 a.66.1.1 (A:76-201) Transducin (alpha subunit), in 5e-19
d1zcaa1122 a.66.1.1 (A:83-204) Transducin (alpha subunit), in 2e-17
d1cipa1121 a.66.1.1 (A:61-181) Transducin (alpha subunit), in 6e-16
d1tada1121 a.66.1.1 (A:57-177) Transducin (alpha subunit), in 3e-15
d1azta1114 a.66.1.1 (A:88-201) Transducin (alpha subunit), in 1e-13
d2bcjq1117 a.66.1.1 (Q:67-183) Transducin (alpha subunit), in 6e-13
>d1zcba1 a.66.1.1 (A:76-201) Transducin (alpha subunit), insertion domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 126 Back     information, alignment and structure

class: All alpha proteins
fold: Transducin (alpha subunit), insertion domain
superfamily: Transducin (alpha subunit), insertion domain
family: Transducin (alpha subunit), insertion domain
domain: Transducin (alpha subunit), insertion domain
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 81.5 bits (201), Expect = 5e-19
 Identities = 36/151 (23%), Positives = 57/151 (37%), Gaps = 27/151 (17%)

Query: 560 FSDDEHENIKLKIQSNAYGYLGILLEGRERFEEEILGEKRKKQSSDETNPVGSSDSTDGK 619
           F     E  +  I SN    + +L++ RE+        K +                 G 
Sbjct: 1   FDQRAREEFRPTIYSNVIKGMRVLVDAREKLHIPWGDNKNQL---------------HGD 45

Query: 620 TIYTIGPRLKAFSDWLLKTMVSGNLEAIFPAATREYSPLVEELWKDAAIQATYSRRSELE 679
            +     R    +  +++T V             +Y P +  LW+D+ IQ  Y RR E +
Sbjct: 46  KLMAFDTRAPMAAQGMVETRV-----------FLQYLPAIRALWEDSGIQNAYDRRREFQ 94

Query: 680 MLSSVASYFLERVVDISRTDYEPSDLDILYA 710
           +  S   YFL+ +  +   DY PS  DIL A
Sbjct: 95  LGES-VKYFLDNLDKLGVPDYIPSQQDILLA 124
>d1zcaa1 a.66.1.1 (A:83-204) Transducin (alpha subunit), insertion domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 122 Back     information, alignment and structure
>d1cipa1 a.66.1.1 (A:61-181) Transducin (alpha subunit), insertion domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 121 Back     information, alignment and structure
>d1tada1 a.66.1.1 (A:57-177) Transducin (alpha subunit), insertion domain {Cow (Bos taurus) [TaxId: 9913]} Length = 121 Back     information, alignment and structure
>d1azta1 a.66.1.1 (A:88-201) Transducin (alpha subunit), insertion domain {Cow (Bos taurus) [TaxId: 9913]} Length = 114 Back     information, alignment and structure
>d2bcjq1 a.66.1.1 (Q:67-183) Transducin (alpha subunit), insertion domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 117 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query819
d1tada1121 Transducin (alpha subunit), insertion domain {Cow 99.94
d1cipa1121 Transducin (alpha subunit), insertion domain {Rat 99.94
d1zcaa1122 Transducin (alpha subunit), insertion domain {Mous 99.94
d2bcjq1117 Transducin (alpha subunit), insertion domain {Mous 99.93
d1zcba1126 Transducin (alpha subunit), insertion domain {Mous 99.93
d1azta1114 Transducin (alpha subunit), insertion domain {Cow 99.89
d1azta2 221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 99.67
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 99.42
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 99.2
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 99.16
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 97.05
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 96.84
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 96.69
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 96.47
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 95.8
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 95.42
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 95.26
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 95.21
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 94.99
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 94.77
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 94.7
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 94.5
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 94.47
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 94.35
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 94.28
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 94.09
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 93.82
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 93.81
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 93.77
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 93.71
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 93.65
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 93.61
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 93.59
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 93.56
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 93.48
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 93.46
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 93.46
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 93.37
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 93.32
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 93.3
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 93.14
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 93.12
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 93.12
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 93.12
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 93.09
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 92.92
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 92.79
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 92.77
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 92.76
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 92.61
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 92.6
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 92.6
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 92.59
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 92.58
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 92.56
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 92.55
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 92.43
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 92.43
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 92.27
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 92.2
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 92.2
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 92.14
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 92.12
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 92.09
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 92.07
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 92.04
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 91.93
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 91.91
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 91.9
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 91.71
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 91.7
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 91.69
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 91.65
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 91.59
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 91.5
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 91.44
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 91.43
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 91.42
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 91.41
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 91.39
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 91.38
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 91.35
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 91.33
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 91.23
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 91.22
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 91.21
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 91.18
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 90.81
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 90.76
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 90.72
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 90.72
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 90.67
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 90.6
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 90.5
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 90.49
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 90.42
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 90.35
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 90.32
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 90.31
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 90.29
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 90.24
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 90.12
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 89.94
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 89.63
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 89.46
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 89.41
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 89.34
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 89.23
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 88.88
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 88.81
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 88.75
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 88.63
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 88.63
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 88.61
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 88.44
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 88.26
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 87.86
d2fh5b1207 Signal recognition particle receptor beta-subunit 87.85
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 87.73
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 87.6
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 87.55
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 86.98
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 86.88
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 86.8
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 86.49
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 86.42
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 86.39
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 86.39
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 86.27
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 86.05
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 86.02
d1nrjb_209 Signal recognition particle receptor beta-subunit 85.99
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 85.91
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 85.74
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 85.52
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 85.51
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 85.39
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 85.1
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 85.07
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 84.83
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 84.65
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 84.56
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 84.5
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 84.47
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 84.37
d2awna2232 Maltose transport protein MalK, N-terminal domain 84.08
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 83.85
d1dvpa272 Hrs {Fruit fly (Drosophila melanogaster) [TaxId: 7 83.81
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 83.78
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 83.77
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 83.75
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 83.64
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 83.54
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 83.44
d1zunb3222 Sulfate adenylate transferase subunit cysN/C, EF-T 83.44
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 83.19
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 83.04
d2hyda1255 Putative multidrug export ATP-binding/permease pro 82.89
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 82.62
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 82.48
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 82.29
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 82.12
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 82.11
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 81.9
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 81.78
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 81.77
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 81.7
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 81.68
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 81.58
d1g2912240 Maltose transport protein MalK, N-terminal domain 81.44
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 80.15
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 80.14
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 80.12
>d1tada1 a.66.1.1 (A:57-177) Transducin (alpha subunit), insertion domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
class: All alpha proteins
fold: Transducin (alpha subunit), insertion domain
superfamily: Transducin (alpha subunit), insertion domain
family: Transducin (alpha subunit), insertion domain
domain: Transducin (alpha subunit), insertion domain
species: Cow (Bos taurus) [TaxId: 9913]

Probab=99.94  E-value=3e-28  Score=224.99  Aligned_cols=121  Identities=24%  Similarity=0.365  Sum_probs=98.0

Q ss_pred             CCHHHhhhhHHHHHHHHHHHHHHHHhhhccchhhHHHhhhhcCCCCCCCCCCCCCCCCCcceeccchhhHHhHHHHHhhh
Q 003444          560 FSDDEHENIKLKIQSNAYGYLGILLEGRERFEEEILGEKRKKQSSDETNPVGSSDSTDGKTIYTIGPRLKAFSDWLLKTM  639 (819)
Q Consensus       560 FS~eEr~~~K~iIqsNIi~sm~iLLea~e~fe~e~l~e~r~~~spde~~~~g~~~~~~~~~Iysi~~rlk~fsdwll~~~  639 (819)
                      ||++|+..||++||.||+.+|+.||++|+.++++.                +++.             .+..++-++...
T Consensus         1 Fs~eE~~~~~~~I~~Nii~~m~~li~a~~~l~i~~----------------~~~~-------------~~~~~~~i~~~~   51 (121)
T d1tada1           1 YSLEECLEFIAIIYGNTLQSILAIVRAMTTLNIQY----------------GDSA-------------RQDDARKLMHMA   51 (121)
T ss_dssp             CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCCC----------------SSTT-------------HHHHHHHHHHHH
T ss_pred             CCHHHHHHhHHHHHHHHHHHHHHHHHHHHHcCCCC----------------CCch-------------HHHHHHHHHHhh
Confidence            89999999999999999999999999999887642                1111             111222222221


Q ss_pred             hcCCccccCcccchhHHHHHHHHhcCHHHHHHHhcccchhhcccchhhhhhcccccccCCCCCCccceeeeeccc
Q 003444          640 VSGNLEAIFPAATREYSPLVEELWKDAAIQATYSRRSELEMLSSVASYFLERVVDISRTDYEPSDLDILYAEGVT  714 (819)
Q Consensus       640 ~~g~ld~~fp~~t~E~A~aI~eLWkDpgIQ~~y~RRnEfq~LpDSA~YFLdnIdRIaspDYvPTdqDILraR~kT  714 (819)
                      ...+ +   +.++.+++++|.+||+|++||+||+||+||+ |+|||.|||++|+||++|+|+||++||||+|++|
T Consensus        52 ~~~~-~---~~~~~e~~~~i~~LW~D~~iq~~~~r~~ef~-L~Dsa~YF~~~l~RI~~~~Y~PT~qDiLr~R~~T  121 (121)
T d1tada1          52 DTIE-E---GTMPKEMSDIIQRLWKDSGIQACFDRASEYQ-LNDSAGYYLSDLERLVTPGYVPTEQDVLRSRVKT  121 (121)
T ss_dssp             HHSC-T---TCCCHHHHHHHHHHHHCHHHHHHHHTGGGSC-CCTTHHHHHTTHHHHTSTTCCCCHHHHHHCCCCC
T ss_pred             cccc-C---CCCCHHHHHHHHHHhCCHHHHHHHHhhhccc-cCcchHHHHHHHHHHcCCCCCCCHHHHhhhcCCC
Confidence            1111 1   2356799999999999999999999999999 8999999999999999999999999999999987
>d1cipa1 a.66.1.1 (A:61-181) Transducin (alpha subunit), insertion domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1zcaa1 a.66.1.1 (A:83-204) Transducin (alpha subunit), insertion domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bcjq1 a.66.1.1 (Q:67-183) Transducin (alpha subunit), insertion domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zcba1 a.66.1.1 (A:76-201) Transducin (alpha subunit), insertion domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1azta1 a.66.1.1 (A:88-201) Transducin (alpha subunit), insertion domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dvpa2 g.50.1.1 (A:149-220) Hrs {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure